Your browser is old and dusty. Try Google Chrome!

Details for ssr3452

ORF ssr3452
Accession NP_440417.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY352a(partial copy): 572672 - 572905]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -246 -232 14.1593 0.0392
NP_441061.1_2 Forward -332 -318 1.86788 0.181
NP_441061.1_2 Forward -390 -376 1.27789 0.192
NP_440795.1_7 Forward -246 -239 14.6904 0.0123
NP_440795.1_7 Reverse -239 -246 14.6904 0.0123
NP_440795.1_7 Reverse -325 -332 10.8555 0.132
NP_441418.1_6 Forward -247 -228 8.65258 0.00385
NP_441418.1_6 Forward -391 -372 -0.4922 0.0102
NP_441418.1_6 Reverse -226 -245 -29.5982 0.23
NP_441418.1_6 Reverse -238 -257 -29.7948 0.238
NP_442291.1_5 Forward -334 -318 -3.38305 0.239
NP_441453.1_1 Forward -254 -236 5.22993 0.251
NP_441453.1_1 Reverse -231 -249 4.63995 0.258
NP_441453.1_1 Forward -350 -332 3.16499 0.276
NP_441453.1_4 Reverse -238 -246 16.539 0.00633
NP_441453.1_4 Forward -247 -239 16.539 0.00633
NP_441453.1_4 Forward -391 -383 6.80426 0.121
NP_441453.1_4 Reverse -382 -390 6.11594 0.121
NP_441453.1_4 Forward -69 -61 5.13263 0.179
NP_441453.1_4 Reverse -60 -68 4.83764 0.237
NP_442151.1_6 Reverse -238 -252 17.8958 0.00866
NP_442151.1_6 Forward -382 -368 9.5377 0.145
NP_442151.1_6 Reverse -382 -396 7.76774 0.19
NP_440226.1_1 Reverse -238 -257 2.0644 0.278
NP_440226.1_1 Forward -247 -228 1.86774 0.286
NP_441630.1_3 Forward -399 -380 18.879 0.0306
NP_440813.1_1 Reverse -376 -390 16.1252 0.267
NP_440259.1_4 Reverse -27 -41 11.1424 0.262
NP_442655.1_10 Forward -385 -366 -19.0768 0.282
NP_442173.1_1 Forward -246 -238 15.4574 0.00633
NP_442173.1_1 Reverse -239 -247 15.4574 0.00633
NP_442173.1_1 Reverse -383 -391 12.0158 0.0316
NP_442173.1_1 Forward -390 -382 4.83764 0.241
NP_442752.1_4 Forward -391 -384 13.8055 0.0199
NP_442752.1_4 Forward -247 -240 13.8055 0.0199
NP_442752.1_4 Reverse -238 -245 13.8055 0.0199
NP_442752.1_4 Reverse -324 -331 5.54565 0.194
NP_443027.1_4 Forward -249 -239 15.3197 0.0437
NP_443027.1_4 Reverse -236 -246 13.943 0.0452
NP_443027.1_4 Reverse -322 -332 8.23984 0.215
NP_442975.1_10 Reverse -234 -248 20.6484 0.00165
NP_442975.1_10 Forward -337 -323 5.99717 0.198
NP_442975.1_10 Reverse -378 -392 4.62054 0.241
NP_442975.1_10 Forward -251 -237 3.63724 0.252
NP_440784.1_7 Forward -246 -239 15.9687 0.0123
NP_440784.1_7 Reverse -239 -246 15.9687 0.0123
NP_440784.1_7 Forward -390 -383 6.23397 0.241
NP_440784.1_7 Reverse -383 -390 6.13563 0.241
NP_441476.1_5 Forward -252 -233 0.392778 0.19
NP_440878.1_9 Reverse -363 -382 1.96607 0.177
NP_442062.1_8 Forward -247 -237 19.4496 0.000558
NP_442062.1_8 Reverse -238 -248 10.3048 0.0493
NP_442062.1_8 Reverse -324 -334 5.68323 0.157
NP_440761.1_4 Forward -252 -233 -13.4719 0.257
NP_441859.1_3 Forward -248 -229 2.55527 0.258
NP_441859.1_5 Forward -93 -74 0.982764 0.3
NP_440304.1_4 Forward -249 -239 18.9579 0.00406
NP_440304.1_4 Reverse -236 -246 9.91146 0.051
NP_440304.1_4 Reverse -371 -381 4.3066 0.271
NP_442242.1_4 Forward -246 -239 14.3954 0.0124
NP_442242.1_4 Reverse -239 -246 14.3954 0.0124
NP_441619.1_8 Reverse -61 -75 6.88214 0.295
NP_441208.1_9 Forward -250 -236 16.8142 0.0647
NP_440370.1_10 Forward -256 -237 14.5524 0.0988
NP_440370.1_10 Reverse -373 -392 11.7008 0.176
NP_440132.1_1 Reverse -236 -254 14.4738 0.127
NP_442110.1_7 Reverse -238 -252 11.111 0.0636
NP_440856.1_4 Forward -254 -235 13.0775 0.0346
NP_440856.1_7 Forward -397 -378 -8.94866 0.28
NP_441083.1_5 Reverse -382 -392 17.7779 0.00336
NP_441083.1_5 Forward -247 -237 11.3864 0.0159
NP_441083.1_5 Reverse -238 -248 11.2881 0.0159
NP_441083.1_5 Reverse -67 -77 0.57002 0.223
NP_441083.1_5 Forward -391 -381 -0.904945 0.283
NP_441083.1_5 Forward -333 -323 -0.904945 0.283
NP_441083.1_5 Forward -76 -66 -1.10161 0.295
NP_442827.1_8 Reverse -230 -249 12.3883 0.0469
NP_442827.1_8 Reverse -365 -384 -2.06626 0.267
NP_441434.1_7 Reverse -384 -398 2.85119 0.268
NP_441738.1_2 Reverse -384 -391 15.28 0.0102
NP_441738.1_2 Forward -245 -238 15.28 0.0102
NP_441738.1_2 Reverse -240 -247 15.28 0.0102
NP_441738.1_2 Forward -74 -67 9.77352 0.143
NP_441558.1_5 Forward -249 -230 17.109 0.0231
NP_441558.1_5 Reverse -236 -255 3.93269 0.294
NP_440209.1_1 Reverse -238 -246 18.1123 0.00295
NP_440209.1_1 Forward -247 -239 18.1123 0.00295
NP_440209.1_1 Forward -391 -383 8.57422 0.0425
NP_440209.1_1 Reverse -382 -390 5.52596 0.0821
NP_442765.1_4 Forward -31 -12 14.6508 0.244
NP_440407.1_6 Forward -233 -219 11.0127 0.28
NP_440447.1_6 Reverse -230 -248 1.00246 0.274
NP_441713.1_1 Forward -253 -234 -4.72043 0.113
NP_440178.1_7 Reverse -237 -256 -11.4069 0.0927
NP_440178.1_7 Forward -77 -58 -12.4886 0.121
NP_440178.1_7 Reverse -11 -30 -21.7317 0.237
NP_441716.1_1 Reverse -238 -252 10.6193 0.0936
NP_441716.1_1 Forward -333 -319 2.94952 0.284
NP_442111.1_4 Forward -248 -234 17.7975 0.00941
NP_442111.1_4 Reverse -237 -251 13.0776 0.0399
NP_442111.1_4 Reverse -59 -73 1.96621 0.292
NP_441163.1_9 Reverse -373 -392 13.5691 0.236
