Your browser is old and dusty. Try Google Chrome!

Details for ssr3465

ORF ssr3465
Accession NP_440427.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -370 -384 3.73617 0.16
NP_440795.1_7 Forward -377 -370 14.6904 0.0123
NP_440795.1_7 Reverse -370 -377 14.6904 0.0123
NP_441418.1_6 Forward -378 -359 -19.7651 0.0955
NP_441418.1_6 Reverse -258 -277 -30.4831 0.28
NP_442291.1_5 Reverse -368 -384 1.33684 0.148
NP_442291.1_5 Forward -379 -363 -1.51476 0.199
NP_440897.1_6 Reverse -369 -388 7.57013 0.0821
NP_441453.1_4 Reverse -369 -377 16.539 0.00633
NP_441453.1_4 Forward -378 -370 16.539 0.00633
NP_442151.1_6 Forward -378 -364 18.1908 0.00782
NP_442151.1_6 Reverse -369 -383 11.701 0.0933
NP_442151.1_8 Forward -283 -270 17.8172 0.27
NP_440561.1_6 Forward -383 -364 14.6508 0.284
NP_441818.1_1 Reverse -370 -381 15.4961 0.0264
NP_441818.1_1 Forward -377 -366 9.79292 0.232
NP_440226.1_1 Forward -378 -359 6.4893 0.128
NP_442173.1_1 Forward -377 -369 15.4574 0.00633
NP_442173.1_1 Reverse -370 -378 15.4574 0.00633
NP_442752.1_4 Forward -378 -371 13.8055 0.0199
NP_442752.1_4 Reverse -369 -376 13.8055 0.0199
NP_442752.1_4 Reverse -225 -232 13.5105 0.0314
NP_443027.1_4 Forward -380 -370 11.0914 0.107
NP_441812.1_1 Forward -283 -269 16.5185 0.188
NP_442975.1_10 Reverse -365 -379 10.5204 0.0541
NP_442975.1_10 Forward -382 -368 3.63724 0.252
NP_440784.1_7 Forward -377 -370 15.9687 0.0123
NP_440784.1_7 Reverse -370 -377 15.9687 0.0123
NP_442909.1_7 Forward -377 -363 13.8636 0.12
NP_440061.1_9 Reverse -367 -381 18.3868 0.00917
NP_440061.1_9 Forward -380 -366 13.9619 0.0735
NP_440061.1_9 Reverse -154 -168 8.06211 0.183
NP_440110.1_4 Forward -389 -370 13.5691 0.0777
NP_441054.1_4 Reverse -359 -377 1.10079 0.173
NP_441054.1_4 Forward -175 -157 -1.84914 0.21
NP_440878.1_9 Forward -175 -156 4.52268 0.174
NP_440878.1_9 Reverse -359 -378 2.0644 0.177
NP_442062.1_8 Forward -378 -368 17.3846 0.00193
NP_442062.1_8 Reverse -369 -379 17.3846 0.00193
NP_442062.1_8 Forward -187 -177 9.22315 0.0658
NP_442062.1_8 Reverse -225 -235 6.56821 0.123
NP_442062.1_8 Forward -238 -228 4.89658 0.193
NP_442062.1_8 Forward -165 -155 2.83163 0.293
NP_440304.1_4 Reverse -256 -266 6.46988 0.155
NP_440304.1_4 Forward -380 -370 1.84832 0.299
NP_440304.1_4 Reverse -367 -377 1.84832 0.299
NP_442242.1_4 Forward -377 -370 14.3954 0.0124
NP_442242.1_4 Reverse -370 -377 14.3954 0.0124
NP_441781.1_7 Forward -378 -359 5.40766 0.186
NP_441492.1_1 Forward -247 -228 15.1424 0.148
NP_441208.1_9 Reverse -366 -380 6.78443 0.229
NP_442110.1_7 Forward -378 -364 0.786239 0.248
NP_441082.1_10 Reverse -323 -336 7.6891 0.297
NP_441083.1_5 Forward -378 -368 20.3345 0.00053
NP_441083.1_5 Reverse -369 -379 20.3345 0.00053
NP_441149.1_9 Forward -306 -287 -0.492971 0.281
NP_441434.1_7 Forward -232 -218 6.29277 0.225
NP_442245.1_8 Reverse -260 -279 17.404 0.256
NP_441738.1_2 Forward -376 -369 15.28 0.0102
NP_441738.1_2 Reverse -371 -378 15.28 0.0102
NP_441738.1_2 Forward -162 -155 6.72528 0.236
NP_441558.1_5 Forward -380 -361 22.6156 0.00172
NP_440209.1_1 Reverse -369 -377 18.1123 0.00295
NP_440209.1_1 Forward -378 -370 18.1123 0.00295
NP_442889.1_8 Forward -381 -367 13.2736 0.0588
NP_442398.1_4 Forward -294 -275 8.35677 0.237
NP_441713.1_1 Forward -384 -365 -16.3235 0.28
NP_440178.1_7 Forward -379 -360 -20.7484 0.199
NP_441716.1_1 Forward -378 -364 15.9292 0.0451
NP_441716.1_1 Reverse -369 -383 13.1759 0.0689
NP_442111.1_4 Reverse -368 -382 13.3726 0.039
NP_442111.1_4 Forward -379 -365 9.83269 0.0575
NP_440343.1_9 Reverse -260 -279 7.96426 0.275
NP_440906.1_5 Forward -377 -370 15.8704 0.0124
NP_440906.1_5 Reverse -370 -377 15.8704 0.0124
NP_440747.1_10 Forward -381 -369 16.7552 0.0019
NP_440747.1_10 Reverse -366 -378 14.9853 0.00221
NP_440747.1_10 Reverse -153 -165 -12.0557 0.199
NP_441837.1_6 Reverse -277 -296 20.2556 0.187
NP_441130.1_10 Reverse -223 -237 9.34103 0.126
NP_441130.1_10 Forward -380 -366 6.3911 0.19
NP_441486.1_1 Reverse -366 -380 14.5526 0.00628
NP_441486.1_1 Forward -381 -367 6.3911 0.0344
