Your browser is old and dusty. Try Google Chrome!

Details for ssr3570

ORF ssr3570
Accession NP_441360.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -273 -254 -28.9099 0.213
NP_441418.1_6 Forward -368 -349 -29.4015 0.224
NP_441453.1_4 Forward -368 -360 6.80426 0.121
NP_441453.1_4 Reverse -359 -367 6.11594 0.121
NP_441818.1_1 Reverse -360 -371 14.4145 0.0502
NP_440226.1_1 Reverse -359 -378 3.6377 0.218
NP_441630.1_3 Forward -376 -357 -1.37718 0.298
NP_440120.1_8 Forward -67 -49 18.112 0.143
NP_442173.1_1 Reverse -360 -368 12.0158 0.0316
NP_442173.1_1 Forward -367 -359 4.83764 0.241
NP_442752.1_4 Forward -368 -361 13.8055 0.0199
NP_443027.1_4 Forward -209 -199 6.27322 0.286
NP_440784.1_7 Forward -367 -360 6.23397 0.241
NP_440784.1_7 Reverse -360 -367 6.13563 0.241
NP_439918.1_2 Forward -55 -36 -4.52377 0.278
NP_442110.1_7 Forward -374 -360 0.392915 0.261
NP_440300.1_1 Reverse -41 -60 6.88182 0.281
NP_441083.1_5 Reverse -359 -369 17.7779 0.00336
NP_441083.1_5 Forward -368 -358 7.05986 0.067
NP_441738.1_2 Reverse -361 -368 15.28 0.0102
NP_440209.1_1 Forward -368 -360 8.57422 0.0425
NP_440209.1_1 Reverse -359 -367 5.52596 0.0821
NP_442889.1_8 Forward -210 -196 8.3571 0.123
NP_442889.1_8 Forward -290 -276 5.80051 0.213
NP_440178.1_7 Reverse -358 -377 -22.6167 0.268
NP_442461.1_2 Reverse -377 -396 16.1257 0.216
NP_442111.1_4 Reverse -358 -372 9.63603 0.0593
NP_441624.1_7 Forward -380 -366 8.25939 0.24
NP_440906.1_5 Forward -272 -265 8.79057 0.149
NP_440906.1_5 Forward -367 -360 6.23397 0.234
NP_440906.1_5 Reverse -360 -367 6.13563 0.241
NP_442596.1_10 Reverse -373 -392 6.39097 0.293
NP_440747.1_10 Forward -371 -359 -2.61596 0.0556
NP_440747.1_10 Reverse -356 -368 -4.38592 0.0974
NP_441130.1_10 Reverse -357 -371 6.88276 0.173
NP_441854.1_10 Reverse -303 -322 1.57275 0.282
NP_441486.1_1 Forward -371 -357 -2.36035 0.175
NP_441486.1_1 Reverse -106 -120 -5.31028 0.231
NP_441486.1_1 Forward -163 -149 -5.70361 0.254
NP_441194.1_1 Reverse -61 -80 11.6973 0.251
NP_442634.1_3 Reverse -253 -272 9.93006 0.248
NP_441265.1_1 Reverse -212 -231 -10.9153 0.217
NP_441014.1_8 Reverse -352 -371 -7.96535 0.282
NP_442848.1_1 Forward -374 -360 -0.885388 0.263
NP_443018.1_3 Reverse -360 -367 11.7405 0.0655
NP_443018.1_3 Forward -367 -360 5.44732 0.193
NP_440376.1_1 Forward -368 -359 5.99792 0.111
NP_440376.1_1 Reverse -359 -368 -0.196935 0.285
NP_441588.1_4 Reverse -153 -163 5.38824 0.272
NP_442687.1_7 Reverse -358 -368 5.97822 0.179
NP_441846.1_10 Reverse -378 -397 -21.83 0.256
NP_441029.1_4 Forward -364 -345 2.75272 0.22
NP_440741.1_1 Forward -228 -209 11.2084 0.143
