Your browser is old and dusty. Try Google Chrome!

Details for ssr3571

ORF ssr3571
Accession NP_441361.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -81 -95 3.53951 0.163
NP_440795.1_7 Forward -88 -81 13.6088 0.0364
NP_441418.1_6 Reverse -80 -99 -28.9099 0.213
NP_441418.1_6 Forward -89 -70 -29.6965 0.234
NP_442291.1_5 Reverse -79 -95 -4.66135 0.281
NP_441453.1_4 Forward -89 -81 7.09925 0.0962
NP_441453.1_4 Reverse -80 -88 7.00092 0.107
NP_441453.1_7 Forward -122 -115 11.9372 0.298
NP_442151.1_6 Forward -89 -75 6.98109 0.214
NP_440120.1_8 Forward -306 -288 18.112 0.143
NP_442655.1_5 Forward -110 -91 12.1925 0.278
NP_442655.1_10 Forward -231 -212 -19.2734 0.282
NP_442173.1_1 Forward -88 -80 12.3108 0.0316
NP_442173.1_1 Reverse -81 -89 5.91928 0.2
NP_442173.1_3 Forward -121 -111 16.598 0.196
NP_442752.1_4 Reverse -80 -87 4.46401 0.269
NP_442752.1_4 Forward -89 -82 4.36568 0.273
NP_443027.1_4 Forward -91 -81 6.76487 0.269
NP_442975.1_10 Forward -93 -79 19.1735 0.00467
NP_440784.1_7 Reverse -81 -88 6.62729 0.168
NP_440784.1_7 Forward -88 -81 6.52896 0.176
NP_440110.1_8 Forward -174 -155 -2.36049 0.266
NP_442062.1_8 Forward -89 -79 8.04317 0.0816
NP_440304.1_4 Forward -91 -81 10.5998 0.051
NP_441781.1_7 Reverse -80 -99 -0.197208 0.256
NP_439918.1_2 Forward -294 -275 -4.52377 0.278
NP_441619.1_8 Forward -95 -81 6.48882 0.295
NP_442196.1_10 Forward -146 -127 17.3057 0.133
NP_442110.1_7 Reverse -80 -94 11.111 0.0636
NP_440300.1_1 Reverse -280 -299 6.88182 0.281
NP_441925.1_4 Reverse -140 -159 -0.492971 0.155
NP_440856.1_1 Forward -99 -80 0.58944 0.231
NP_441083.1_5 Forward -89 -79 10.8948 0.0174
NP_441083.1_5 Reverse -80 -90 1.74999 0.198
NP_441434.1_1 Reverse -37 -51 8.79688 0.252
NP_440209.1_1 Forward -89 -81 8.67255 0.0333
NP_440209.1_1 Reverse -80 -88 8.57422 0.0425
NP_442889.1_8 Forward -92 -78 9.73373 0.0945
NP_442889.1_10 Forward -215 -196 14.7481 0.149
NP_440178.1_7 Reverse -79 -98 -23.1083 0.294
NP_442570.1_3 Reverse -84 -103 -9.63698 0.3
NP_442111.1_3 Forward -219 -206 13.9081 0.25
NP_442111.1_4 Reverse -79 -93 1.86788 0.293
NP_440343.1_9 Reverse -109 -128 6.78429 0.293
NP_440906.1_5 Forward -88 -81 6.43063 0.223
NP_440906.1_5 Reverse -81 -88 6.3323 0.234
NP_440747.1_10 Reverse -77 -89 5.34885 0.0141
NP_440747.1_10 Forward -92 -80 -11.3674 0.118
NP_441486.1_1 Forward -92 -78 5.1128 0.0391
NP_441486.1_1 Reverse -345 -359 -5.31028 0.231
NP_441486.1_1 Reverse -77 -91 -5.31028 0.231
NP_441194.1_1 Reverse -300 -319 11.6973 0.251
NP_440842.1_10 Forward -132 -118 1.86788 0.281
NP_441014.1_8 Reverse -172 -191 -8.45701 0.283