NP_440944.1_2 Forward -360 -341 4.42435 0.205
NP_441014.1_5 Reverse -274 -292 11.3272 0.258
NP_441014.1_10 Reverse -199 -218 0.785326 0.238
NP_442848.1_1 Reverse -363 -377 8.84938 0.0791
NP_443018.1_3 Forward -377 -370 14.8871 0.0123
NP_443018.1_3 Reverse -370 -377 14.8871 0.0123
NP_443018.1_3 Forward -186 -179 8.49558 0.141
NP_441634.1_8 Forward -380 -366 5.80112 0.114
NP_440376.1_1 Forward -378 -369 19.4693 0.000692
NP_440376.1_1 Reverse -369 -378 19.4693 0.000692
NP_440376.1_1 Reverse -156 -165 3.93297 0.188
NP_440376.1_1 Reverse -155 -164 0.491382 0.273
NP_441588.1_4 Forward -376 -366 8.92815 0.14
NP_441588.1_4 Reverse -371 -381 6.46988 0.193
NP_442687.1_7 Forward -379 -369 8.92815 0.0994
NP_442687.1_7 Reverse -368 -378 8.92815 0.0994
NP_441013.1_2 Reverse -358 -376 -1.84914 0.282
NP_441013.1_3 Reverse -357 -376 7.27595 0.268
NP_442770.1_10 Forward -289 -275 18.5371 0.13
NP_441422.1_7 Forward -380 -363 -2.91109 0.225
NP_440533.1_9 Forward -267 -248 4.52268 0.223
NP_442296.1_9 Forward -237 -218 -5.31042 0.282
NP_442658.1_1 Forward -380 -370 7.94438 0.199
NP_442658.1_1 Reverse -367 -377 6.76441 0.214
NP_441414.1_9 Reverse -369 -388 -5.50708 0.177
NP_441414.1_9 Forward -378 -359 -10.3253 0.28
NP_442937.1_5 Forward -383 -364 12.6841 0.103
NP_442937.1_5 Reverse -364 -383 9.3409 0.196
NP_442321.1_4 Forward -174 -155 0.58944 0.255
NP_441958.1_5 Forward -379 -369 12.2714 0.00183
NP_441958.1_5 Reverse -368 -378 12.2714 0.00183
NP_442836.1_5 Reverse -363 -382 0.786102 0.295
NP_442836.1_10 Forward -367 -357 16.6963 0.197
NP_440203.1_2 Forward -376 -357 14.0608 0.257
NP_440203.1_5 Forward -375 -365 13.3526 0.116
NP_439905.1_1 Reverse -370 -383 7.09911 0.268
NP_440984.1_7 Reverse -151 -165 5.70279 0.245
NP_439990.1_5 Forward -383 -370 23.0287 0.000569
NP_439990.1_5 Reverse -364 -377 12.3107 0.114
NP_442911.1_2 Forward -244 -225 0.491109 0.0665
NP_442911.1_2 Reverse -359 -378 -3.24547 0.11
NP_442911.1_2 Forward -388 -369 -4.22878 0.129
NP_440153.1_5 Forward -377 -363 3.04785 0.219
NP_440153.1_5 Reverse -370 -384 1.76955 0.245
NP_440993.1_3 Forward -388 -369 1.08032 0.236
NP_440138.1_7 Reverse -359 -377 16.6176 0.278
NP_441913.1_1 Reverse -65 -81 18.0796 0.246
NP_441099.1_5 Forward -388 -369 5.30933 0.0469
NP_441099.1_5 Reverse -359 -378 -7.17871 0.171
NP_441938.1_3 Forward -374 -355 12.0942 0.116
NP_441294.1_7 Reverse -365 -379 17.7936 0.00679
NP_441646.1_1 Reverse -362 -381 4.71934 0.189
NP_441646.1_1 Forward -385 -366 -1.47551 0.287
NP_442438.1_10 Forward -239 -225 2.85119 0.168
NP_442438.1_10 Reverse -364 -378 0.0979218 0.239
NP_440147.1_4 Reverse -367 -380 18.9972 0.00328
NP_440147.1_4 Forward -380 -367 8.77074 0.0465
NP_441550.1_8 Forward -380 -370 15.1225 0.0132
NP_441550.1_8 Reverse -367 -377 14.6309 0.0132
NP_441916.1_7 Forward -378 -368 10.3048 0.0261
NP_441916.1_7 Reverse -369 -379 10.3048 0.0261
NP_441916.1_7 Reverse -178 -188 1.35667 0.286
NP_441041.1_4 Forward -378 -359 2.94938 0.0684
NP_442004.1_6 Forward -378 -364 8.75105 0.14
NP_441725.1_4 Forward -383 -369 3.14559 0.279
NP_441725.1_5 Forward -377 -367 2.04498 0.115
NP_441725.1_5 Reverse -370 -380 2.04498 0.115
NP_439966.1_7 Forward -380 -370 15.3192 0.0152
NP_439966.1_7 Reverse -367 -377 7.25606 0.15
NP_439966.1_9 Reverse -223 -232 1.08137 0.253
NP_440202.1_8 Reverse -148 -167 13.1133 0.26
NP_442941.1_3 Reverse -370 -380 19.2529 0.00262
NP_442941.1_3 Forward -377 -367 11.0914 0.0116
NP_440674.1_1 Reverse -115 -134 14.0608 0.274
NP_440289.1_2 Forward -381 -368 3.06754 0.0811
NP_440289.1_2 Reverse -366 -379 -4.89726 0.294
NP_442281.1_1 Reverse -151 -165 3.8339 0.217
NP_442256.1_2 Forward -380 -362 -7.06068 0.214
NP_440437.1_1 Reverse -150 -169 -4.81876 0.269
NP_441556.1_10 Reverse -364 -378 17.2301 0.0842
NP_441556.1_10 Forward -170 -156 12.2659 0.195
NP_440498.1_1 Reverse -360 -378 0.609134 0.214
NP_441644.1_6 Forward -378 -368 17.3841 0.00127
NP_441644.1_6 Reverse -369 -379 17.3841 0.00127
NP_440587.1_6 Forward -303 -284 22.3206 0.0606