NP_440906.1_5 Forward -246 -239 15.8704 0.0124
NP_440906.1_5 Reverse -239 -246 15.8704 0.0124
NP_440906.1_5 Forward -390 -383 6.23397 0.234
NP_440906.1_5 Reverse -383 -390 6.13563 0.241
NP_440747.1_10 Forward -250 -238 7.80712 0.00223
NP_440747.1_10 Reverse -235 -247 -2.1243 0.0225
NP_440747.1_10 Reverse -321 -333 -2.61596 0.0556
NP_440747.1_10 Forward -394 -382 -4.48425 0.101
NP_440747.1_10 Reverse -379 -391 -11.9574 0.178
NP_441130.1_10 Reverse -236 -250 9.73436 0.12
NP_441130.1_10 Reverse -380 -394 8.94771 0.131
NP_441486.1_1 Forward -394 -380 2.35953 0.0844
NP_441486.1_1 Reverse -64 -78 -4.03198 0.186
NP_441486.1_1 Reverse -379 -393 -5.11362 0.222
NP_442634.1_4 Reverse -236 -250 14.3559 0.0195
NP_442634.1_4 Forward -249 -235 4.32615 0.0819
NP_441265.1_3 Forward -253 -239 12.9793 0.0742
NP_440403.1_10 Reverse -373 -392 3.44104 0.273
NP_440842.1_6 Reverse -371 -390 17.8948 0.12
NP_441014.1_10 Forward -248 -229 -2.45958 0.276
NP_442848.1_1 Reverse -232 -246 -2.26202 0.263
NP_442848.1_1 Reverse -376 -390 -4.13031 0.282
NP_443018.1_3 Forward -246 -239 14.8871 0.0123
NP_443018.1_3 Reverse -239 -246 14.8871 0.0123
NP_443018.1_3 Reverse -383 -390 11.7405 0.0655
NP_443018.1_3 Forward -390 -383 5.44732 0.193
NP_441316.1_7 Reverse -236 -251 13.7462 0.0486
NP_441634.1_8 Reverse -322 -336 3.04785 0.157
NP_441634.1_8 Forward -249 -235 -2.65535 0.295
NP_440376.1_1 Forward -247 -238 19.4693 0.000692
NP_440376.1_1 Reverse -238 -247 19.4693 0.000692
NP_440376.1_1 Forward -76 -67 8.06287 0.0463
NP_440376.1_1 Forward -391 -382 5.99792 0.111
NP_440376.1_1 Reverse -60 -69 4.12963 0.173
NP_440376.1_1 Reverse -67 -76 0.393051 0.279
NP_440376.1_1 Reverse -382 -391 -0.196935 0.285
NP_441588.1_4 Reverse -384 -394 18.1713 0.0143
NP_442687.1_7 Reverse -237 -247 15.8113 0.0125
NP_442687.1_7 Forward -22 -12 9.7148 0.0994
NP_442687.1_7 Forward -248 -238 9.02648 0.0994
NP_442687.1_7 Reverse -372 -382 6.66654 0.155
NP_442687.1_7 Reverse -59 -69 3.71661 0.292
NP_442485.1_3 Reverse -371 -390 -0.885524 0.254
NP_442485.1_3 Forward -393 -374 -4.72043 0.285
NP_440042.1_2 Reverse -228 -247 0.294447 0.213
NP_441422.1_7 Reverse -236 -253 -1.73112 0.194
NP_440533.1_9 Reverse -238 -257 7.17762 0.189
NP_441763.1_10 Forward -258 -239 16.1249 0.0969
NP_441763.1_10 Reverse -227 -246 6.88182 0.265
NP_442658.1_1 Reverse -236 -246 18.7607 0.00222
NP_442658.1_1 Forward -249 -239 15.9091 0.00966
NP_442198.1_7 Reverse -235 -254 13.2733 0.185
NP_441855.2_4 Reverse -374 -393 18.7781 0.0307
NP_441414.1_9 Reverse -238 -257 -1.57384 0.102
NP_441414.1_9 Forward -247 -228 -4.03212 0.145
NP_441256.1_8 Forward -22 -3 1.76941 0.288
NP_439959.1_5 Forward -384 -365 13.0775 0.257
NP_442937.1_5 Reverse -233 -252 11.6025 0.133
NP_441958.1_5 Forward -248 -238 21.2195 0.000805
NP_441958.1_5 Reverse -237 -247 12.2714 0.00183
NP_441958.1_5 Reverse -66 -76 1.94665 0.0664
NP_441958.1_5 Forward -77 -67 1.25834 0.108
NP_441958.1_5 Forward -392 -382 0.865012 0.12
NP_441958.1_5 Reverse -59 -69 -1.19994 0.231
NP_440203.1_5 Reverse -241 -251 12.7626 0.138
NP_440984.1_7 Forward -396 -382 8.45605 0.144
NP_439990.1_5 Forward -252 -239 19.3905 0.00775
NP_442376.1_2 Reverse -233 -252 -4.13045 0.238
NP_442911.1_2 Reverse -228 -247 8.94757 0.0188
NP_442911.1_2 Forward -86 -67 -0.39387 0.0747
NP_442911.1_2 Forward -257 -238 -0.688862 0.0775
NP_442911.1_2 Reverse -372 -391 -10.4236 0.279
NP_441580.1_6 Forward -258 -239 -6.1954 0.235
NP_441580.1_6 Reverse -227 -246 -6.78538 0.235
NP_440153.1_5 Forward -246 -232 0.786239 0.289
NP_440200.1_7 Forward -283 -264 8.23655 0.204
NP_443055.1_6 Reverse -355 -373 -2.34152 0.294
NP_440993.1_2 Forward -252 -236 15.4965 0.0631
NP_440993.1_2 Reverse -233 -249 12.1532 0.0735
NP_440993.1_3 Forward -257 -238 -1.77127 0.292
NP_441099.1_5 Reverse -228 -247 16.1257 0.0153
NP_441099.1_5 Forward -257 -238 9.3409 0.0328
NP_441099.1_5 Reverse -363 -382 -5.21209 0.15
NP_441099.1_5 Reverse -314 -333 -11.4069 0.28
NP_442002.1_9 Reverse -237 -244 10.7572 0.185
NP_441654.1_5 Reverse -88 -107 12.732 0.275
NP_441294.1_7 Forward -337 -323 14.242 0.0448
NP_441424.1_2 Forward -91 -72 9.02356 0.292
NP_441646.1_1 Reverse -231 -250 9.43923 0.13
NP_441646.1_1 Forward -83 -64 -1.7705 0.294
NP_442438.1_10 Reverse -233 -247 3.24451 0.165
NP_442438.1_10 Forward -252 -238 2.75286 0.168
NP_442438.1_10 Reverse -352 -366 0.88457 0.213
NP_441000.1_6 Reverse -381 -395 -5.50694 0.279
NP_442771.1_1 Forward -249 -231 0.805796 0.0892
NP_440147.1_4 Reverse -236 -249 12.2123 0.0326
NP_440147.1_4 Forward -249 -236 11.819 0.0326
NP_440147.1_4 Reverse -65 -78 0.805932 0.244
NP_440147.1_4 Forward -71 -58 -0.570702 0.291
NP_441175.1_7 Reverse -67 -86 6.39097 0.258
NP_441550.1_8 Forward -249 -239 17.4824 0.00754
NP_441550.1_8 Forward -393 -383 13.3526 0.0252
NP_441550.1_8 Reverse -236 -246 10.501 0.066
NP_441916.1_7 Reverse -238 -248 18.9579 0.00144
NP_441916.1_7 Forward -247 -237 18.4663 0.00144
NP_441916.1_7 Reverse -60 -70 6.37155 0.0988