NP_442848.1_1 Forward -95 -81 -2.85201 0.263
NP_441012.1_4 Forward -93 -80 5.91914 0.286
NP_443018.1_3 Forward -88 -81 5.44732 0.193
NP_443018.1_3 Reverse -81 -88 5.34899 0.212
NP_440376.1_1 Reverse -80 -89 17.2076 0.00278
NP_440376.1_1 Forward -89 -80 10.3245 0.0293
NP_441588.1_4 Forward -87 -77 6.46988 0.193
NP_442687.1_7 Reverse -79 -89 6.66654 0.155
NP_442191.1_7 Forward -148 -129 12.9791 0.206
NP_442485.1_3 Forward -100 -81 -5.11376 0.287
NP_442946.1_7 Reverse -50 -65 12.2259 0.284
NP_441763.1_10 Forward -100 -81 6.1935 0.272
NP_442658.1_1 Forward -97 -87 8.73102 0.181
NP_441414.1_9 Forward -89 -70 -4.32711 0.152
NP_442300.1_5 Forward -193 -174 10.7175 0.289
NP_441958.1_5 Forward -90 -80 11.7798 0.00293
NP_441958.1_5 Reverse -79 -89 2.7333 0.0378
NP_441127.1_1 Forward -351 -337 11.701 0.215
NP_443001.1_7 Reverse -108 -127 5.50599 0.279
NP_440984.1_7 Reverse -75 -89 9.04604 0.131
NP_442690.1_1 Reverse -194 -213 -6.78538 0.169
NP_442911.1_2 Reverse -70 -89 -3.73712 0.117
NP_442911.1_2 Reverse -110 -129 -10.0303 0.268
NP_441580.1_6 Forward -100 -81 -6.1954 0.235
NP_442064.1_1 Reverse -75 -94 -12.5869 0.277
NP_443055.1_6 Forward -137 -119 -2.14486 0.29
NP_441099.1_5 Forward -99 -80 -10.4236 0.253
NP_442002.1_7 Reverse -44 -62 19.576 0.133
NP_442431.1_10 Forward -234 -216 3.75572 0.213
NP_440605.1_1 Forward -113 -94 23.1664 0.0145
NP_440147.1_4 Reverse -78 -91 1.19926 0.235
NP_441550.1_8 Reverse -78 -88 5.09279 0.267
NP_441916.1_7 Reverse -80 -90 17.4829 0.00323
NP_441916.1_10 Forward -97 -78 13.4708 0.122
NP_441916.1_10 Forward -131 -112 3.83436 0.225
NP_440345.1_3 Forward -213 -199 15.0039 0.215
NP_441041.1_4 Reverse -80 -99 -11.6036 0.25
NP_441041.1_7 Forward -92 -80 7.4176 0.167
NP_442396.1_5 Reverse -76 -89 12.409 0.0913
NP_441725.1_5 Reverse -81 -91 1.65166 0.13
NP_439966.1_7 Forward -91 -81 5.48612 0.22
NP_442941.1_3 Reverse -81 -91 10.4031 0.018
NP_442941.1_3 Forward -88 -78 1.65166 0.147
NP_440289.1_2 Forward -92 -79 4.14919 0.0706
NP_440260.1_8 Reverse -83 -101 17.5221 0.0569
NP_440260.1_8 Reverse -166 -184 -7.55234 0.295
NP_442281.1_1 Forward -94 -80 8.06211 0.0869
NP_001035871.2_7 Reverse -116 -126 13.2547 0.219
NP_440498.1_1 Forward -98 -80 -1.06249 0.222
NP_442982.1_5 Forward -99 -80 3.04771 0.212
NP_441644.1_6 Forward -89 -79 14.7292 0.0105
NP_441644.1_6 Reverse -390 -400 9.81266 0.0678
NP_441644.1_6 Reverse -80 -90 9.51767 0.0747
NP_441071.1_3 Reverse -264 -283 7.17681 0.276
NP_441071.1_3 Reverse -364 -383 5.40686 0.276
NP_441795.1_5 Forward -295 -276 15.8307 0.104
NP_442215.1_2 Reverse -78 -94 4.87675 0.0815