NP_440867.1_10 Reverse -147 -166 8.06259 0.251
NP_442215.1_2 Reverse -367 -383 -1.3181 0.183
NP_442215.1_2 Forward -380 -364 -1.71142 0.187
NP_442215.1_2 Forward -167 -151 -7.21796 0.289
NP_442029.1_6 Forward -383 -364 8.06259 0.211
NP_440253.1_2 Reverse -369 -387 2.37909 0.139
NP_440929.1_8 Forward -378 -369 19.2726 0.000701
NP_440929.1_8 Reverse -369 -378 19.2726 0.000701
NP_442933.1_10 Forward -378 -369 17.601 0.00325
NP_442933.1_10 Reverse -369 -378 17.601 0.00325
NP_441751.2_8 Reverse -370 -384 5.30946 0.0448
NP_442554.1_8 Reverse -370 -380 16.2046 0.0065
NP_442554.1_8 Forward -377 -367 15.3197 0.00882
NP_441762.1_7 Forward -379 -367 0.432302 0.0747
NP_441762.1_7 Forward -369 -357 -3.89426 0.14
NP_441762.1_7 Reverse -224 -236 -5.36923 0.203
NP_441762.1_7 Forward -235 -223 -5.46756 0.212
NP_441762.1_7 Reverse -368 -380 -6.74586 0.284
NP_442142.1_4 Forward -381 -368 4.24695 0.227
NP_442142.1_4 Reverse -366 -379 3.06699 0.268
NP_442142.1_4 Forward -399 -386 2.772 0.278
NP_442292.1_1 Forward -377 -368 18.486 0.00229
NP_442292.1_1 Reverse -370 -379 18.486 0.00229
NP_442143.1_10 Forward -377 -358 12.6841 0.213
NP_442476.1_5 Forward -361 -342 11.9958 0.256
NP_442476.1_6 Forward -233 -219 5.21113 0.139
NP_440895.1_6 Forward -384 -371 9.06573 0.229
NP_441523.1_6 Reverse -365 -384 3.6377 0.272
NP_443009.1_2 Forward -376 -357 0.786102 0.216
NP_443009.1_5 Forward -166 -155 10.6779 0.0767
NP_443009.1_5 Reverse -368 -379 8.90795 0.0965
NP_443009.1_5 Forward -379 -368 8.90795 0.0965
NP_443009.1_5 Reverse -155 -166 5.56471 0.197
NP_441715.1_4 Reverse -370 -380 17.3846 0.0106
NP_441715.1_4 Forward -377 -367 7.94484 0.107
NP_441198.1_8 Forward -167 -157 11.3181 0.211
NP_440464.1_10 Forward -377 -367 13.0082 0.169
NP_441468.1_1 Forward -377 -370 15.8704 0.0124
NP_441468.1_1 Reverse -370 -377 15.8704 0.0124
NP_441020.2_6 Reverse -256 -273 5.54538 0.298
NP_441015.1_10 Reverse -364 -383 -4.42544 0.203
NP_441673.1_1 Forward -378 -369 20.8459 0.000698
NP_441673.1_1 Reverse -369 -378 20.8459 0.000698
NP_441956.1_10 Forward -292 -278 18.2885 0.233
NP_440265.1_8 Reverse -75 -93 14.7688 0.219
NP_441826.1_2 Reverse -363 -377 3.34284 0.111
NP_441826.1_2 Forward -384 -370 -1.67204 0.252
NP_442868.1_6 Forward -380 -370 19.2529 0.00563
NP_442868.1_6 Reverse -367 -377 9.81313 0.038
NP_441612.1_2 Reverse -369 -379 8.54929 0.21
NP_441612.1_2 Forward -378 -368 8.54929 0.21
NP_442808.1_1 Reverse -368 -378 8.63269 0.0481
NP_442808.1_1 Forward -379 -369 8.63269 0.0481
NP_442050.1_5 Forward -380 -370 14.3359 0.0206
NP_442050.1_5 Reverse -367 -377 7.64939 0.243
NP_441493.2_10 Reverse -358 -377 5.60432 0.267
NP_441878.1_6 Forward -379 -369 10.4031 0.0176
NP_441878.1_6 Reverse -368 -378 10.4031 0.0176
NP_441878.1_6 Reverse -155 -165 2.33998 0.0405
NP_441878.1_6 Forward -166 -156 1.16001 0.11
NP_441036.1_8 Forward -379 -369 8.33817 0.174
NP_441036.1_8 Reverse -368 -378 8.33817 0.174
NP_442650.1_2 Forward -378 -364 6.19444 0.134
NP_442721.1_4 Reverse -349 -368 14.7491 0.291
NP_441557.1_5 Forward -378 -369 19.9609 0.000699
NP_441557.1_5 Reverse -369 -378 19.9609 0.000699
NP_442066.2_9 Forward -382 -369 10.5407 0.154
NP_440084.1_8 Forward -322 -308 10.6112 0.266
NP_440101.1_10 Forward -378 -359 2.26107 0.261
NP_441458.1_10 Forward -387 -368 4.32602 0.23
NP_440248.1_4 Forward -200 -181 19.0152 0.0793
NP_441549.1_9 Forward -169 -151 -10.4039 0.278
NP_442347.1_2 Forward -377 -368 12.4878 0.056
NP_442347.1_2 Reverse -370 -379 12.4878 0.056
NP_442347.1_2 Forward -233 -224 4.52295 0.282
NP_442645.1_2 Forward -386 -367 -15.0452 0.189
NP_442645.1_2 Reverse -361 -380 -22.0267 0.29
NP_442965.1_2 Forward -224 -205 -3.93378 0.255
NP_441037.1_4 Reverse -367 -377 7.9999 0.237
NP_440690.1_5 Reverse -263 -282 14.0608 0.272
NP_441633.1_3 Forward -380 -367 3.46087 0.0699
NP_441633.1_3 Forward -236 -223 3.06754 0.0764
NP_441633.1_3 Reverse -367 -380 1.19926 0.109
NP_441633.1_3 Reverse -154 -167 -4.60227 0.205
NP_440136.1_2 Forward -377 -370 15.9687 0.0123
NP_440136.1_2 Reverse -370 -377 15.9687 0.0123