NP_441041.1_4 Reverse -238 -257 16.4207 0.0117
NP_441041.1_4 Forward -247 -228 -6.29373 0.166
NP_441041.1_4 Forward -391 -372 -11.5053 0.248
NP_441041.1_7 Forward -250 -238 14.9975 0.0309
NP_441041.1_7 Reverse -235 -247 10.1386 0.102
NP_441041.1_7 Forward -394 -382 7.32042 0.169
NP_441041.1_7 Forward -336 -324 6.34865 0.211
NP_441041.1_7 Forward -385 -373 4.79381 0.295
NP_442004.1_6 Reverse -238 -252 4.12949 0.224
NP_441725.1_4 Forward -252 -238 4.03056 0.278
NP_441725.1_4 Reverse -233 -247 2.35894 0.287
NP_441725.1_5 Forward -246 -236 9.02648 0.0553
NP_441725.1_5 Reverse -239 -249 8.92815 0.0553
NP_441725.1_5 Forward -381 -371 0.176696 0.206
NP_441725.1_5 Forward -390 -380 -0.41329 0.251
NP_439966.1_7 Reverse -380 -390 18.1707 0.00631
NP_439966.1_7 Reverse -236 -246 17.4824 0.00636
NP_439966.1_7 Forward -249 -239 13.8442 0.0234
NP_439966.1_9 Reverse -236 -245 10.7178 0.0863
NP_439966.1_9 Forward -249 -240 0.983037 0.253
NP_440736.1_3 Reverse -58 -77 8.25926 0.158
NP_442941.1_3 Reverse -239 -249 10.9931 0.0116
NP_442941.1_3 Forward -246 -236 2.53664 0.14
NP_442941.1_3 Reverse -383 -393 1.25834 0.15
NP_442941.1_3 Forward -332 -322 0.176696 0.224
NP_440289.1_2 Reverse -235 -248 3.36254 0.0799
NP_440289.1_2 Reverse -379 -392 1.59258 0.122
NP_440289.1_2 Forward -250 -237 -4.50394 0.288
NP_440983.1_9 Forward -256 -237 1.76941 0.292
NP_441514.1_6 Forward -367 -360 12.8221 0.252
NP_442281.1_1 Reverse -377 -391 10.422 0.0589
NP_442281.1_1 Reverse -233 -247 9.73373 0.0675
NP_442281.1_1 Forward -252 -238 6.88214 0.113
NP_441334.1_7 Reverse -236 -255 -9.24366 0.12
NP_441334.1_7 Forward -249 -230 -17.8968 0.275
NP_441079.1_7 Reverse -130 -149 -7.47443 0.294
NP_440437.1_1 Reverse -376 -395 -0.590531 0.183
NP_442012.1_1 Forward -253 -234 14.0608 0.058
NP_442012.1_1 Reverse -232 -251 5.40766 0.153
NP_442012.1_1 Reverse -366 -385 0.294447 0.241
NP_442049.1_6 Forward -399 -380 4.62101 0.247
NP_441457.1_7 Forward -249 -230 7.66927 0.166
NP_442982.1_5 Reverse -57 -76 1.76941 0.228
NP_441644.1_6 Reverse -238 -248 19.0557 0.000803
NP_441644.1_6 Reverse -382 -392 14.4342 0.0126
NP_441644.1_6 Forward -247 -237 10.1076 0.0628
NP_443049.1_6 Forward -392 -382 14.4711 0.114
NP_442215.1_2 Forward -78 -62 -3.28472 0.213
NP_442215.1_2 Reverse -236 -252 -3.38305 0.214
NP_442215.1_2 Reverse -380 -396 -5.25134 0.248
NP_442215.1_2 Forward -335 -319 -7.21796 0.289
NP_440253.1_2 Forward -247 -229 22.3403 0.00289
NP_440929.1_8 Forward -247 -238 19.2726 0.000701
NP_440929.1_8 Reverse -238 -247 19.2726 0.000701
NP_440929.1_8 Reverse -382 -391 7.07956 0.0713
NP_440929.1_8 Reverse -67 -76 6.68623 0.0887
NP_442933.1_10 Forward -247 -238 17.601 0.00325
NP_442933.1_10 Reverse -238 -247 17.601 0.00325
NP_441751.2_8 Reverse -239 -253 5.01447 0.0448
NP_441751.2_8 Forward -332 -318 -3.34366 0.141
NP_441751.2_8 Reverse -374 -388 -6.29359 0.259
NP_442554.1_8 Reverse -239 -249 19.1546 0.00369
NP_442554.1_8 Forward -246 -236 16.008 0.0065
NP_442554.1_8 Reverse -383 -393 5.48657 0.146
NP_442554.1_8 Forward -75 -65 4.20827 0.193
NP_442554.1_8 Forward -390 -380 1.94665 0.288
NP_442554.1_8 Reverse -61 -71 1.74999 0.298
NP_441762.1_7 Forward -248 -236 12.527 0.0142
NP_441762.1_7 Reverse -237 -249 11.7404 0.0142
NP_441762.1_7 Reverse -59 -71 1.02229 0.0747
NP_441762.1_7 Forward -392 -380 -4.77924 0.182
NP_442142.1_4 Forward -250 -237 15.4566 0.0264
NP_442142.1_4 Reverse -379 -392 11.2284 0.0603
NP_442142.1_4 Reverse -235 -248 6.50855 0.163
NP_442292.1_1 Reverse -239 -248 17.5026 0.00435
NP_442292.1_1 Forward -246 -237 9.63616 0.0183
NP_442292.1_1 Reverse -383 -392 8.65285 0.0335
NP_442292.1_1 Forward -75 -66 5.89959 0.128
NP_442292.1_1 Forward -332 -323 -0.786921 0.287
NP_441525.1_1 Reverse -372 -385 17.9155 0.136
NP_442476.1_6 Forward -246 -232 3.34284 0.158
NP_443009.1_5 Forward -248 -237 19.626 0.00102
NP_443009.1_5 Reverse -237 -248 7.82632 0.118
NP_443009.1_5 Reverse -323 -334 6.1547 0.173
NP_441715.1_4 Forward -246 -236 9.32148 0.097
NP_441715.1_4 Reverse -239 -249 7.25653 0.108
NP_440183.1_1 Reverse -239 -258 10.7175 0.244
NP_441198.1_8 Forward -249 -239 15.4199 0.0427
NP_440379.1_5 Reverse -373 -392 -8.16202 0.25
NP_441468.1_1 Forward -246 -239 15.8704 0.0124
NP_441468.1_1 Reverse -239 -246 15.8704 0.0124
NP_441468.1_1 Forward -390 -383 6.13563 0.209
NP_441468.1_1 Reverse -383 -390 6.0373 0.223
NP_441020.2_6 Forward -249 -232 22.2616 0.00186
NP_441020.2_6 Forward -393 -376 10.7569 0.136
NP_441020.2_6 Reverse -65 -82 10.1669 0.151
NP_441015.1_10 Forward -252 -233 1.47442 0.159
NP_441673.1_1 Forward -247 -238 20.8459 0.000698
NP_441673.1_1 Reverse -238 -247 20.8459 0.000698
NP_441673.1_1 Forward -76 -67 1.57302 0.0764
NP_441673.1_1 Reverse -67 -76 1.57302 0.0764
NP_441673.1_1 Forward -391 -382 1.37636 0.114
NP_441673.1_1 Reverse -382 -391 1.1797 0.163
NP_441826.1_2 Reverse -376 -390 6.6861 0.0907
NP_441826.1_2 Reverse -232 -246 2.35953 0.129
NP_441826.1_2 Forward -388 -374 -2.55701 0.273
NP_441826.1_2 Forward -253 -239 -2.55701 0.273