NP_442215.1_2 Forward -190 -174 -0.826444 0.173
NP_440253.1_2 Forward -89 -71 -1.06249 0.23
NP_440929.1_8 Forward -89 -80 10.2261 0.0218
NP_440929.1_8 Reverse -80 -89 9.93116 0.0249
NP_442933.1_10 Forward -89 -80 8.45619 0.0741
NP_442933.1_10 Reverse -80 -89 8.06287 0.0885
NP_441751.2_8 Reverse -81 -95 5.89945 0.0407
NP_442554.1_8 Reverse -81 -91 7.45319 0.092
NP_442554.1_8 Forward -88 -78 5.87989 0.135
NP_442554.1_8 Reverse -121 -131 2.63497 0.265
NP_442142.1_4 Forward -92 -79 4.14862 0.231
NP_442292.1_1 Forward -88 -79 9.04618 0.0226
NP_442292.1_1 Reverse -81 -90 7.96454 0.0578
NP_442476.1_6 Forward -88 -74 1.47456 0.214
NP_443009.1_5 Reverse -79 -90 4.97473 0.222
NP_441726.1_4 Reverse -3 -17 15.3392 0.281
NP_442408.2_7 Forward -126 -107 22.5172 0.0522
NP_441715.1_4 Reverse -81 -91 4.99491 0.24
NP_440183.1_1 Reverse -81 -100 9.83255 0.244
NP_440379.1_5 Forward -132 -113 -11.1119 0.288
NP_441468.1_1 Forward -88 -81 6.52896 0.135
NP_441468.1_1 Reverse -81 -88 6.3323 0.202
NP_441020.2_6 Forward -114 -97 9.87194 0.159
NP_441020.2_6 Forward -174 -157 9.57695 0.168
NP_440742.1_4 Reverse -107 -126 22.7139 0.0438
NP_441015.1_8 Forward -231 -212 0.58944 0.277
NP_441015.1_10 Forward -233 -214 -7.96535 0.272
NP_441015.1_10 Forward -111 -92 -11.6036 0.298
NP_441673.1_1 Forward -89 -80 11.4061 0.00254
NP_441673.1_1 Reverse -80 -89 11.3078 0.00437
NP_441876.1_9 Reverse -124 -134 14.3359 0.267
NP_441826.1_2 Forward -95 -81 3.8345 0.105
NP_442868.1_6 Reverse -78 -88 10.4031 0.038
NP_442719.1_2 Reverse -197 -215 -3.52148 0.2
NP_441906.1_5 Reverse -277 -296 11.11 0.225
NP_442505.1_2 Reverse -27 -46 12.2875 0.259
NP_442050.1_5 Forward -91 -81 8.73102 0.217
NP_440558.1_2 Forward -98 -79 -0.000545616 0.197
NP_442789.1_4 Forward -174 -155 -3.83545 0.254
NP_442792.1_5 Forward -128 -111 8.69197 0.296
NP_441878.1_6 Forward -90 -80 1.65166 0.0795
NP_441878.1_6 Reverse -119 -129 1.55333 0.0937
NP_441878.1_6 Forward -130 -120 0.963343 0.128
NP_441878.1_6 Reverse -79 -89 0.865012 0.132
NP_441036.1_8 Forward -90 -80 14.238 0.0278
NP_441557.1_5 Forward -89 -80 10.5211 0.00695
NP_441557.1_5 Reverse -80 -89 10.4228 0.00915
NP_442066.2_9 Reverse -76 -89 10.049 0.158
NP_442183.1_1 Reverse -80 -94 10.9143 0.078
NP_442397.1_9 Forward -89 -70 8.35759 0.246
NP_442347.1_2 Forward -88 -79 3.04799 0.289
NP_442888.1_8 Reverse -115 -134 11.0125 0.221
NP_441037.1_4 Reverse -78 -88 5.95329 0.289
NP_442594.1_8 Forward -149 -130 4.916 0.254
NP_442047.1_2 Forward -121 -107 14.7492 0.19
NP_440136.1_2 Forward -88 -81 6.52896 0.116
NP_440136.1_2 Reverse -81 -88 6.43063 0.154