NP_442658.1_1 Forward -388 -378 5.19112 0.28
NP_442198.1_7 Reverse -241 -260 12.9783 0.185
NP_440141.1_8 Reverse -363 -382 5.89931 0.271
NP_440662.1_2 Reverse -343 -362 -3.63879 0.276
NP_441414.1_9 Forward -368 -349 -9.44032 0.259
NP_441256.1_8 Forward -346 -327 5.11266 0.272
NP_441958.1_5 Reverse -358 -368 0.865012 0.12
NP_441958.1_5 Forward -369 -359 0.865012 0.12
NP_441127.1_1 Forward -112 -98 11.701 0.215
NP_442605.1_4 Forward -254 -235 10.0292 0.275
NP_439905.1_1 Reverse -360 -373 10.049 0.216
NP_442911.1_2 Reverse -349 -368 -10.1286 0.27
NP_440153.1_5 Reverse -360 -374 11.3077 0.0763
NP_443055.1_6 Reverse -351 -369 -1.45654 0.279
NP_440827.1_3 Forward -379 -360 11.4058 0.268
NP_441099.1_5 Reverse -349 -368 -6.88371 0.167
NP_441294.1_7 Reverse -150 -164 8.57871 0.294
NP_441000.1_6 Reverse -358 -372 4.52282 0.0953
NP_440147.1_4 Reverse -357 -370 1.59258 0.224
NP_441550.1_8 Forward -370 -360 13.8442 0.0207
NP_441550.1_8 Reverse -357 -367 13.0576 0.0273
NP_441550.1_8 Forward -162 -152 7.64939 0.153
NP_441041.1_7 Reverse -356 -368 5.6684 0.245
NP_441041.1_7 Reverse -261 -273 5.27969 0.265
NP_441725.1_5 Forward -367 -357 0.0783647 0.215
NP_439966.1_7 Forward -370 -360 5.58445 0.216
NP_439966.1_9 Forward -275 -266 7.57121 0.253
NP_442941.1_3 Reverse -360 -370 9.41981 0.0319
NP_440289.1_2 Forward -276 -263 0.412608 0.163
NP_440289.1_2 Reverse -259 -272 -2.63565 0.261
NP_440289.1_2 Forward -371 -358 -4.9956 0.294
NP_440983.1_9 Reverse -158 -177 1.86774 0.292
NP_440260.1_8 Reverse -269 -287 4.83737 0.154
NP_442281.1_1 Reverse -354 -368 12.0937 0.0409
NP_442256.1_2 Reverse -357 -375 1.69077 0.107
NP_440437.1_1 Reverse -212 -231 -5.01543 0.273
NP_442012.1_2 Forward -370 -351 2.94938 0.239
NP_441457.1_7 Reverse -346 -365 1.57275 0.276
NP_441644.1_6 Reverse -359 -369 14.4342 0.0126
NP_441644.1_6 Reverse -151 -161 9.81266 0.0678
NP_443049.1_6 Forward -369 -359 14.4711 0.114
NP_441071.1_3 Reverse -25 -44 7.17681 0.276
NP_441071.1_3 Reverse -125 -144 5.40686 0.276
NP_441795.1_5 Forward -56 -37 15.8307 0.104
NP_440929.1_8 Reverse -359 -368 7.07956 0.0713
NP_442554.1_8 Reverse -360 -370 6.37155 0.12
NP_442554.1_8 Forward -367 -357 2.33998 0.274
NP_441762.1_7 Reverse -263 -275 5.15219 0.0443
NP_441762.1_7 Forward -369 -357 -7.33585 0.287
NP_442142.1_4 Reverse -356 -369 6.0169 0.175
NP_442292.1_1 Reverse -360 -369 8.65285 0.0335
NP_440919.1_1 Forward -373 -354 0.884433 0.221
NP_442476.1_6 Reverse -360 -374 0.982901 0.233
NP_441264.1_5 Reverse -249 -268 19.8623 0.000343
NP_442408.2_1 Forward -374 -355 -2.75381 0.241
NP_441715.1_4 Reverse -360 -370 7.55152 0.108