NP_441826.1_6 Forward -25 -11 13.1759 0.261
NP_441330.1_1 Forward -252 -233 -13.0786 0.183
NP_442490.1_9 Reverse -226 -245 0.786102 0.167
NP_441764.1_10 Reverse -131 -150 19.3367 0.231
NP_442868.1_6 Forward -249 -239 8.63316 0.0555
NP_442868.1_6 Reverse -236 -246 8.53483 0.0555
NP_442868.1_6 Forward -393 -383 0.0783647 0.248
NP_442868.1_6 Reverse -322 -332 -0.0199663 0.255
NP_441251.1_7 Reverse -91 -104 14.1789 0.266
NP_441056.1_1 Forward -391 -372 -9.44032 0.3
NP_440051.1_5 Forward -145 -131 13.5751 0.294
NP_441612.1_2 Reverse -124 -134 11.7441 0.21
NP_442227.1_2 Reverse -375 -394 -3.54046 0.293
NP_442361.1_3 Forward -397 -384 8.37742 0.285
NP_442808.1_1 Reverse -381 -391 19.449 0.00201
NP_442808.1_1 Reverse -237 -247 18.4657 0.00201
NP_442808.1_1 Forward -248 -238 8.73102 0.0481
NP_441101.1_1 Forward -249 -231 12.2122 0.247
NP_440145.1_3 Forward -257 -238 16.0274 0.0103
NP_440145.1_3 Reverse -50 -69 -5.01543 0.257
NP_442542.1_2 Forward -384 -371 11.3273 0.114
NP_442050.1_5 Forward -249 -239 17.1874 0.00812
NP_442050.1_5 Reverse -236 -246 8.23937 0.234
NP_442342.1_9 Reverse -236 -252 17.7581 0.0732
NP_440558.1_2 Forward -364 -345 -3.04881 0.232
NP_440558.1_2 Reverse -373 -392 -7.4737 0.294
NP_442789.1_4 Reverse -371 -390 -8.06369 0.299
NP_441518.1_3 Reverse -228 -247 -15.5368 0.296
NP_441878.1_6 Forward -248 -238 10.5014 0.0176
NP_441878.1_6 Reverse -237 -247 10.4031 0.0176
NP_441878.1_6 Forward -77 -67 1.55333 0.0937
NP_441878.1_6 Forward -383 -373 -6.70647 0.194
NP_441878.1_6 Reverse -59 -69 -7.39479 0.222
NP_441036.1_8 Reverse -237 -247 17.7779 0.000554
NP_441036.1_8 Forward -248 -238 15.713 0.00724
NP_441036.1_8 Reverse -381 -391 6.07655 0.242
NP_441036.1_8 Reverse -55 -65 5.97822 0.246
NP_441557.1_5 Forward -247 -238 19.9609 0.000699
NP_441557.1_5 Reverse -238 -247 19.9609 0.000699
NP_441557.1_5 Forward -391 -382 1.08137 0.0794
NP_441557.1_5 Forward -76 -67 0.688044 0.128
NP_441557.1_5 Reverse -67 -76 0.688044 0.128
NP_441557.1_5 Reverse -382 -391 0.589713 0.134
NP_441557.1_5 Forward -69 -60 -0.983583 0.272
NP_441445.1_1 Forward -391 -372 1.47442 0.255
NP_441445.1_1 Forward -400 -381 -0.000545616 0.283
NP_442066.2_4 Reverse -238 -257 3.24438 0.121
NP_442066.2_4 Forward -247 -228 -9.24366 0.296
NP_442066.2_9 Reverse -234 -247 10.5407 0.154
NP_441308.1_8 Forward -249 -239 12.4681 0.218
NP_441308.1_8 Reverse -236 -246 9.22315 0.226
NP_440101.1_10 Reverse -232 -251 3.44104 0.236
NP_441458.1_10 Reverse -373 -392 2.0644 0.274
NP_442183.1_1 Forward -247 -233 21.1407 0.00376
NP_442183.1_1 Forward -391 -377 15.0442 0.0248
NP_442183.1_1 Reverse -238 -252 8.45605 0.115
NP_441574.1_1 Reverse -226 -245 -0.590531 0.208
NP_441574.1_1 Forward -247 -228 -3.24547 0.238
NP_440157.1_5 Forward -171 -152 15.0396 0.272
NP_442347.1_2 Forward -332 -323 17.9943 0.056
NP_442347.1_2 Forward -246 -237 11.1111 0.056
NP_442347.1_2 Reverse -383 -392 10.3245 0.058
NP_442347.1_2 Reverse -297 -306 4.71961 0.266
NP_442347.1_2 Forward -102 -93 4.32629 0.284
NP_442347.1_2 Reverse -239 -248 3.34298 0.284
NP_442645.1_2 Forward -84 -65 -12.5869 0.144
NP_442645.1_2 Reverse -59 -78 -14.9469 0.185
NP_442645.1_2 Reverse -52 -71 -22.9117 0.299
NP_441037.1_4 Forward -249 -239 16.5761 0.0168
NP_441037.1_4 Reverse -236 -246 16.2838 0.0168
NP_441037.1_4 Forward -71 -61 6.44058 0.263
NP_441633.1_3 Reverse -236 -249 5.91914 0.0481
NP_441633.1_3 Forward -249 -236 3.95252 0.0699
NP_441633.1_3 Forward -335 -322 -6.56889 0.259
NP_441633.1_3 Reverse -371 -384 -6.66722 0.265
NP_440136.1_2 Forward -246 -239 15.9687 0.0123
NP_440136.1_2 Reverse -239 -246 15.9687 0.0123
NP_440136.1_2 Forward -390 -383 6.23397 0.171
NP_440136.1_2 Reverse -383 -390 6.13563 0.193
NP_440136.1_2 Reverse -325 -332 3.97235 0.288
NP_441728.2_4 Forward -94 -75 12.8432 0.263
NP_442998.1_10 Reverse -384 -391 15.5754 0.0102
NP_442998.1_10 Forward -245 -238 15.5754 0.0102
NP_442998.1_10 Reverse -240 -247 15.5754 0.0102
NP_440899.1_5 Reverse -363 -382 8.16093 0.242
NP_440899.1_8 Reverse -26 -45 -8.65367 0.258
NP_440299.1_1 Reverse -234 -247 20.0782 0.0014
NP_440299.1_1 Forward -251 -238 12.7034 0.0356
NP_441799.1_1 Forward -80 -66 10.6187 0.0702
NP_441799.1_1 Forward -251 -237 9.34041 0.0942
NP_441799.1_1 Forward -395 -381 6.88214 0.158
NP_441799.1_1 Reverse -234 -248 3.44058 0.298
NP_442802.1_6 Forward -248 -229 2.16274 0.204
NP_441007.1_10 Forward -252 -239 3.85419 0.182
NP_441007.1_10 Reverse -233 -246 1.59258 0.203
NP_441007.1_10 Forward -396 -383 0.707601 0.219
NP_441007.1_10 Forward -387 -374 -1.06236 0.3
NP_440256.1_1 Forward -394 -375 5.89931 0.0331
NP_440256.1_1 Forward -250 -231 0.786102 0.0805
NP_441559.1_8 Forward -252 -238 10.7177 0.0574
NP_441559.1_8 Reverse -351 -365 -0.000409212 0.171
NP_441559.1_8 Forward -386 -372 -5.90027 0.271
NP_441559.1_8 Reverse -233 -247 -6.29359 0.276
NP_440915.1_6 Reverse -234 -248 23.9923 0.000827
NP_440915.1_6 Forward -251 -237 13.3726 0.0187
NP_442452.1_8 Forward -253 -239 13.7653 0.273