NP_442590.1_10 Forward -378 -359 7.27595 0.23
NP_442998.1_5 Forward -361 -351 13.5497 0.158
NP_442998.1_10 Forward -376 -369 15.5754 0.0102
NP_442998.1_10 Reverse -371 -378 15.5754 0.0102
NP_442998.1_10 Forward -232 -225 5.84064 0.235
NP_440299.1_1 Forward -382 -369 20.6681 0.00128
NP_440299.1_1 Reverse -365 -378 19.9798 0.00161
NP_441799.1_1 Reverse -365 -379 10.717 0.0683
NP_441799.1_1 Forward -382 -368 4.71887 0.238
NP_442201.1_10 Forward -389 -370 -7.57203 0.201
NP_440256.1_1 Reverse -366 -385 -7.37537 0.234
NP_441559.1_8 Forward -383 -369 3.63784 0.143
NP_441559.1_8 Reverse -364 -378 2.65453 0.143
NP_441559.1_8 Forward -169 -155 -5.31028 0.259
NP_440915.1_6 Forward -382 -368 10.3243 0.0322
NP_440915.1_6 Reverse -151 -165 -1.37704 0.233
NP_440915.1_6 Reverse -152 -166 -2.55701 0.276
NP_442158.1_2 Reverse -300 -319 17.8088 0.247
NP_442785.1_7 Forward -380 -366 11.0127 0.228
NP_441704.1_8 Reverse -358 -377 5.2102 0.3
NP_442031.1_8 Reverse -355 -374 8.94757 0.218
NP_440695.1_6 Forward -201 -187 14.8714 0.208
NP_441939.1_3 Reverse -370 -389 7.37428 0.204
NP_440677.1_1 Reverse -360 -379 9.14423 0.187
NP_442386.1_9 Reverse -368 -377 13.8639 0.0289
NP_442386.1_9 Forward -379 -370 13.8639 0.0289
NP_440570.1_5 Reverse -359 -378 2.16274 0.234
NP_442054.1_4 Forward -242 -223 10.4225 0.275
NP_441340.1_5 Forward -377 -370 15.6737 0.0124
NP_441340.1_5 Reverse -370 -377 15.6737 0.0124
NP_441271.1_2 Forward -284 -265 19.0757 0.206
NP_442327.1_3 Reverse -303 -322 5.58586 0.276
NP_442484.1_2 Reverse -358 -377 1.67108 0.227
NP_442240.1_2 Reverse -370 -389 -19.4701 0.295
NP_440586.1_8 Forward -377 -370 13.2151 0.026
NP_440586.1_8 Reverse -370 -377 13.2151 0.026
NP_440586.1_8 Forward -371 -364 9.18354 0.171
NP_442251.1_6 Forward -377 -370 15.2804 0.0124
NP_442251.1_6 Reverse -370 -377 15.2804 0.0124
NP_442251.1_6 Forward -233 -226 10.4622 0.12
NP_441262.1_3 Reverse -369 -376 14.7888 0.0223
NP_441262.1_3 Forward -378 -371 14.7888 0.0223
NP_443051.1_1 Reverse -368 -377 10.4228 0.00754
NP_443051.1_1 Forward -379 -370 10.4228 0.00754
NP_439937.1_8 Reverse -223 -242 -0.885524 0.247
NP_439937.1_9 Reverse -154 -171 8.78956 0.0679
NP_439937.1_9 Reverse -155 -172 -6.15667 0.157
NP_439937.1_9 Forward -379 -362 -16.1864 0.287
NP_440372.1_2 Forward -377 -370 16.3621 0.0124
NP_440372.1_2 Reverse -370 -377 16.3621 0.0124
NP_441138.1_5 Reverse -319 -332 2.92653 0.297
NP_440316.1_10 Forward -385 -375 5.78156 0.281
NP_439977.1_5 Forward -384 -365 -0.295539 0.222
NP_441572.1_7 Reverse -219 -238 -0.295539 0.179
NP_440267.1_2 Reverse -169 -183 8.06211 0.177
NP_442384.1_10 Reverse -369 -382 21.1604 0.00194
NP_442384.1_10 Forward -378 -365 18.9972 0.00338
NP_442790.1_4 Forward -387 -368 2.45773 0.0729
NP_442262.1_10 Forward -377 -370 14.1988 0.0123
NP_442262.1_10 Reverse -370 -377 14.1988 0.0123
NP_442262.1_10 Forward -186 -179 8.59391 0.22
NP_441689.1_5 Forward -380 -370 5.78111 0.197
NP_441689.1_5 Reverse -367 -377 5.78111 0.197
NP_442244.1_6 Reverse -222 -241 2.0644 0.291
NP_440344.1_10 Forward -385 -368 -7.63097 0.118
NP_440344.1_10 Reverse -362 -379 -7.63097 0.118
NP_440282.1_3 Forward -156 -137 1.47442 0.281
NP_440531.1_6 Forward -386 -367 -1.37718 0.231
NP_441060.1_2 Forward -86 -67 12.1925 0.223
NP_441965.1_10 Forward -381 -365 8.90832 0.123
NP_441640.1_8 Forward -377 -358 6.09597 0.111
NP_440297.1_9 Forward -377 -367 -0.118297 0.282
NP_440297.1_9 Reverse -370 -380 -0.118297 0.282
NP_441592.1_4 Reverse -369 -388 0.786102 0.227
NP_441592.1_10 Reverse -347 -361 13.1753 0.284
NP_440999.1_9 Forward -382 -368 2.2612 0.152
NP_440999.1_9 Reverse -365 -379 2.2612 0.152
NP_440999.1_9 Forward -271 -257 1.57289 0.162
NP_440888.1_2 Reverse -369 -383 18.7801 0.00187
NP_440888.1_2 Forward -378 -364 11.012 0.0783
NP_440888.1_2 Forward -164 -150 5.80051 0.262
NP_440600.1_4 Forward -386 -368 -2.3408 0.195
NP_440822.1_1 Reverse -161 -180 14.2289 0.231
NP_440060.1_2 Reverse -264 -283 17.0099 0.191
NP_442033.1_10 Forward -380 -361 3.83436 0.086