NP_441468.1_1 Forward -367 -360 6.13563 0.209
NP_441468.1_1 Reverse -360 -367 6.0373 0.223
NP_441673.1_1 Forward -368 -359 1.37636 0.114
NP_441673.1_1 Reverse -359 -368 1.1797 0.163
NP_441956.1_9 Forward -375 -356 6.19431 0.274
NP_441826.1_2 Forward -374 -360 3.24451 0.113
NP_441826.1_5 Reverse -360 -379 2.45773 0.276
NP_441637.1_8 Forward -364 -347 11.9369 0.209
NP_442868.1_6 Forward -370 -360 9.51814 0.0447
NP_442719.1_2 Forward -395 -377 -11.8796 0.297
NP_442427.1_8 Reverse -350 -369 6.88262 0.227
NP_442808.1_1 Reverse -358 -368 9.71433 0.0481
NP_442808.1_1 Forward -274 -264 4.89613 0.185
NP_442692.1_1 Reverse -349 -368 -6.49039 0.296
NP_441906.1_5 Reverse -38 -57 11.11 0.225
NP_442542.1_9 Reverse -204 -218 5.01387 0.279
NP_442050.1_1 Reverse -365 -384 9.93088 0.247
NP_441493.2_10 Reverse -348 -367 8.06259 0.249
NP_441878.1_6 Reverse -358 -368 0.57002 0.14
NP_441557.1_5 Forward -368 -359 1.08137 0.0794
NP_441557.1_5 Reverse -359 -368 0.589713 0.134
NP_441433.1_3 Reverse -354 -373 18.9773 0.0733
NP_442183.1_1 Reverse -264 -278 11.0127 0.0775
NP_442347.1_2 Reverse -360 -369 10.3245 0.058
NP_442347.1_2 Reverse -199 -208 4.52295 0.282
NP_442645.1_2 Forward -376 -357 -22.0267 0.29
NP_440690.1_8 Reverse -253 -272 18.1898 0.0459
NP_441633.1_3 Forward -370 -357 -6.56889 0.259
NP_440136.1_2 Forward -367 -360 6.23397 0.171
NP_440136.1_2 Reverse -360 -367 6.13563 0.193
NP_440136.1_2 Forward -272 -265 4.26735 0.218
NP_442590.1_10 Reverse -359 -378 15.1424 0.113
NP_442998.1_5 Reverse -328 -338 14.533 0.149
NP_442998.1_5 Reverse -385 -395 8.33817 0.264
NP_442998.1_10 Reverse -361 -368 15.5754 0.0102
NP_441799.1_1 Reverse -355 -369 9.43874 0.0922
NP_442333.2_5 Forward -385 -366 -9.83364 0.246
NP_441362.1_4 Forward -45 -27 17.8171 0.0462
NP_441559.1_8 Forward -361 -347 -1.5737 0.184
NP_442756.1_2 Reverse -351 -370 3.83436 0.296
NP_441270.1_5 Forward -73 -54 11.2376 0.294
NP_440915.1_6 Forward -372 -358 9.04604 0.047
NP_442866.1_1 Forward -362 -343 0.392778 0.182
NP_440306.1_8 Reverse -125 -144 1.17865 0.204
NP_442993.1_1 Reverse -208 -224 -13.9045 0.295
NP_442386.1_2 Forward -336 -317 16.5025 0.102
NP_442386.1_9 Forward -274 -265 6.68581 0.219
NP_442386.1_9 Reverse -358 -367 4.52254 0.297
NP_440570.1_5 Forward -348 -329 -0.983855 0.266
NP_442054.1_2 Reverse -211 -230 25.4672 0.000147
NP_442054.1_3 Reverse -256 -275 8.65258 0.0469
NP_441340.1_5 Forward -367 -360 13.5105 0.0314
NP_441340.1_5 Reverse -360 -367 5.84064 0.208
NP_442484.1_2 Forward -379 -360 3.14605 0.21
NP_441676.1_9 Reverse -27 -44 11.4445 0.253
NP_440161.1_3 Forward -370 -351 9.73422 0.238
NP_440211.1_4 Forward -113 -103 15.713 0.215