NP_440243.1_2 Reverse -356 -370 19.7913 0.235
NP_442866.1_1 Reverse -233 -252 -5.9004 0.245
NP_442866.1_1 Forward -396 -377 -6.98204 0.263
NP_441464.1_8 Reverse -373 -387 3.93283 0.283
NP_441939.1_3 Reverse -343 -362 7.7676 0.19
NP_441199.1_6 Forward -251 -232 12.4875 0.0591
NP_441199.1_6 Reverse -234 -253 6.58763 0.132
NP_441494.1_6 Forward -252 -239 8.9674 0.227
NP_442386.1_9 Reverse -237 -246 15.7322 0.0144
NP_442386.1_9 Reverse -381 -390 13.8639 0.0289
NP_442386.1_9 Forward -352 -343 8.06244 0.209
NP_442386.1_9 Forward -248 -239 6.39082 0.219
NP_440570.1_5 Reverse -228 -247 -3.54046 0.29
NP_441340.1_5 Forward -246 -239 15.6737 0.0124
NP_441340.1_5 Reverse -239 -246 15.6737 0.0124
NP_441340.1_5 Forward -390 -383 13.5105 0.0314
NP_441340.1_5 Reverse -61 -68 11.0522 0.0749
NP_441340.1_5 Reverse -383 -390 5.84064 0.208
NP_441340.1_9 Forward -275 -265 16.0642 0.194
NP_440168.1_9 Reverse -371 -390 -1.27885 0.273
NP_442240.1_2 Reverse -239 -258 -12.5869 0.163
NP_440211.1_4 Forward -110 -100 17.0896 0.209
NP_440586.1_8 Forward -246 -239 13.2151 0.026
NP_440586.1_8 Reverse -239 -246 13.2151 0.026
NP_440586.1_8 Reverse -383 -390 9.47853 0.146
NP_440586.1_8 Forward -390 -383 5.74197 0.283
NP_442251.1_6 Forward -246 -239 15.2804 0.0124
NP_442251.1_6 Reverse -239 -246 15.2804 0.0124
NP_440192.1_4 Reverse -236 -255 8.62144 0.292
NP_440684.1_9 Forward -75 -61 8.45605 0.23
NP_441262.1_3 Reverse -238 -245 14.7888 0.0223
NP_441262.1_3 Forward -391 -384 14.7888 0.0223
NP_441262.1_3 Forward -247 -240 14.7888 0.0223
NP_440027.1_3 Reverse -372 -390 10.8348 0.164
NP_440027.1_3 Forward -361 -343 5.81991 0.236
NP_443051.1_1 Forward -248 -239 19.5676 0.00335
NP_443051.1_1 Reverse -237 -246 10.4228 0.00754
NP_443051.1_1 Forward -392 -383 7.47288 0.0571
NP_443051.1_1 Reverse -66 -75 0.29472 0.195
NP_443051.1_1 Forward -77 -68 -1.18024 0.297
NP_441232.1_10 Forward -80 -61 1.0811 0.289
NP_439937.1_8 Forward -357 -338 -4.22878 0.28
NP_439937.1_9 Reverse -237 -254 1.11978 0.0948
NP_441595.1_2 Forward -184 -171 8.46506 0.29
NP_440408.1_10 Forward -253 -234 9.83255 0.176
NP_440439.1_1 Forward -250 -237 17.5222 0.0105
NP_440439.1_1 Reverse -235 -248 9.2624 0.0465
NP_440439.1_1 Forward -308 -295 -1.35735 0.263
NP_440372.1_2 Forward -246 -239 16.3621 0.0124
NP_440372.1_2 Reverse -239 -246 16.3621 0.0124
NP_440372.1_2 Forward -390 -383 13.8055 0.0214
NP_440372.1_2 Reverse -383 -390 6.52896 0.188
NP_440372.1_2 Reverse -61 -68 4.07068 0.262
NP_441181.1_6 Forward -332 -314 3.65739 0.268
NP_440378.1_7 Forward -109 -90 13.1758 0.205
NP_440316.1_10 Reverse -317 -327 5.68323 0.29
NP_441803.1_2 Reverse -377 -396 2.75272 0.204
NP_441803.1_2 Forward -252 -233 -0.295539 0.272
NP_439977.1_5 Forward -253 -234 14.4541 0.0531
NP_439977.1_5 Reverse -232 -251 13.2741 0.0531
NP_440139.1_1 Reverse -54 -73 6.58682 0.14
NP_442384.1_10 Forward -247 -234 9.95071 0.047
NP_442384.1_10 Reverse -238 -251 9.36073 0.054
NP_442384.1_10 Forward -333 -320 8.86907 0.0606
NP_442384.1_10 Reverse -67 -80 4.64084 0.151
NP_442114.1_4 Forward -247 -236 12.1534 0.107
NP_441877.1_7 Reverse -233 -252 0.392004 0.266
NP_441018.1_7 Forward -395 -376 17.2074 0.0724
NP_442790.1_4 Reverse -229 -248 -4.81876 0.135
NP_442262.1_10 Forward -246 -239 14.1988 0.0123
NP_442262.1_10 Reverse -239 -246 14.1988 0.0123
NP_442262.1_10 Reverse -383 -390 13.2155 0.0213
NP_441689.1_5 Forward -249 -239 8.43603 0.132
NP_440344.1_10 Reverse -375 -392 0.530496 0.0353
NP_440344.1_10 Forward -254 -237 -0.0594896 0.0381
NP_440344.1_10 Reverse -231 -248 -0.846137 0.0466
NP_440344.1_10 Forward -340 -323 -11.1709 0.205
NP_440531.1_6 Forward -399 -380 -2.36049 0.249
NP_441965.1_10 Reverse -235 -251 5.76173 0.197
NP_441965.1_10 Reverse -339 -355 4.77842 0.231
NP_440297.1_9 Forward -246 -236 -0.216628 0.282
NP_440297.1_9 Reverse -347 -357 -0.216628 0.282
NP_440297.1_9 Reverse -239 -249 -0.314959 0.282
NP_442187.1_3 Forward -392 -382 15.6147 0.105
NP_441896.1_3 Reverse -229 -248 10.2259 0.0847
NP_440990.1_7 Reverse -226 -245 12.8808 0.16
NP_440894.1_10 Reverse -233 -252 3.53937 0.271
NP_440894.1_10 Forward -252 -233 3.24438 0.276
YP_680420.1_1 Reverse -65 -84 8.06259 0.244
NP_440999.1_9 Reverse -234 -248 12.291 0.0414
NP_440999.1_9 Forward -251 -237 3.93283 0.12
NP_440999.1_9 Reverse -378 -392 3.34284 0.131
NP_440888.1_2 Forward -247 -233 18.6818 0.00204
NP_440888.1_2 Reverse -238 -252 16.0269 0.00832
NP_440888.1_2 Reverse -382 -396 5.40719 0.28
NP_440888.1_2 Forward -76 -62 5.21053 0.288
NP_440491.1_1 Reverse -379 -398 8.47633 0.241
NP_440491.1_1 Forward -250 -231 8.28142 0.246
NP_442948.1_2 Forward -392 -373 2.75272 0.3
NP_442277.1_4 Reverse -229 -248 5.80018 0.172
NP_442277.1_4 Reverse -337 -356 0.981987 0.291
NP_442033.1_10 Reverse -236 -255 19.174 0.0224
NP_442033.1_10 Forward -384 -365 -11.8986 0.26
NP_441949.1_2 Reverse -228 -247 4.42435 0.261
NP_441543.1_2 Forward -246 -237 18.486 0.00236
NP_441543.1_2 Reverse -239 -248 15.9293 0.00518
NP_441543.1_2 Reverse -383 -392 7.07956 0.131