NP_442033.1_10 Reverse -357 -376 -11.8986 0.26
NP_441543.1_2 Forward -377 -368 16.9127 0.00359
NP_441543.1_2 Reverse -370 -379 16.9127 0.00359
NP_441543.1_2 Forward -233 -224 5.60459 0.189
NP_442845.1_2 Forward -384 -370 6.48943 0.209
NP_442845.1_2 Reverse -363 -377 4.52282 0.258
NP_441319.1_8 Forward -384 -366 5.13236 0.281
NP_441469.1_8 Forward -379 -370 6.48957 0.227
NP_441469.1_8 Reverse -368 -377 6.48957 0.227
NP_443064.1_6 Forward -378 -368 12.5669 0.0796
NP_443064.1_6 Reverse -369 -379 12.5669 0.0796
NP_442578.1_7 Forward -377 -370 14.5921 0.026
NP_442578.1_7 Reverse -370 -377 14.5921 0.026
NP_441462.1_2 Forward -378 -368 11.5831 0.00406
NP_441462.1_2 Reverse -369 -379 11.5831 0.00406
NP_441621.1_7 Forward -236 -222 -2.95034 0.188
NP_443062.1_6 Reverse -361 -380 3.93269 0.225
NP_442204.1_1 Reverse -365 -376 6.94184 0.144
NP_442204.1_1 Forward -382 -371 2.12362 0.266
NP_442204.1_5 Reverse -215 -234 1.67108 0.231
NP_441560.1_8 Forward -383 -364 12.4866 0.25
NP_442487.1_5 Reverse -1 -20 2.06362 0.3
NP_440516.1_2 Forward -384 -366 6.01734 0.122
NP_440516.1_2 Reverse -363 -381 2.87075 0.163
NP_440516.1_8 Forward -378 -369 16.9127 0.00442
NP_440516.1_8 Reverse -369 -378 16.9127 0.00442
NP_442428.1_5 Forward -377 -370 15.8704 0.0124
NP_442428.1_5 Reverse -370 -377 15.8704 0.0124
NP_441443.1_10 Reverse -143 -161 0.805058 0.292
NP_440673.1_3 Forward -376 -369 12.4288 0.0426
NP_440673.1_3 Reverse -371 -378 12.4288 0.0426
NP_441052.1_2 Forward -378 -368 19.9412 0.00106
NP_441052.1_2 Reverse -369 -379 19.9412 0.00106
NP_440992.1_2 Reverse -267 -286 14.6508 0.189
NP_442219.1_9 Forward -377 -368 17.7976 0.00718
NP_442219.1_9 Reverse -370 -379 17.7976 0.00718
NP_440436.1_4 Forward -377 -368 17.2072 0.00233
NP_440436.1_4 Reverse -370 -379 17.2072 0.00233
NP_440436.1_4 Forward -164 -155 6.78414 0.147
NP_442412.1_5 Forward -283 -264 2.94938 0.294
NP_441321.1_1 Forward -246 -227 20.1573 0.176
NP_440314.1_9 Reverse -370 -389 -0.000545616 0.102
NP_442907.1_2 Forward -377 -359 8.08229 0.272
NP_441719.1_2 Reverse -332 -346 14.2134 0.278
NP_441719.1_4 Forward -377 -370 16.3621 0.0124
NP_441719.1_4 Reverse -370 -377 16.3621 0.0124
NP_441004.1_1 Forward -24 -5 -18.0934 0.297
NP_442813.1_5 Forward -309 -290 2.65439 0.275
NP_442366.1_5 Reverse -366 -376 17.2858 0.0141
NP_441437.1_1 Forward -164 -145 17.2074 0.116
NP_441115.1_4 Forward -235 -217 8.17984 0.257
NP_441115.1_4 Forward -379 -361 7.19654 0.295
NP_442854.1_4 Forward -383 -364 11.6017 0.253
NP_440328.1_4 Reverse -150 -169 -1.08219 0.298
NP_443054.1_2 Reverse -154 -168 8.25939 0.126
NP_443054.1_2 Forward -380 -366 -0.492064 0.295
NP_441851.1_2 Reverse -186 -205 0.58944 0.273
NP_441851.1_10 Forward -379 -369 15.8113 0.00552
NP_441851.1_10 Reverse -368 -378 15.8113 0.00552
NP_441851.1_10 Reverse -155 -165 4.99491 0.233
NP_441851.1_10 Forward -166 -156 4.10993 0.287
NP_442856.1_7 Forward -387 -368 -2.55715 0.236
NP_442515.1_1 Reverse -368 -382 11.406 0.0412
NP_442515.1_1 Forward -379 -365 2.16287 0.141
NP_442515.1_1 Reverse -155 -169 1.57289 0.155
NP_441396.1_5 Reverse -388 -397 7.47288 0.252
NP_440593.1_3 Forward -383 -364 -1.7705 0.215
NP_440593.1_3 Reverse -364 -383 -3.44213 0.235
NP_441349.1_10 Reverse -359 -378 -2.16383 0.114
NP_441349.1_10 Forward -388 -369 -8.65367 0.278
NP_441409.1_6 Reverse -363 -382 -10.9153 0.213
NP_439960.1_10 Forward -385 -367 -4.60241 0.293
NP_440474.1_8 Forward -233 -219 10.0287 0.149
NP_442450.1_5 Reverse -367 -377 7.55152 0.13
NP_440588.1_2 Forward -387 -368 -2.0655 0.16
NP_440588.1_2 Reverse -360 -379 -2.45882 0.165
NP_440588.1_2 Forward -174 -155 -5.70374 0.259
NP_440195.1_4 Reverse -357 -376 9.43923 0.184
NP_440195.1_4 Reverse -347 -366 5.70265 0.284
NP_442006.1_2 Reverse -84 -101 -17.7591 0.282
NP_441570.1_1 Forward -378 -360 -6.66736 0.0813
NP_441078.1_4 Forward -378 -369 19.6659 0.0007
NP_441078.1_4 Reverse -369 -378 19.6659 0.0007
NP_441078.1_4 Reverse -156 -165 -1.57357 0.266
NP_441078.1_4 Forward -165 -156 -1.57357 0.266