NP_440586.1_8 Reverse -360 -367 9.47853 0.146
NP_440586.1_8 Forward -367 -360 5.74197 0.283
NP_441262.1_3 Forward -368 -361 14.7888 0.0223
NP_443051.1_1 Forward -369 -360 7.47288 0.0571
NP_443051.1_1 Reverse -358 -367 -1.18024 0.297
NP_440439.1_1 Forward -371 -358 2.96921 0.122
NP_439943.1_4 Forward -57 -38 3.34271 0.298
NP_440372.1_2 Forward -367 -360 13.8055 0.0214
NP_440372.1_2 Reverse -360 -367 6.52896 0.188
NP_442285.1_8 Reverse -332 -351 17.1082 0.247
NP_441803.1_2 Forward -386 -367 1.86774 0.223
NP_441572.1_7 Reverse -366 -385 0.687771 0.162
NP_440267.1_2 Reverse -342 -356 5.01387 0.285
NP_442384.1_10 Reverse -359 -372 10.344 0.0461
NP_442384.1_10 Reverse -151 -164 9.45906 0.0536
NP_442790.1_4 Forward -377 -358 -14.3569 0.274
NP_442262.1_10 Reverse -360 -367 13.2155 0.0213
NP_440344.1_10 Reverse -352 -369 -1.92778 0.0588
NP_442910.1_1 Reverse -352 -371 -4.72043 0.254
NP_442187.1_3 Forward -369 -359 15.6147 0.105
NP_441103.1_2 Forward -379 -361 8.86816 0.178
NP_440888.1_2 Reverse -359 -373 15.8302 0.00862
NP_441123.1_3 Reverse -129 -148 16.0274 0.0782
NP_441123.1_4 Reverse -359 -373 20.1568 0.0308
NP_441949.1_5 Forward -82 -63 11.0656 0.274
NP_441543.1_2 Reverse -360 -369 7.07956 0.131
NP_442845.1_2 Forward -166 -152 6.78443 0.202
NP_442845.1_2 Forward -62 -48 4.81781 0.251
NP_442315.1_2 Forward -61 -49 9.47875 0.291
NP_442637.1_3 Forward -89 -70 3.73603 0.202
NP_442578.1_7 Forward -367 -360 6.0373 0.18
NP_440220.1_4 Reverse -34 -53 -3.34455 0.286
NP_441462.1_2 Forward -368 -358 16.1063 0.00406
NP_441929.1_3 Forward -244 -225 5.30933 0.266
NP_441601.1_2 Reverse -145 -164 -3.63879 0.28
NP_440277.1_4 Reverse -378 -397 14.8474 0.191
NP_442204.1_1 Forward -372 -361 9.79344 0.0736
NP_440255.1_5 Forward -108 -94 15.5768 0.246
NP_442872.1_1 Forward -389 -370 -11.8986 0.252
NP_440516.1_8 Forward -368 -359 18.9776 0.00442
NP_440516.1_8 Reverse -359 -368 5.01461 0.118
NP_442428.1_5 Reverse -199 -206 7.90559 0.0969
NP_442428.1_5 Forward -367 -360 6.13563 0.209
NP_442428.1_5 Reverse -360 -367 6.0373 0.212
NP_441443.1_1 Reverse -204 -223 -5.9004 0.3
NP_440673.1_2 Reverse -99 -118 11.8529 0.162
NP_440673.1_3 Reverse -361 -368 12.4288 0.0426
NP_441052.1_2 Reverse -359 -369 10.6981 0.0285
NP_442219.1_8 Reverse -319 -338 8.36037 0.249
NP_442219.1_9 Reverse -360 -369 7.96454 0.0696
NP_440436.1_4 Reverse -360 -369 7.57079 0.124
NP_440314.1_9 Forward -252 -233 -9.047 0.258
NP_441719.1_4 Forward -367 -360 6.82395 0.0855
NP_441719.1_4 Reverse -360 -367 6.52896 0.188
NP_441733.1_10 Forward -276 -263 7.19745 0.156
NP_441004.1_4 Forward -83 -73 7.94484 0.282