NP_441543.1_2 Reverse -61 -70 6.09625 0.153
NP_442845.1_2 Forward -253 -239 10.226 0.156
NP_442845.1_2 Reverse -336 -350 7.17775 0.198
NP_442845.1_2 Forward -397 -383 6.78443 0.202
NP_441304.1_10 Forward -368 -359 15.1427 0.164
NP_441469.1_8 Reverse -237 -246 16.126 0.00797
NP_441469.1_8 Forward -334 -325 6.8829 0.227
NP_441469.1_8 Forward -248 -239 6.5879 0.227
NP_441469.1_8 Reverse -381 -390 5.60459 0.258
NP_443064.1_6 Reverse -238 -248 10.8217 0.13
NP_442578.1_7 Forward -246 -239 14.5921 0.026
NP_442578.1_7 Reverse -239 -246 14.5921 0.026
NP_442578.1_7 Forward -390 -383 6.0373 0.18
NP_441462.1_2 Reverse -238 -248 20.2362 0.000805
NP_441462.1_2 Forward -247 -237 11.5831 0.00406
NP_441462.1_2 Forward -391 -381 7.55152 0.0543
NP_441462.1_2 Reverse -67 -77 1.25834 0.0964
NP_441462.1_2 Forward -76 -66 0.963343 0.109
NP_441462.1_2 Forward -69 -59 -0.511621 0.236
NP_441462.1_2 Reverse -373 -383 -0.806614 0.254
NP_441621.1_7 Reverse -236 -250 23.7957 0.00827
NP_441621.1_7 Forward -249 -235 6.58777 0.068
NP_443062.1_1 Reverse -238 -256 18.7842 0.022
NP_443062.1_1 Forward -333 -315 9.42349 0.134
NP_443062.1_1 Forward -247 -229 3.76806 0.285
NP_442204.1_1 Forward -251 -240 11.9567 0.0565
NP_440516.1_8 Forward -391 -382 18.9776 0.00442
NP_440516.1_8 Forward -247 -238 16.9127 0.00442
NP_440516.1_8 Reverse -238 -247 16.9127 0.00442
NP_440516.1_8 Reverse -382 -391 5.01461 0.118
NP_442428.1_4 Reverse -237 -256 3.83436 0.238
NP_442428.1_5 Forward -246 -239 15.8704 0.0124
NP_442428.1_5 Reverse -239 -246 15.8704 0.0124
NP_442428.1_5 Forward -332 -325 9.57722 0.0852
NP_442428.1_5 Forward -390 -383 6.13563 0.209
NP_442428.1_5 Reverse -383 -390 6.0373 0.212
NP_442120.1_10 Reverse -232 -251 -14.2585 0.288
NP_440673.1_2 Reverse -228 -247 11.8529 0.162
NP_440673.1_3 Forward -245 -238 12.4288 0.0426
NP_440673.1_3 Reverse -384 -391 12.4288 0.0426
NP_440673.1_3 Reverse -240 -247 12.4288 0.0426
NP_440865.1_9 Forward -253 -234 -3.04881 0.191
NP_441052.1_2 Reverse -382 -392 10.6981 0.0285
NP_441052.1_2 Forward -247 -237 10.5014 0.0285
NP_441052.1_2 Reverse -238 -248 10.4031 0.0285
NP_441052.1_2 Forward -333 -323 7.25653 0.0765
NP_442219.1_9 Forward -332 -323 11.6028 0.0526
NP_442219.1_9 Forward -246 -237 8.35786 0.0681
NP_442219.1_9 Reverse -239 -248 8.25953 0.0681
NP_442219.1_9 Reverse -383 -392 7.96454 0.0696
NP_440436.1_4 Forward -246 -237 18.1905 0.00233
NP_440436.1_4 Reverse -239 -248 9.24241 0.0871
NP_440436.1_4 Reverse -383 -392 7.57079 0.124
NP_440436.1_4 Forward -332 -323 4.42421 0.265
NP_441884.1_8 Reverse -237 -256 -7.37537 0.249
NP_441884.1_8 Forward -392 -373 -13.4719 0.282
NP_441884.1_9 Forward -250 -231 -13.7669 0.138
NP_441884.1_9 Reverse -235 -254 -22.3217 0.277
NP_441884.1_9 Reverse -379 -398 -24.5833 0.288
NP_440314.1_9 Reverse -239 -258 -3.04881 0.173
NP_440314.1_9 Reverse -61 -80 -8.16202 0.245
NP_440314.1_9 Forward -246 -227 -8.752 0.253
NP_440648.1_1 Reverse -238 -257 14.9458 0.0772
NP_440041.1_8 Reverse -313 -332 7.37428 0.229
NP_441719.1_4 Forward -246 -239 16.3621 0.0124
NP_441719.1_4 Reverse -239 -246 16.3621 0.0124
NP_441719.1_4 Forward -390 -383 6.82395 0.0855
NP_441719.1_4 Reverse -383 -390 6.52896 0.188
NP_441733.1_10 Forward -250 -237 15.6539 0.0564
NP_441733.1_10 Forward -394 -381 10.5407 0.106
NP_441733.1_10 Reverse -235 -248 7.78743 0.15
NP_441004.1_1 Forward -397 -378 -15.3402 0.275
NP_441004.1_1 Reverse -232 -251 -17.1101 0.289
NP_442366.1_3 Reverse -237 -255 -3.32411 0.246
NP_442366.1_3 Forward -334 -316 -3.71743 0.255
NP_442366.1_5 Forward -394 -384 14.8275 0.0375
NP_442873.1_3 Reverse -228 -247 7.57013 0.209
NP_440296.1_10 Forward -238 -219 -7.08038 0.229
NP_441115.1_4 Reverse -237 -255 16.2429 0.0301
NP_441115.1_4 Forward -248 -230 9.75313 0.202
NP_442206.1_10 Forward -391 -376 8.92802 0.167
NP_442206.1_10 Reverse -238 -253 2.8315 0.198
NP_442206.1_10 Forward -247 -232 2.43817 0.201
NP_443054.1_2 Forward -249 -235 3.14618 0.24
NP_443054.1_2 Reverse -380 -394 0.491246 0.262
NP_442430.1_10 Forward -257 -238 10.815 0.262
NP_441966.1_7 Reverse -363 -382 5.50519 0.192
NP_441851.1_10 Reverse -237 -247 16.008 0.00552
NP_441851.1_10 Forward -248 -238 8.53483 0.114
NP_441851.1_10 Reverse -323 -333 4.99491 0.233
NP_441668.1_4 Forward -86 -67 0.491109 0.237
NP_442515.1_1 Reverse -372 -386 12.4876 0.0339
NP_442515.1_1 Forward -248 -234 -1.67204 0.26
NP_440463.1_8 Forward -353 -334 5.56364 0.277
NP_442689.1_3 Forward -29 -10 15.6341 0.123
NP_441349.1_10 Forward -257 -238 -9.14533 0.284
NP_441409.1_6 Forward -253 -234 -7.57203 0.153
NP_440432.1_9 Forward -246 -231 8.43636 0.0427
NP_440432.1_9 Reverse -239 -254 -3.26502 0.179
NP_442843.1_1 Forward -390 -371 -11.0136 0.285
NP_440474.1_8 Forward -246 -232 8.65209 0.183
NP_440588.1_2 Reverse -315 -334 2.85105 0.112
NP_440588.1_2 Forward -256 -237 -4.22878 0.21
NP_439950.1_1 Forward -307 -298 12.4878 0.279
NP_440195.1_4 Reverse -226 -245 9.3409 0.189
NP_441003.1_9 Reverse -303 -322 5.01433 0.271