NP_442590.1_10 Reverse -80 -99 6.68596 0.239
NP_442998.1_10 Forward -87 -80 6.13563 0.181
NP_442998.1_10 Reverse -82 -89 6.0373 0.205
NP_440899.1_2 Forward -100 -81 11.0117 0.142
NP_440299.1_1 Reverse -76 -89 9.5568 0.0699
NP_441799.1_1 Reverse -76 -90 7.27547 0.147
NP_441007.1_10 Forward -94 -81 1.69091 0.203
NP_441362.1_2 Forward -215 -196 20.5824 0.105
NP_441362.1_4 Forward -284 -266 17.8171 0.0462
NP_441559.1_8 Reverse -114 -128 -7.47356 0.294
NP_441270.1_5 Forward -312 -293 11.2376 0.294
NP_441866.1_4 Reverse -198 -211 12.3695 0.282
NP_440134.1_2 Forward -216 -197 5.60432 0.298
NP_442452.1_3 Forward -190 -171 16.8141 0.0828
NP_440306.1_8 Reverse -364 -383 1.17865 0.204
NP_440695.1_6 Forward -216 -202 14.5805 0.215
NP_441199.1_6 Reverse -215 -234 0.884433 0.23
NP_442993.1_1 Reverse -80 -96 9.00665 0.0227
NP_442386.1_9 Reverse -79 -88 4.62087 0.294
NP_440570.1_5 Forward -99 -80 -3.44213 0.289
NP_441750.1_1 Forward -234 -215 -13.1769 0.3
NP_441340.1_5 Forward -88 -81 6.23397 0.132
NP_441340.1_5 Reverse -81 -88 6.13563 0.175
NP_441676.1_9 Reverse -266 -283 11.4445 0.253
NP_442950.1_1 Reverse -63 -82 -4.52377 0.244
NP_440211.1_4 Forward -352 -342 15.713 0.215
NP_440684.1_9 Reverse -74 -88 10.816 0.186
NP_440684.1_9 Forward -95 -81 8.55439 0.226
NP_441262.1_3 Forward -89 -82 5.34899 0.181
NP_441262.1_3 Reverse -80 -87 5.25066 0.215
NP_443051.1_1 Forward -90 -81 10.1278 0.0112
NP_443051.1_1 Reverse -79 -88 0.884706 0.125
NP_439937.1_8 Forward -100 -81 6.09597 0.192
NP_440926.1_9 Reverse -69 -88 8.75091 0.275
NP_443039.1_3 Reverse -197 -216 5.40766 0.286
NP_440439.1_1 Forward -179 -166 2.18257 0.138
NP_439943.1_4 Forward -296 -277 3.34271 0.298
NP_440372.1_2 Forward -88 -81 6.92228 0.0492
NP_440372.1_2 Reverse -81 -88 6.82395 0.0854
NP_440819.1_5 Forward -98 -90 7.8859 0.266
NP_442384.1_10 Forward -89 -76 6.4108 0.102
NP_442790.1_4 Reverse -71 -90 -1.7705 0.105
NP_441689.1_5 Forward -91 -81 8.43603 0.132
NP_440344.1_10 Forward -96 -79 -6.94266 0.115
NP_440344.1_10 Reverse -212 -229 -8.90928 0.135
NP_440297.1_9 Forward -128 -118 6.07655 0.206
NP_440297.1_9 Reverse -81 -91 -0.216628 0.282
NP_443036.1_8 Forward -100 -81 11.9958 0.28
NP_440888.1_2 Reverse -80 -94 13.4703 0.0285
NP_441123.1_3 Reverse -368 -387 16.0274 0.0782
NP_441949.1_5 Forward -321 -302 11.0656 0.274
NP_441949.1_6 Reverse -141 -160 13.5683 0.113
NP_441543.1_2 Forward -88 -79 7.47288 0.117
NP_441543.1_2 Reverse -81 -90 6.39124 0.153
NP_442845.1_2 Forward -301 -287 4.81781 0.251
NP_442845.1_2 Reverse -74 -88 3.73617 0.279
NP_442845.1_2 Forward -109 -95 3.53951 0.287