NP_439949.1_7 Forward -114 -100 14.8476 0.215
NP_442694.1_4 Reverse -272 -281 11.6028 0.277
NP_440328.1_4 Forward -374 -355 2.55606 0.199
NP_443054.1_2 Forward -120 -106 2.16287 0.245
NP_442586.1_7 Reverse -218 -237 15.4008 0.287
NP_441542.1_4 Reverse -382 -396 4.91614 0.264
NP_441668.1_4 Reverse -349 -368 -0.39387 0.252
NP_442515.1_1 Reverse -283 -297 -3.93365 0.298
NP_441046.1_2 Forward -171 -152 -1.67217 0.292
NP_441349.1_10 Reverse -349 -368 -8.65367 0.278
NP_439960.1_2 Forward -374 -355 16.2241 0.112
NP_442450.1_5 Reverse -357 -367 8.23984 0.13
NP_440943.1_4 Reverse -256 -268 17.1486 0.0959
NP_442243.1_1 Forward -374 -356 6.21323 0.178
NP_441078.1_4 Forward -368 -359 0.196389 0.205
NP_441078.1_4 Reverse -359 -368 -0.000272808 0.205
NP_442443.1_1 Reverse -344 -363 -4.72043 0.276
NP_441432.1_8 Forward -369 -360 14.0611 0.0258
NP_441333.1_1 Forward -131 -121 15.1171 0.175
NP_441732.1_2 Reverse -355 -371 -17.5427 0.27
NP_441030.1_6 Reverse -357 -376 14.8731 0.184
NP_442003.1_4 Reverse -360 -379 9.83255 0.299
NP_442510.1_3 Reverse -350 -369 13.9625 0.245
NP_442489.1_7 Forward -368 -359 0.688044 0.152
NP_442489.1_7 Reverse -359 -368 0.688044 0.152
NP_442079.1_7 Forward -367 -348 1.76941 0.241
NP_440559.1_1 Reverse -360 -369 7.76787 0.0918
NP_440559.1_1 Forward -367 -358 6.39124 0.134
NP_441659.2_6 Forward -78 -59 17.4032 0.0922
NP_441659.2_8 Reverse -359 -369 5.48657 0.106
NP_441659.2_8 Forward -368 -358 0.275027 0.27
NP_441040.1_2 Forward -376 -357 -13.7669 0.284
NP_442008.1_2 Reverse -356 -375 6.29264 0.223
NP_442346.1_5 Reverse -358 -368 4.3066 0.291
NP_442346.1_5 Forward -81 -71 4.3066 0.291
NP_440545.1_3 Reverse -355 -372 -5.86102 0.262
NP_440486.1_6 Reverse -381 -400 11.8975 0.207
NP_440459.1_2 Reverse -357 -374 10.3636 0.2
NP_442603.1_7 Reverse -359 -373 16.7152 0.0291
NP_441585.1_5 Reverse -341 -360 7.17681 0.211
NP_441948.1_4 Reverse -257 -275 -1.65248 0.148
NP_440170.1_2 Forward -380 -361 4.22769 0.296
NP_441833.1_4 Reverse -360 -367 6.52896 0.0924
NP_441833.1_4 Forward -367 -360 6.23397 0.163
NP_442162.1_9 Forward -367 -360 12.9205 0.0282
NP_442162.1_9 Reverse -360 -367 12.9205 0.0282
NP_443026.1_5 Forward -55 -36 -4.72043 0.283
NP_442073.1_6 Reverse -350 -369 1.67108 0.25
NP_442140.1_3 Reverse -360 -370 8.23984 0.122
NP_442140.1_3 Forward -367 -357 6.07655 0.184
NP_442021.1_3 Forward -87 -68 3.6377 0.153
NP_441813.1_5 Forward -370 -360 8.4365 0.0432
NP_441813.1_5 Reverse -357 -367 5.68323 0.113
NP_440590.1_4 Reverse -360 -373 11.7207 0.0187
NP_440035.1_6 Reverse -258 -277 7.57094 0.283
NP_442497.1_10 Forward -367 -358 1.08137 0.115