NP_441570.1_1 Forward -391 -373 1.29745 0.0315
NP_441570.1_1 Reverse -238 -256 -6.96235 0.0829
NP_440078.1_10 Reverse -238 -257 7.86593 0.216
NP_441078.1_4 Forward -247 -238 19.6659 0.0007
NP_441078.1_4 Reverse -238 -247 19.6659 0.0007
NP_441078.1_4 Reverse -67 -76 0.589713 0.174
NP_441078.1_4 Forward -76 -67 0.393051 0.205
NP_441078.1_4 Forward -391 -382 0.196389 0.205
NP_441078.1_4 Reverse -382 -391 -0.000272808 0.205
NP_441078.1_4 Forward -69 -60 -1.57357 0.266
NP_442729.1_8 Reverse -234 -247 17.9155 0.0343
NP_442729.1_8 Reverse -369 -382 5.72248 0.233
NP_442348.1_2 Forward -305 -296 7.57121 0.28
NP_442443.1_1 Forward -390 -371 -3.14714 0.264
NP_440526.1_3 Reverse -239 -250 9.3996 0.0876
NP_440526.1_3 Forward -246 -235 2.51647 0.267
NP_440526.1_3 Reverse -383 -394 0.64819 0.273
NP_441432.1_8 Forward -248 -239 16.8143 0.00595
NP_441432.1_8 Forward -392 -383 14.0611 0.0258
NP_441432.1_8 Reverse -237 -246 8.25953 0.0755
NP_441432.1_8 Reverse -323 -332 4.0313 0.24
NP_442320.1_8 Reverse -232 -246 14.4542 0.0132
NP_442320.1_8 Forward -253 -239 -0.688726 0.0817
NP_441732.1_2 Forward -251 -235 3.40179 0.0141
NP_441732.1_2 Reverse -234 -250 -15.0844 0.145
NP_441732.1_2 Reverse -378 -394 -17.7394 0.292
NP_440760.1_1 Reverse -67 -86 -11.1119 0.0851
NP_440760.1_1 Reverse -238 -257 -20.7484 0.225
NP_440760.1_1 Forward -247 -228 -21.1417 0.231
NP_440760.1_9 Reverse -7 -26 9.24257 0.277
NP_440199.1_10 Forward -394 -384 7.25653 0.231
NP_440578.1_8 Forward -391 -372 13.8641 0.238
NP_441805.1_2 Forward -258 -239 -4.52377 0.275
NP_441057.1_4 Forward -392 -374 -3.91409 0.299
NP_440713.1_4 Forward -257 -238 10.2259 0.13
NP_442489.1_7 Forward -247 -238 20.1576 0.000695
NP_442489.1_7 Reverse -238 -247 20.1576 0.000695
NP_442489.1_7 Forward -76 -67 0.884706 0.145
NP_442489.1_7 Reverse -67 -76 0.884706 0.145
NP_442489.1_7 Forward -391 -382 0.688044 0.152
NP_442489.1_7 Reverse -382 -391 0.688044 0.152
NP_442489.1_7 Forward -382 -373 -1.6719 0.235
NP_441706.1_1 Reverse -156 -175 3.73603 0.0988
NP_442079.1_7 Reverse -239 -258 12.7825 0.0838
NP_442079.1_7 Forward -246 -227 5.211 0.178
NP_440559.1_1 Forward -246 -237 8.75118 0.0586
NP_440559.1_1 Reverse -239 -248 8.65285 0.0586
NP_440559.1_1 Reverse -383 -392 7.76787 0.0918
NP_441659.2_8 Reverse -238 -248 20.9245 0.000805
NP_441659.2_8 Forward -247 -237 11.9764 0.0147
NP_441659.2_8 Reverse -382 -392 5.48657 0.106
NP_441659.2_8 Forward -76 -66 1.65166 0.233
NP_441659.2_8 Reverse -67 -77 0.176696 0.271
NP_441040.1_2 Forward -393 -374 -15.9302 0.289
NP_441040.1_5 Forward -223 -204 2.0644 0.294
NP_439956.1_7 Reverse -232 -251 1.96607 0.276
NP_442776.1_8 Reverse -375 -394 15.0432 0.21
NP_442346.1_2 Forward -258 -239 13.1758 0.216
NP_442346.1_5 Forward -248 -238 16.303 0.00248
NP_442346.1_5 Reverse -237 -247 9.02648 0.118
NP_442346.1_5 Reverse -372 -382 8.04317 0.149
NP_440352.1_5 Forward -283 -264 9.63828 0.294
NP_440545.1_3 Forward -251 -234 17.7384 0.0108
NP_440545.1_3 Reverse -234 -251 10.5603 0.0314
NP_440545.1_5 Forward -395 -378 4.6604 0.244
NP_441856.1_3 Reverse -235 -254 8.55425 0.101
NP_441653.1_2 Reverse -227 -246 3.04645 0.277
NP_440010.1_4 Reverse -372 -391 -2.55791 0.284
NP_440010.1_10 Forward -394 -375 2.65439 0.275
NP_442603.1_7 Reverse -238 -252 10.0287 0.134
NP_442603.1_7 Forward -391 -377 9.14375 0.155
NP_442603.1_7 Forward -247 -233 8.84875 0.162
NP_441888.1_7 Reverse -233 -247 12.6843 0.0743
NP_441888.1_7 Reverse -377 -391 0.88457 0.276
NP_440449.1_6 Reverse -230 -248 11.7573 0.128
NP_441948.1_4 Forward -340 -322 7.09898 0.0626
NP_441502.1_3 Forward -249 -230 8.25926 0.218
NP_441833.1_4 Forward -246 -239 15.9687 0.0124
NP_441833.1_4 Reverse -239 -246 15.9687 0.0124
NP_441833.1_4 Reverse -383 -390 6.52896 0.0924
NP_441833.1_4 Forward -390 -383 6.23397 0.163
NP_442699.1_8 Reverse -117 -136 -11.9969 0.238
NP_442162.1_9 Forward -246 -239 16.2637 0.0124
NP_442162.1_9 Reverse -239 -246 16.2637 0.0124
NP_442162.1_9 Forward -390 -383 12.9205 0.0282
NP_442162.1_9 Reverse -383 -390 12.9205 0.0282
NP_440671.1_4 Reverse -376 -390 16.7159 0.0263
NP_440671.1_4 Forward -253 -239 7.9644 0.205
NP_440204.1_5 Forward -147 -128 13.7963 0.23
NP_442199.1_5 Reverse -230 -249 -4.72043 0.229
NP_442140.1_3 Forward -246 -236 17.4829 0.0159
NP_442140.1_3 Reverse -383 -393 10.2065 0.0902
NP_442140.1_3 Reverse -239 -249 7.94484 0.124
NP_442140.1_3 Reverse -61 -71 3.42162 0.297
NP_442021.1_3 Reverse -232 -251 -6.49039 0.257
NP_441609.1_1 Reverse -78 -97 1.47442 0.196
NP_440875.1_9 Reverse -240 -250 17.5217 0.0116
NP_440875.1_9 Forward -245 -235 9.44274 0.233
NP_441813.1_5 Reverse -380 -390 14.0414 0.0172
NP_441813.1_5 Reverse -236 -246 10.0098 0.0208
NP_441813.1_5 Forward -249 -239 8.73149 0.0367
NP_440590.1_4 Forward -246 -233 13.0973 0.013
NP_440590.1_4 Reverse -239 -252 6.4108 0.0575
NP_440590.1_4 Reverse -383 -396 -0.177378 0.179
NP_440567.1_1 Forward -246 -232 14.5526 0.0187
NP_440567.1_1 Reverse -239 -253 9.83269 0.0414
NP_440567.1_1 Reverse -383 -397 2.94952 0.157