NP_442845.1_2 Forward -95 -81 3.34284 0.294
NP_442315.1_2 Forward -300 -288 9.47875 0.291
NP_442637.1_3 Forward -328 -309 3.73603 0.202
NP_442578.1_7 Forward -88 -81 11.9372 0.0739
NP_440220.1_4 Reverse -273 -292 -3.34455 0.286
NP_441462.1_2 Reverse -80 -90 18.7612 0.00247
NP_441462.1_2 Forward -89 -79 2.14332 0.0801
NP_441621.1_7 Forward -100 -86 -5.11362 0.248
NP_443062.1_1 Reverse -80 -98 3.67056 0.289
NP_443062.1_6 Forward -165 -146 0.786102 0.288
NP_441601.1_4 Reverse -168 -187 -4.52377 0.293
NP_440519.1_8 Reverse -68 -84 1.23851 0.29
NP_442204.1_1 Forward -183 -172 5.27021 0.213
NP_442204.1_1 Forward -93 -82 0.451995 0.281
NP_440255.1_5 Forward -347 -333 15.5768 0.246
NP_440516.1_8 Forward -89 -80 7.47288 0.0581
NP_440516.1_8 Reverse -80 -89 7.37455 0.0648
NP_442428.1_5 Forward -88 -81 6.43063 0.148
NP_442428.1_5 Reverse -81 -88 6.3323 0.193
NP_442120.1_10 Reverse -80 -99 -7.17871 0.217
NP_440673.1_2 Reverse -338 -357 11.8529 0.162
NP_440673.1_2 Reverse -125 -144 9.51162 0.243
NP_440673.1_3 Forward -87 -80 9.67555 0.179
NP_441052.1_2 Forward -89 -79 10.5014 0.0285
NP_441052.1_2 Reverse -80 -90 0.865012 0.256
NP_442219.1_9 Forward -88 -79 8.55452 0.0681
NP_440436.1_4 Forward -88 -79 7.96411 0.119
NP_441884.1_9 Forward -92 -73 -23.305 0.284
NP_440314.1_9 Reverse -81 -100 -5.60541 0.225
NP_440314.1_9 Forward -88 -69 -8.45701 0.248
NP_441719.1_2 Reverse -77 -91 15.5589 0.265
NP_441719.1_4 Forward -88 -81 6.92228 0.0565
NP_441719.1_4 Reverse -81 -88 6.82395 0.0855
NP_441004.1_1 Forward -101 -82 -4.52377 0.171
NP_441004.1_4 Forward -322 -312 7.94484 0.282
NP_442366.1_3 Reverse -79 -97 -4.40575 0.271
NP_442366.1_5 Reverse -77 -87 14.2375 0.0497
NP_442366.1_5 Forward -191 -181 10.206 0.282
NP_439949.1_7 Forward -353 -339 14.8476 0.215
NP_442176.1_4 Forward -109 -90 22.0256 0.0127
NP_443054.1_2 Forward -359 -345 2.16287 0.245
NP_443054.1_2 Forward -91 -77 -0.393733 0.294
NP_441851.1_10 Reverse -79 -89 6.46988 0.167
NP_442208.1_5 Forward -143 -124 -1.67217 0.252
NP_442515.1_1 Forward -90 -76 -4.7203 0.298
NP_440593.1_9 Reverse -123 -137 10.9143 0.24
NP_441982.1_6 Forward -208 -199 13.2493 0.274
NP_442689.1_8 Reverse -198 -215 3.28376 0.172
NP_441349.1_10 Forward -99 -80 -5.50708 0.204
NP_440474.1_8 Reverse -81 -95 4.03056 0.294
NP_441124.1_5 Reverse -203 -213 13.5811 0.215
NP_440431.1_3 Forward -90 -71 2.94938 0.0923
NP_440588.1_2 Reverse -77 -96 -6.58872 0.285
NP_441003.1_9 Reverse -111 -130 5.80098 0.257
NP_442038.1_1 Forward -224 -205 0.884433 0.278
NP_441570.1_1 Reverse -80 -98 -8.73231 0.12
NP_441078.1_4 Forward -89 -80 10.2261 0.0136