NP_442729.1_8 Forward -382 -369 9.36073 0.125
NP_441663.1_7 Reverse -222 -241 5.60432 0.236
NP_441663.1_8 Reverse -150 -169 -1.18052 0.24
NP_441663.1_8 Forward -274 -255 -2.85214 0.274
NP_440707.1_9 Reverse -265 -284 7.66927 0.219
NP_442443.1_1 Reverse -148 -167 -1.96717 0.246
NP_442443.1_1 Forward -297 -278 -3.83545 0.267
NP_442443.1_1 Reverse -265 -284 -6.98204 0.299
NP_440526.1_3 Reverse -370 -381 1.04151 0.267
NP_440526.1_3 Forward -377 -366 0.943182 0.267
NP_441432.1_8 Reverse -368 -377 16.8143 0.00595
NP_441432.1_8 Forward -379 -370 16.8143 0.00595
NP_441333.1_1 Reverse -311 -321 13.0198 0.217
NP_442320.1_8 Forward -384 -370 -2.95034 0.1
NP_442320.1_8 Reverse -219 -233 -4.13031 0.148
NP_441732.1_2 Reverse -365 -381 2.02515 0.0253
NP_441732.1_2 Forward -382 -366 -5.64466 0.0478
NP_440497.1_2 Reverse -370 -389 5.50599 0.287
NP_440629.1_4 Forward -292 -273 18.4857 0.0908
NP_442003.1_4 Forward -377 -358 14.8474 0.205
NP_440760.1_1 Reverse -369 -388 10.6192 0.0106
NP_440760.1_1 Forward -378 -359 -13.3736 0.102
NP_442353.1_4 Reverse -363 -382 14.1583 0.0776
NP_442353.1_4 Forward -384 -365 13.47 0.0776
NP_440713.1_4 Reverse -359 -378 6.98095 0.184
NP_440713.1_4 Forward -388 -369 3.04771 0.251
NP_442489.1_7 Forward -378 -369 20.1576 0.000695
NP_442489.1_7 Reverse -369 -378 20.1576 0.000695
NP_442489.1_7 Reverse -156 -165 -1.57357 0.213
NP_442489.1_7 Forward -165 -156 -2.06522 0.288
NP_440559.1_1 Forward -377 -368 17.4043 0.00658
NP_440559.1_1 Reverse -370 -379 17.4043 0.00658
NP_441659.2_8 Forward -378 -368 18.1713 0.00133
NP_441659.2_8 Reverse -369 -379 18.1713 0.00133
NP_441659.2_8 Reverse -2 -12 0.0783647 0.277
NP_442749.1_5 Forward -367 -350 17.768 0.159
NP_442913.1_10 Reverse -360 -379 10.5209 0.0421
NP_441040.1_2 Reverse -147 -166 -14.6519 0.286
NP_441040.1_5 Forward -383 -364 2.55606 0.28
NP_442849.1_1 Forward -21 -7 10.521 0.204
NP_442346.1_5 Forward -379 -369 16.6963 0.00248
NP_442346.1_5 Reverse -368 -378 16.6963 0.00248
NP_442346.1_5 Reverse -155 -165 4.79825 0.272
NP_440545.1_3 Reverse -365 -382 4.46374 0.0703
NP_440545.1_3 Forward -169 -152 -4.77938 0.232
NP_441629.1_1 Reverse -361 -380 7.96426 0.249
NP_440555.1_4 Forward -21 -2 5.99764 0.255
NP_440459.1_2 Reverse -360 -377 7.90532 0.276
NP_442551.1_4 Forward -167 -152 -1.69173 0.247
NP_442551.1_4 Reverse -154 -169 -1.88839 0.25
NP_442603.1_7 Reverse -369 -383 19.7634 0.00895
NP_442603.1_7 Forward -378 -364 13.077 0.0925
NP_442828.1_7 Forward -21 -2 -5.60541 0.277
NP_441585.1_6 Reverse -2 -21 13.6666 0.263
NP_441888.1_7 Forward -286 -272 12.0943 0.0743
NP_441888.1_7 Forward -383 -369 3.04785 0.225
NP_441888.1_7 Forward -192 -178 3.04785 0.225
NP_441888.1_9 Forward -187 -168 14.263 0.282
NP_440449.1_6 Forward -173 -155 5.92152 0.266
NP_441833.1_4 Forward -377 -370 15.9687 0.0124
NP_441833.1_4 Reverse -370 -377 15.9687 0.0124
NP_442162.1_9 Forward -377 -370 16.2637 0.0124
NP_442162.1_9 Reverse -370 -377 16.2637 0.0124
NP_440772.1_8 Forward -384 -365 10.3242 0.253
NP_442140.1_3 Forward -377 -367 12.2714 0.0632
NP_442140.1_3 Reverse -370 -380 10.3048 0.0902
NP_441609.1_1 Reverse -195 -214 -0.983855 0.251
NP_441671.1_6 Forward -395 -376 10.2259 0.179
NP_441813.1_5 Forward -380 -370 18.1713 0.00743
NP_441813.1_5 Reverse -367 -377 8.63316 0.0367
NP_440590.1_4 Forward -377 -364 21.4554 0.00401
NP_440590.1_4 Reverse -370 -383 21.4554 0.00401
NP_440590.1_4 Forward -367 -354 -0.669033 0.196
NP_440567.1_1 Forward -233 -219 4.62115 0.116
NP_440567.1_1 Reverse -364 -378 -0.393733 0.281
NP_442497.1_10 Forward -377 -368 10.4228 0.0087
NP_442497.1_10 Reverse -370 -379 10.4228 0.0087
NP_440821.1_4 Reverse -367 -377 9.41981 0.0286
NP_440821.1_4 Forward -380 -370 9.41981 0.0286
NP_440821.1_4 Reverse -223 -233 -0.609952 0.279
NP_440821.1_10 Reverse -169 -187 16.3793 0.284
NP_441239.1_9 Reverse -154 -166 9.97041 0.0912
NP_441239.1_9 Forward -380 -368 5.25052 0.223
NP_441239.1_9 Reverse -367 -379 3.38223 0.285
NP_440624.1_5 Reverse -185 -203 6.89614 0.298
NP_441892.1_1 Reverse -360 -377 -6.15601 0.298