NP_442497.1_10 Reverse -360 -369 0.589713 0.153
NP_440821.1_4 Forward -275 -265 3.51995 0.131
NP_440821.1_4 Forward -370 -360 -0.314959 0.251
NP_441239.1_9 Reverse -357 -369 9.18376 0.113
NP_441951.1_4 Reverse -359 -378 0.294447 0.297
NP_441727.1_3 Reverse -352 -371 7.96426 0.213
NP_440400.1_1 Forward -387 -368 -1.67294 0.285
NP_441892.1_1 Forward -383 -366 -3.50107 0.242
NP_440665.1_1 Forward -242 -223 -11.6036 0.244
NP_440604.1_2 Forward -165 -146 19.764 0.127
NP_440740.1_7 Forward -236 -218 17.6204 0.0646
NP_442216.1_2 Reverse -247 -266 19.2723 0.000859
NP_442216.1_4 Forward -354 -346 8.1805 0.255
NP_440546.1_4 Forward -368 -358 14.9908 0.0459
NP_440462.1_6 Forward -275 -265 5.48657 0.15
NP_440868.1_4 Forward -372 -360 8.00379 0.0602
NP_441249.1_8 Forward -61 -42 14.6508 0.115
NP_442479.1_9 Forward -328 -309 -8.94866 0.266
NP_442479.1_9 Reverse -92 -111 -13.7669 0.29
NP_442402.1_4 Reverse -125 -144 -0.689632 0.189
NP_442039.1_4 Forward -367 -360 11.6422 0.0747
NP_442039.1_5 Forward -275 -256 17.0107 0.265
NP_442837.1_3 Forward -367 -360 6.0373 0.25
NP_442837.1_3 Reverse -360 -367 6.0373 0.25
NP_442053.1_1 Reverse -359 -368 14.4544 0.0114
NP_442053.1_1 Forward -368 -359 7.86621 0.0863
NP_440505.1_3 Forward -370 -360 16.7946 0.00614
NP_441701.1_3 Forward -366 -349 8.59364 0.247
NP_442456.1_5 Reverse -374 -392 11.2289 0.26
NP_440914.1_1 Reverse -359 -369 13.1043 0.0386
NP_440914.1_1 Reverse -151 -161 11.3477 0.097
NP_441011.1_8 Forward -367 -358 9.24284 0.131
NP_441011.1_8 Reverse -265 -274 9.04618 0.141
NP_442101.1_10 Forward -174 -155 -13.3736 0.29
NP_442533.1_1 Reverse -379 -398 -17.7001 0.293
NP_442533.1_6 Reverse -359 -368 4.42462 0.179
NP_441482.1_7 Forward -374 -360 -10.2268 0.209
NP_440116.1_5 Forward -371 -354 2.30045 0.276
NP_440116.1_8 Forward -367 -348 -8.45701 0.253
NP_440115.1_6 Forward -371 -361 15.0247 0.0505
NP_441170.1_6 Forward -178 -163 10.993 0.251
NP_441972.1_5 Reverse -152 -171 -7.96535 0.256
NP_441869.1_4 Reverse -261 -280 8.16093 0.276
NP_439903.1_6 Reverse -69 -88 0.785326 0.256
NP_441286.1_1 Forward -369 -357 5.05386 0.0259
NP_440670.1_8 Forward -368 -359 8.75118 0.0606
NP_440670.1_8 Reverse -359 -368 6.19458 0.124
NP_440886.1_7 Reverse -358 -368 6.76441 0.114
NP_442072.1_9 Reverse -358 -376 -23.482 0.297
NP_440907.2_8 Reverse -265 -275 4.10949 0.278
NP_441021.1_1 Reverse -360 -379 -8.26035 0.194
NP_441463.1_3 Reverse -349 -368 -6.49039 0.246
NP_441626.1_2 Forward -367 -360 12.2322 0.0511
NP_441626.1_2 Reverse -360 -367 5.93897 0.231
NP_441431.1_2 Forward -371 -357 6.68548 0.263
NP_441488.1_8 Forward -373 -359 17.5018 0.0865