NP_441078.1_4 Reverse -80 -89 10.1278 0.016
NP_442729.1_8 Reverse -76 -89 8.18076 0.125
NP_442348.1_2 Reverse -119 -128 8.1612 0.28
NP_442443.1_1 Forward -143 -124 -5.50708 0.282
NP_441432.1_8 Forward -90 -81 7.57121 0.0962
NP_441432.1_8 Reverse -79 -88 7.27622 0.101
NP_441333.1_1 Forward -370 -360 15.1171 0.175
NP_442320.1_8 Reverse -74 -88 -4.91696 0.192
NP_442320.1_8 Forward -95 -81 -5.31028 0.217
NP_441732.1_2 Forward -93 -77 -6.62797 0.0495
NP_441328.2_8 Forward -25 -6 16.6165 0.268
NP_442353.1_4 Forward -95 -76 -0.689632 0.29
NP_441072.1_2 Forward -239 -220 5.40766 0.296
NP_442400.1_10 Forward -30 -17 7.41465 0.286
NP_442489.1_7 Forward -89 -80 10.7178 0.00742
NP_442489.1_7 Reverse -80 -89 10.6195 0.00984
NP_440559.1_1 Forward -88 -79 7.96454 0.0739
NP_441659.2_6 Forward -317 -298 17.4032 0.0922
NP_441659.2_8 Reverse -80 -90 17.9746 0.00155
NP_441659.2_8 Forward -89 -79 8.73149 0.0401
NP_442913.1_10 Forward -98 -79 -5.70374 0.276
NP_441040.1_2 Reverse -78 -97 -4.52377 0.168
NP_440335.1_9 Forward -46 -28 13.3922 0.23
NP_442776.1_1 Forward -123 -104 7.17762 0.209
NP_442346.1_5 Reverse -79 -89 12.8614 0.0349
NP_442346.1_5 Forward -90 -80 6.8632 0.188
NP_442346.1_5 Forward -320 -310 4.3066 0.291
NP_440352.1_5 Forward -56 -37 10.9037 0.27
NP_440545.1_3 Reverse -76 -93 -7.04099 0.295
NP_440486.1_6 Forward -109 -90 13.4708 0.207
NP_440486.1_6 Forward -102 -83 5.211 0.3
NP_440010.1_10 Forward -191 -172 1.57275 0.297
NP_442732.1_2 Forward -45 -26 15.5152 0.249
NP_441833.1_4 Forward -88 -81 6.52896 0.0924
NP_441833.1_4 Reverse -81 -88 6.43063 0.125
NP_442498.1_7 Forward -193 -176 17.9423 0.131
NP_442162.1_9 Forward -88 -81 6.82395 0.0927
NP_442162.1_9 Reverse -81 -88 6.72562 0.116
NP_440671.1_4 Forward -95 -81 16.5192 0.0288
NP_443026.1_5 Forward -294 -275 -4.72043 0.283
NP_442021.1_3 Forward -326 -307 3.6377 0.153
NP_442021.1_3 Reverse -74 -93 -7.76869 0.28
NP_441609.1_1 Forward -30 -11 -1.47551 0.269
NP_441813.1_5 Forward -91 -81 6.46988 0.0908
NP_440567.1_1 Forward -88 -74 2.06454 0.184
NP_440567.1_1 Reverse -81 -95 0.491246 0.244
NP_442497.1_10 Reverse -81 -90 8.06287 0.0643
NP_442497.1_10 Forward -88 -79 0.983037 0.123
NP_440821.1_4 Forward -91 -81 1.65166 0.132
NP_440821.1_4 Reverse -78 -88 -0.118297 0.229
NP_440227.1_2 Reverse -195 -211 9.30165 0.29
NP_441239.1_9 Forward -91 -79 3.18557 0.292
NP_441769.1_3 Forward -30 -11 4.62021 0.159
NP_441617.1_6 Reverse -197 -216 2.16274 0.2
NP_440675.1_1 Reverse -77 -96 7.17762 0.195
NP_440462.1_6 Forward -91 -81 7.45319 0.0788
NP_442144.1_1 Reverse -77 -93 11.6616 0.296
NP_442499.1_3 Reverse -79 -97 3.55906 0.289