NP_442082.1_10 Forward -334 -315 25.2705 0.00537
NP_440796.1_3 Reverse -362 -380 11.6214 0.204
NP_442270.1_9 Reverse -358 -377 9.43923 0.0824
NP_441017.1_6 Forward -382 -368 13.6669 0.179
NP_441017.1_8 Forward -168 -153 11.4846 0.188
NP_440546.1_4 Forward -378 -368 10.046 0.109
NP_440546.1_4 Reverse -369 -379 10.046 0.109
NP_440462.1_6 Forward -380 -370 9.61647 0.0429
NP_440462.1_6 Reverse -223 -233 5.28991 0.161
NP_440462.1_6 Reverse -367 -377 1.35667 0.294
NP_440868.1_4 Reverse -365 -377 8.6921 0.0582
NP_440868.1_4 Forward -382 -370 0.923956 0.196
NP_440868.1_4 Forward -238 -226 0.23564 0.224
NP_442787.1_3 Reverse -146 -165 19.2723 0.102
NP_441848.1_4 Forward -288 -272 8.3146 0.288
NP_440653.1_1 Reverse -354 -373 3.04771 0.277
NP_439942.1_7 Forward -167 -148 -6.09707 0.294
NP_440696.1_6 Reverse -357 -376 3.73603 0.288
NP_442039.1_4 Forward -377 -370 15.1821 0.0124
NP_442039.1_4 Reverse -370 -377 15.1821 0.0124
NP_441811.1_8 Reverse -363 -377 13.8643 0.175
NP_441811.1_8 Forward -384 -370 5.80112 0.289
NP_440825.1_7 Forward -377 -367 12.9096 0.152
NP_442837.1_3 Forward -377 -370 15.7721 0.0124
NP_442837.1_3 Reverse -370 -377 15.7721 0.0124
NP_442053.1_1 Forward -378 -369 18.3876 0.0007
NP_442053.1_1 Reverse -369 -378 18.3876 0.0007
NP_440505.1_3 Forward -380 -370 18.3679 0.00213
NP_440505.1_3 Reverse -367 -377 9.22315 0.122
NP_441959.1_10 Forward -166 -148 10.7533 0.277
NP_441536.1_9 Reverse -125 -144 17.7974 0.212
NP_442532.1_7 Reverse -225 -239 4.22782 0.178
NP_440914.1_1 Forward -378 -368 17.5935 0.000537
NP_440914.1_1 Reverse -369 -379 17.5935 0.000537
NP_441011.1_8 Forward -377 -368 8.25953 0.144
NP_441011.1_8 Reverse -370 -379 8.25953 0.144
NP_442533.1_6 Forward -378 -369 17.2076 0.00137
NP_442533.1_6 Reverse -369 -378 17.2076 0.00137
NP_442533.1_6 Forward -165 -156 7.57121 0.0898
NP_442232.1_3 Reverse -264 -283 -12.7836 0.282
NP_442535.1_9 Reverse -360 -378 -3.81576 0.262
NP_441482.1_7 Forward -384 -370 -2.45868 0.0963
NP_441482.1_7 Reverse -363 -377 -8.35854 0.193
NP_439944.1_9 Forward -377 -367 10.5014 0.0887
NP_439944.1_9 Reverse -370 -380 10.5014 0.0887
NP_441697.1_5 Forward -211 -192 -4.24981 0.22
NP_441028.1_6 Reverse -146 -156 8.73102 0.216
NP_441028.1_6 Reverse -12 -22 5.38779 0.255
NP_440116.1_5 Reverse -366 -383 3.38209 0.233
NP_440116.1_8 Forward -377 -358 18.0924 0.00891
NP_440115.1_6 Reverse -366 -376 8.33817 0.13
NP_440115.1_6 Forward -381 -371 6.76487 0.167
NP_441972.1_5 Forward -377 -358 -4.22878 0.207
NP_441972.1_5 Reverse -370 -389 -9.44032 0.285
NP_441106.1_1 Forward -379 -370 9.63616 0.0311
NP_441106.1_1 Reverse -368 -377 9.63616 0.0311
NP_442588.1_9 Forward -369 -355 21.0424 0.124
NP_440444.1_9 Forward -296 -277 12.0933 0.295
NP_441286.1_1 Forward -379 -367 12.9203 0.00815
NP_441286.1_1 Reverse -368 -380 12.9203 0.00815
NP_442674.1_3 Reverse -355 -374 3.14526 0.295
NP_440670.1_8 Forward -378 -369 18.3876 0.000699
NP_440670.1_8 Reverse -369 -378 18.3876 0.000699
NP_440886.1_7 Forward -379 -369 7.94438 0.0805
NP_440886.1_7 Reverse -368 -378 7.94438 0.0805
NP_440886.1_7 Forward -268 -258 4.50281 0.232
NP_442614.1_2 Forward -378 -364 6.29277 0.291
NP_439995.1_5 Reverse -215 -234 8.45592 0.235
NP_442717.1_8 Forward -346 -327 21.6314 0.0219
NP_442072.1_9 Forward -379 -361 -23.482 0.297
NP_440907.2_8 Forward -377 -367 7.64939 0.117
NP_441021.1_1 Reverse -370 -389 1.76941 0.083
NP_441021.1_1 Forward -377 -358 -6.88371 0.181
NP_441021.1_1 Reverse -273 -292 -12.2919 0.283
NP_441626.1_2 Forward -377 -370 15.7721 0.0124
NP_441626.1_2 Reverse -370 -377 15.7721 0.0124
NP_442365.1_7 Reverse -365 -384 1.86774 0.168
NP_442794.1_1 Forward -382 -370 17.1486 0.0232
NP_442794.1_1 Reverse -365 -377 12.4287 0.0721
NP_442615.1_1 Reverse -360 -378 -3.42244 0.161
NP_442615.1_1 Forward -387 -369 -4.79907 0.194
NP_441962.1_4 Reverse -267 -286 -10.1286 0.224
NP_441962.1_4 Reverse -364 -383 -10.4236 0.228
NP_440387.1_1 Forward -378 -362 13.0382 0.00969
NP_440387.1_1 Reverse -225 -241 3.59845 0.0551