NP_441193.1_1 Reverse -39 -58 12.1917 0.229
NP_440467.1_3 Reverse -366 -385 12.9165 0.214
NP_440766.1_4 Forward -372 -358 10.3243 0.0871
NP_441237.1_9 Forward -367 -357 14.0414 0.0535
NP_439910.1_2 Reverse -123 -140 -13.4325 0.162
NP_440457.1_1 Forward -372 -360 10.4621 0.092
NP_440798.1_6 Forward -367 -354 1.39592 0.217
NP_441436.1_2 Reverse -362 -381 -3.14714 0.28
NP_442509.1_9 Forward -368 -358 13.1559 0.061
NP_442514.1_5 Reverse -351 -370 -4.81951 0.249
NP_441610.1_2 Forward -380 -361 7.96426 0.186
NP_440554.1_4 Reverse -360 -370 5.97822 0.128
NP_442862.1_3 Reverse -93 -110 5.25038 0.279
NP_441885.1_5 Reverse -359 -369 1.25834 0.11
NP_441885.1_5 Forward -368 -358 -0.0199663 0.186
NP_442341.1_7 Forward -382 -368 7.27608 0.109
NP_442341.1_9 Forward -370 -356 13.8636 0.0744
NP_441756.1_5 Reverse -355 -374 -5.01543 0.298
NP_441173.1_9 Forward -106 -98 9.85212 0.275
NP_443000.1_7 Forward -370 -360 10.2065 0.0355
NP_441842.1_1 Reverse -153 -166 10.6384 0.292
NP_440275.1_3 Forward -370 -360 12.5664 0.0316
NP_442451.1_2 Forward -376 -357 -9.24366 0.259
NP_440258.1_7 Forward -132 -113 12.2703 0.287
NP_440880.1_5 Forward -60 -42 24.0119 0.00745
NP_440149.1_8 Reverse -359 -378 -3.24547 0.185
NP_442373.1_2 Forward -52 -33 -11.3086 0.293
NP_440216.1_1 Reverse -359 -373 -1.8687 0.0412
NP_440172.1_1 Forward -368 -358 7.55152 0.0761
NP_440172.1_1 Reverse -359 -369 2.24165 0.279
NP_440046.1_7 Reverse -305 -324 8.55425 0.297
NP_442015.1_10 Forward -372 -359 2.2809 0.196
NP_442015.1_10 Reverse -355 -368 1.39592 0.204
NP_441226.1_7 Forward -367 -360 12.7234 0.0312
NP_441226.1_7 Reverse -360 -367 11.5435 0.0757
NP_441226.1_7 Reverse -48 -55 5.34865 0.289
NP_441111.1_7 Reverse -360 -368 8.86921 0.0589
NP_441766.1_2 Reverse -359 -368 14.7494 0.00772
NP_440416.1_9 Forward -375 -356 -20.0601 0.281
NP_442154.1_1 Forward -275 -257 -16.9921 0.247
NP_440261.1_5 Reverse -360 -373 -4.60227 0.158
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCCCCCATTTTGCCACACTCCCATAACCGCTGGCGATCGGGCAGTTAATGCCCCGGTTTATGGATTTGTCCAAAGAGCTTGTCAAGGTTGATACTTCTTGGTATGTTGTTAATGCGCTAAAAAAGCCGGGATAGCTCAGTTGGTAGAGCAGTGGACTGAAAATCCTCGTGTCGGCGGTTCAAGTCCGCCTCCTGGCATCACAAAACTCCTTATATAACTGTGCGGCGACACACTGTGTTGGTCATCGGTTACATATTGGGGGAGACGTTGTTTAATTTTACGGTAATGGCAGATTTAGCAAATTATCTAACTGGTTTAGGGTAACGGTTTGTTACGAGTGTTAAGGGTTGGGAGTTTGTTGGGTAGGCTAATGATTGTCGGTTCTAAATTAGAATTCCT

CDS

ATGTCGGACGTGATGATCCGGGTAGAAAATTTAGGCAAAAAGTACATGATTGGCCACCAAGCAGAGGGGCGGTCTAATTATGGGTTGTTGCGGGATGTGCTAGCAGATGGGGCCAAGTCCCTGGTAAAGCGGTTTACGGGCCGGGACAAAGGCGGTCGCCAAAATAGTTCCCTCCTCTCCAATTGA

Protein

MSDVMIRVENLGKKYMIGHQAEGRSNYGLLRDVLADGAKSLVKRFTGRDKGGRQNSSLLSN