NP_441249.1_8 Forward -300 -281 14.6508 0.115
NP_442479.1_9 Reverse -331 -350 -13.7669 0.29
NP_441474.1_1 Reverse -169 -188 4.22689 0.221
NP_442402.1_4 Reverse -364 -383 -0.689632 0.189
NP_442402.1_4 Reverse -190 -209 -9.14605 0.285
NP_442402.1_9 Reverse -83 -102 8.84924 0.278
NP_441848.1_4 Forward -213 -197 10.6064 0.25
NP_441848.1_7 Reverse -205 -224 -1.8696 0.257
NP_441926.1_3 Reverse -80 -96 7.53169 0.17
NP_442837.1_3 Forward -88 -81 6.43063 0.212
NP_442837.1_3 Reverse -81 -88 6.23397 0.244
NP_440160.1_2 Forward -130 -111 0.0977854 0.228
NP_442053.1_1 Reverse -80 -89 9.34117 0.0666
NP_442053.1_1 Forward -89 -80 9.04618 0.0689
NP_440505.1_3 Forward -91 -81 12.0747 0.0596
NP_442532.1_1 Forward -52 -38 11.8628 0.215
NP_440914.1_1 Reverse -390 -400 11.3477 0.097
NP_440914.1_1 Forward -89 -79 8.12715 0.207
NP_440914.1_1 Reverse -80 -90 6.95605 0.257
NP_441011.1_8 Reverse -81 -90 7.17789 0.179
NP_442533.1_6 Forward -89 -80 14.5527 0.0116
NP_442533.1_6 Reverse -80 -89 7.86621 0.0862
NP_440263.1_5 Reverse -199 -213 8.94771 0.294
NP_442322.1_8 Forward -218 -200 18.8139 0.268
NP_441482.1_7 Forward -95 -81 -2.95034 0.103
NP_439944.1_9 Reverse -81 -91 8.1415 0.116
NP_442269.1_10 Reverse -69 -88 3.6377 0.248
NP_440116.1_8 Reverse -81 -100 -9.24366 0.271
NP_441527.1_4 Forward -52 -33 -11.9847 0.285
NP_440007.1_9 Forward -93 -79 2.94952 0.277
NP_442728.1_6 Forward -238 -219 15.9291 0.122
NP_440063.1_5 Forward -52 -33 23.1072 0.0459
NP_441972.1_5 Forward -88 -69 -10.1286 0.299
NP_441106.1_1 Forward -90 -81 9.04618 0.0371
NP_441106.1_1 Reverse -79 -88 6.8829 0.087
NP_439903.1_6 Reverse -308 -327 0.785326 0.256
NP_439903.1_6 Forward -92 -73 0.686995 0.258
NP_441286.1_1 Reverse -79 -91 4.8572 0.0272
NP_441286.1_1 Forward -90 -78 -5.95921 0.235
NP_442674.1_2 Forward -57 -38 8.94757 0.236
NP_442674.1_3 Reverse -171 -190 7.17681 0.219
NP_440670.1_8 Forward -89 -80 8.94785 0.0606
NP_440670.1_8 Reverse -80 -89 8.84951 0.0606
NP_441930.1_3 Forward -44 -25 5.75208 0.263
NP_440886.1_7 Reverse -79 -89 6.96107 0.112
NP_440886.1_7 Reverse -147 -157 3.91283 0.26
NP_442072.1_9 Reverse -79 -97 -23.0886 0.277
NP_441753.1_10 Forward -98 -79 1.27776 0.272
NP_441403.1_4 Reverse -123 -141 12.2122 0.282
NP_441021.1_1 Reverse -81 -100 -4.72043 0.172
NP_441626.1_2 Reverse -81 -88 12.6255 0.0468
NP_441626.1_2 Forward -88 -81 6.3323 0.155
NP_440387.1_1 Reverse -80 -96 8.61333 0.0282
NP_440387.1_1 Forward -89 -73 2.91013 0.0693
NP_441193.1_1 Reverse -278 -297 12.1917 0.229
NP_439910.1_2 Reverse -362 -379 -13.4325 0.162
NP_440457.1_1 Forward -176 -164 5.34885 0.141