NP_440387.1_1 Reverse -369 -385 -0.629782 0.14
NP_441431.1_2 Forward -190 -176 8.45543 0.216
NP_441488.1_8 Reverse -364 -378 11.2087 0.146
NP_441488.1_8 Forward -383 -369 6.88214 0.289
NP_441836.1_2 Reverse -363 -382 -4.72043 0.262
NP_441836.1_2 Forward -384 -365 -5.31042 0.277
NP_441174.1_1 Reverse -147 -162 10.403 0.294
NP_440814.1_4 Reverse -360 -379 -11.4069 0.224
NP_440114.1_10 Reverse -156 -170 7.07942 0.246
NP_440293.1_3 Reverse -149 -168 -6.58872 0.291
NP_440293.1_9 Reverse -217 -231 12.3106 0.243
NP_441237.1_6 Reverse -284 -301 9.57695 0.127
NP_441237.1_9 Forward -377 -367 14.828 0.0242
NP_442743.1_4 Reverse -370 -389 -6.78538 0.279
NP_440502.1_7 Forward -332 -313 13.9625 0.268
NP_440457.1_1 Forward -382 -370 6.33216 0.123
NP_440457.1_1 Reverse -365 -377 0.137309 0.25
NP_440801.1_9 Reverse -239 -253 16.7136 0.227
NP_441984.1_1 Forward -384 -366 6.214 0.288
NP_440054.1_4 Forward -195 -176 11.7992 0.191
NP_442509.1_9 Forward -378 -368 8.14104 0.192
NP_442509.1_9 Reverse -369 -379 8.14104 0.192
NP_441489.1_3 Forward -210 -196 7.45999 0.266
NP_440554.1_4 Reverse -370 -380 8.92815 0.0646
NP_440554.1_4 Reverse -360 -370 2.53664 0.261
NP_442862.1_3 Reverse -317 -334 4.56207 0.29
NP_441885.1_5 Forward -378 -368 20.9245 0.000538
NP_441885.1_5 Reverse -369 -379 20.9245 0.000538
NP_440478.1_10 Reverse -367 -381 8.65272 0.257
NP_442341.1_7 Forward -379 -365 17.6992 0.0111
NP_442341.1_7 Reverse -368 -382 10.521 0.0625
NP_442341.1_7 Forward -235 -221 8.55439 0.0864
NP_442341.1_9 Forward -380 -366 9.43874 0.152
NP_441173.1_9 Reverse -14 -22 9.75379 0.284
NP_440686.1_2 Forward -128 -109 11.8975 0.256
NP_443000.1_7 Forward -380 -370 19.9412 0.00223
NP_443000.1_7 Reverse -367 -377 10.3048 0.0345
NP_440507.2_3 Reverse -360 -379 7.76679 0.27
NP_441832.1_3 Reverse -99 -118 18.879 0.0381
NP_440275.1_3 Forward -380 -370 15.123 0.0182
NP_440275.1_3 Reverse -367 -377 8.04317 0.0602
NP_440091.1_1 Forward -238 -226 6.82381 0.0912
NP_442451.1_2 Forward -386 -367 -10.7186 0.278
NP_440149.1_8 Forward -378 -359 2.26107 0.112
NP_441105.1_3 Forward -389 -370 -2.75381 0.167
NP_441105.1_3 Reverse -358 -377 -9.53865 0.29
NP_440216.1_1 Reverse -369 -383 -0.787057 0.0284
NP_440216.1_1 Forward -378 -364 -9.24352 0.145
NP_440216.1_1 Forward -165 -151 -12.0951 0.24
NP_440678.1_9 Reverse -220 -239 9.43923 0.279
NP_440172.1_1 Forward -378 -368 15.0247 0.00945
NP_440172.1_1 Reverse -369 -379 15.0247 0.00945
NP_442015.1_10 Reverse -365 -378 20.2755 0.00366
NP_442015.1_10 Forward -382 -369 12.5073 0.0368
NP_441226.1_7 Forward -377 -370 14.4934 0.0123
NP_441226.1_7 Reverse -370 -377 14.4934 0.0123
NP_441226.1_7 Reverse -2 -9 5.64364 0.286
NP_441111.1_7 Forward -377 -369 18.7023 0.00294
NP_441111.1_7 Reverse -370 -378 18.7023 0.00294
NP_441766.1_2 Forward -378 -369 17.5026 0.00297
NP_441766.1_2 Reverse -369 -378 17.5026 0.00297
NP_443052.1_8 Forward -244 -225 10.9142 0.0166
NP_441135.1_4 Reverse -362 -381 1.47442 0.284
NP_440261.1_5 Reverse -157 -170 3.06754 0.0655
NP_440261.1_5 Forward -164 -151 -3.12731 0.115
NP_440261.1_5 Forward -377 -364 -4.40561 0.147
NP_440261.1_5 Reverse -370 -383 -4.40561 0.147
NP_440261.1_5 Forward -233 -220 -11.0921 0.237
NP_440988.1_10 Forward -380 -366 9.15859 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTCCTCCATCGATTCGTCTCTGGCGATCGCCAACGATCTGGGCAGATTTTCGGAAACCAGACGCTCAAACTCAGCGGAAAAATGAAAATTGGGTTGTCCCTTCTTGTGCCAGAACTCCAGCAAATGCTCCACCGAAACCGCCTTATAACGGCCTAGGTACAGGGCTTCGATCACCGCAAGACGAATCCACAGGGCTGAAAAATTCTTAAGCCAGCCATTGATGACCTGTTTGGGGGCCATTCCCCGGAGGTCAAAACAATAGGCAGTCAAAAGCGAAACTGTCTGCAAAATGCCTGGATCCTTTTGAGCCTGGGATATTGTCATATTTGCTAGGGAGCTATGCTTAGTAGTTCCTAGAATACTAGCTCAAGTCCAGTCTGGGAGAAAGGAGGGTCGGCT

CDS

ATGTTTAAACAATTAGGAGTTCTGGCCACATTTATTGCCTTTGCGTTGGCCCTGGCGGTGTCGAGTAATATCCCCAGTGAAGTCACCAGTCTGCCCCAACAATCCCTCACCATTGCCCAACAATCCAAACAACAAGCCCGGCTCCGTTTGCAACGCTCTCTACAGCAATTACTCCTACGGCCCCATCGTTTTTCCGGCTCCAGCAATGGGGTAGTCAATCCCAAGGCAGAATATTTTTAG

Protein

MFKQLGVLATFIAFALALAVSSNIPSEVTSLPQQSLTIAQQSKQQARLRLQRSLQQLLLRPHRFSGSSNGVVNPKAEYF