NP_440457.1_1 Forward -93 -81 4.8572 0.151
NP_440987.1_4 Forward -215 -196 4.62101 0.239
NP_442680.1_7 Forward -214 -195 2.45773 0.253
NP_440801.1_8 Reverse -218 -237 1.86774 0.236
NP_442509.1_9 Forward -228 -218 11.091 0.147
NP_440554.1_4 Reverse -81 -91 6.56821 0.121
NP_442862.1_3 Reverse -332 -349 5.25038 0.279
NP_441845.1_6 Forward -101 -83 8.08229 0.133
NP_441885.1_5 Forward -89 -79 11.4848 0.00668
NP_441885.1_5 Reverse -80 -90 1.84832 0.0957
NP_442341.1_9 Forward -91 -77 7.27547 0.202
NP_441173.1_9 Forward -345 -337 9.85212 0.275
NP_443000.1_7 Forward -91 -81 8.23984 0.0483
NP_443000.1_7 Reverse -78 -88 0.766681 0.29
NP_440507.2_3 Forward -98 -79 9.34008 0.226
NP_440275.1_3 Reverse -78 -88 7.05986 0.0901
NP_442451.1_2 Forward -84 -65 -9.047 0.258
NP_442638.1_3 Reverse -9 -28 10.1695 0.298
NP_440258.1_7 Forward -371 -352 12.2703 0.287
NP_440258.1_7 Reverse -36 -55 11.9838 0.287
NP_440880.1_2 Forward -29 -10 16.09 0.238
NP_440880.1_5 Forward -299 -281 24.0119 0.00745
NP_442495.1_4 Forward -138 -128 11.1898 0.283
NP_442495.1_5 Forward -106 -87 10.9142 0.23
NP_442373.1_2 Forward -175 -156 -7.4737 0.233
NP_442373.1_2 Forward -291 -272 -11.3086 0.293
NP_440216.1_1 Reverse -80 -94 -11.4068 0.184
NP_440216.1_9 Forward -121 -112 5.3096 0.298
NP_440172.1_1 Reverse -80 -90 8.04317 0.0692
NP_440172.1_1 Forward -89 -79 5.5849 0.14
NP_441226.1_7 Forward -88 -81 11.8385 0.0485
NP_441226.1_7 Reverse -287 -294 5.34865 0.289
NP_441111.1_7 Forward -88 -80 9.26253 0.0107
NP_441111.1_7 Reverse -81 -89 9.1642 0.0184
NP_441766.1_2 Forward -89 -80 14.2577 0.0103
NP_441766.1_2 Reverse -80 -89 7.96454 0.0694
NP_442417.1_5 Reverse -80 -94 11.2093 0.105
NP_440416.1_1 Reverse -80 -99 -5.01543 0.138
NP_440416.1_9 Reverse -168 -187 -17.7985 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGTCATCGGTTACATATTGGGGGAGACGTTGTTTAATTTTACGGTAATGGCAGATTTAGCAAATTATCTAACTGGTTTAGGGTAACGGTTTGTTACGAGTGTTAAGGGTTGGGAGTTTGTTGGGTAGGCTAATGATTGTCGGTTCTAAATTAGAATTCCTATGTCGGACGTGATGATCCGGGTAGAAAATTTAGGCAAAAAGTACATGATTGGCCACCAAGCAGAGGGGCGGTCTAATTATGGGTTGTTGCGGGATGTGCTAGCAGATGGGGCCAAGTCCCTGGTAAAGCGGTTTACGGGCCGGGACAAAGGCGGTCGCCAAAATAGTTCCCTCCTCTCCAATTGATGAAATAAGATAAATTAAGTAGCAAATTTGATCAATATCTACAAGGATTAAAA

CDS

ATGGAAACCATTAATTATCAACAATTCTCTGAAAAACTGCCCACTTTGGTAGAAAAAATAGGTAATGAGCAAGAACCTCTCTGTCTAGAGCTTCCGAATTATTTACGAGCTGTTATTATATCTGAGCAAGATTACCGTAGTTTGATGGAAACTGTTTATCTGTTGAGTAACCCTGTTAATGCTGAAAAGTTATTAACTACCGCTAGTCGATCAATTGATCAAGCTACATCGTGGACAAAAGTAAAAAATGACTTAGGACTATGA

Protein

METINYQQFSEKLPTLVEKIGNEQEPLCLELPNYLRAVIISEQDYRSLMETVYLLSNPVNAEKLLTTASRSIDQATSWTKVKNDLGL