NP_440567.1_1 Forward -75 -61 1.96621 0.188
NP_442497.1_10 Reverse -239 -248 17.601 0.00813
NP_442497.1_10 Forward -246 -237 10.4228 0.0087
NP_442497.1_10 Reverse -383 -392 0.589713 0.153
NP_442497.1_10 Reverse -68 -77 0.589713 0.153
NP_440821.1_4 Reverse -236 -246 18.7612 0.00422
NP_440821.1_4 Forward -249 -239 10.7964 0.0146
NP_440821.1_4 Reverse -380 -390 6.8632 0.0814
NP_440821.1_4 Forward -393 -383 -0.314959 0.251
NP_441239.1_9 Forward -249 -237 17.4436 0.0146
NP_441239.1_9 Reverse -236 -248 16.0669 0.0175
NP_441239.1_9 Reverse -380 -392 11.7404 0.0551
NP_441951.1_4 Forward -247 -228 4.32602 0.273
NP_441951.1_4 Forward -397 -378 3.83436 0.273
NP_441009.1_4 Reverse -238 -257 17.994 0.131
NP_442568.1_1 Reverse -70 -89 4.81688 0.267
NP_441892.1_1 Forward -256 -239 1.21881 0.155
NP_441892.1_1 Forward -213 -196 -2.51776 0.223
NP_441892.1_2 Reverse -363 -382 -1.67217 0.18
NP_440604.1_6 Reverse -238 -257 3.73603 0.131
NP_442044.1_1 Forward -252 -233 -12.9802 0.273
NP_442643.1_1 Reverse -232 -251 -11.1119 0.231
NP_442216.1_4 Reverse -358 -366 8.1805 0.255
NP_440876.1_5 Forward -245 -226 4.42435 0.299
NP_440949.1_7 Reverse -374 -393 13.3716 0.209
NP_442138.1_10 Forward -244 -225 -3.73712 0.242
NP_440546.1_4 Forward -391 -381 14.0213 0.0459
NP_440546.1_4 Reverse -238 -248 13.5365 0.0459
NP_440546.1_4 Forward -247 -237 11.8882 0.0679
NP_440546.1_4 Reverse -60 -70 10.8217 0.104
NP_440546.1_4 Forward -69 -59 8.6886 0.176
NP_440546.1_4 Reverse -342 -352 6.8464 0.276
NP_440462.1_6 Forward -249 -239 19.4496 0.00371
NP_440462.1_6 Reverse -236 -246 17.9746 0.00578
NP_440462.1_6 Reverse -380 -390 11.4848 0.0396
NP_442611.1_1 Forward -252 -233 18.3873 0.0372
NP_442611.1_1 Reverse -238 -257 -2.85214 0.295
NP_440868.1_4 Forward -251 -239 7.4138 0.0691
NP_440868.1_4 Forward -395 -383 5.64384 0.0949
NP_440868.1_4 Reverse -234 -246 2.89058 0.145
NP_440868.1_4 Reverse -378 -390 0.628964 0.206
NP_440401.1_5 Reverse -370 -384 16.9125 0.22
NP_442499.1_3 Reverse -237 -255 4.44404 0.289
NP_441084.1_6 Forward -249 -235 13.3194 0.135
NP_439942.1_7 Forward -261 -242 -5.50708 0.279
NP_442039.1_4 Forward -246 -239 15.1821 0.0124
NP_442039.1_4 Reverse -239 -246 15.1821 0.0124
NP_442039.1_4 Forward -390 -383 11.6422 0.0747
NP_442039.1_4 Reverse -61 -68 8.59391 0.193
NP_442039.1_7 Forward -113 -103 6.76487 0.299
NP_442679.1_1 Forward -46 -27 -1.37718 0.231
NP_442679.1_1 Forward -45 -26 -2.85214 0.244
NP_440825.1_7 Reverse -383 -393 10.9578 0.278
NP_442837.1_3 Forward -246 -239 15.7721 0.0124
NP_442837.1_3 Reverse -239 -246 15.7721 0.0124
NP_442837.1_3 Forward -332 -325 10.1672 0.0935
NP_442837.1_3 Forward -390 -383 6.0373 0.25
NP_442837.1_3 Reverse -383 -390 6.0373 0.25
NP_442053.1_1 Forward -247 -238 18.3876 0.0007
NP_442053.1_1 Reverse -238 -247 18.3876 0.0007
NP_442053.1_1 Reverse -382 -391 14.4544 0.0114
NP_442053.1_1 Forward -391 -382 7.86621 0.0863
NP_442053.1_1 Reverse -67 -76 5.80125 0.164
NP_442053.1_1 Forward -76 -67 5.40793 0.187
NP_440505.1_3 Forward -249 -239 15.418 0.0114
NP_440505.1_3 Reverse -236 -246 14.1397 0.0235
NP_440505.1_3 Reverse -322 -332 7.94484 0.147
NP_440505.1_3 Forward -393 -383 7.64985 0.151
NP_441959.1_8 Forward -104 -91 7.93804 0.299
NP_442532.1_7 Forward -247 -233 15.6342 0.0587
NP_442174.1_9 Forward -249 -230 9.53756 0.187
NP_440914.1_1 Reverse -238 -248 16.3248 0.00196
NP_440914.1_1 Reverse -382 -392 13.1043 0.0386
NP_440914.1_1 Forward -351 -341 10.079 0.158
NP_440914.1_1 Forward -247 -237 8.6151 0.186
NP_441011.1_8 Forward -246 -237 16.9127 0.00602
NP_441011.1_8 Reverse -239 -248 16.6177 0.00602
NP_441011.1_8 Forward -390 -381 11.7994 0.0629
NP_442101.1_10 Forward -255 -236 -8.35868 0.233
NP_442533.1_1 Forward -394 -375 -14.9469 0.248
NP_442533.1_6 Forward -247 -238 17.2076 0.00137
NP_442533.1_6 Reverse -238 -247 17.2076 0.00137
NP_442533.1_6 Reverse -382 -391 4.42462 0.179
NP_442533.1_6 Forward -69 -60 3.53964 0.21
NP_442232.1_3 Forward -255 -236 -15.9302 0.299
NP_442322.1_9 Reverse -7 -25 9.75313 0.284
NP_440854.1_1 Forward -177 -158 7.87766 0.174
NP_441482.1_7 Reverse -376 -390 6.29277 0.0323
NP_441482.1_7 Forward -253 -239 -0.885388 0.0612
NP_441482.1_7 Reverse -232 -246 -2.75368 0.0997
NP_439944.1_9 Reverse -239 -249 17.7779 0.00341
NP_439944.1_9 Forward -246 -236 10.4031 0.0887
NP_441697.1_5 Forward -149 -130 1.4797 0.178
NP_440116.1_5 Forward -394 -377 8.98696 0.155
NP_440116.1_8 Reverse -239 -258 -5.11376 0.187
NP_441527.1_4 Forward -37 -18 -9.78835 0.262
NP_441527.1_4 Forward -46 -27 -11.1252 0.278
NP_440115.1_6 Forward -250 -240 16.9913 0.0288
NP_441602.1_3 Reverse -233 -252 6.29264 0.133
NP_441602.1_3 Forward -252 -233 -2.45882 0.233
NP_441106.1_1 Forward -248 -239 18.486 0.0028
NP_441106.1_1 Reverse -237 -246 18.191 0.0028
NP_439903.1_6 Forward -250 -231 1.27698 0.249
NP_442306.1_10 Forward -252 -233 -9.93197 0.11
NP_441286.1_1 Forward -248 -236 5.34885 0.0259
NP_441286.1_1 Reverse -237 -249 5.15219 0.0259
NP_441286.1_1 Forward -392 -380 4.07055 0.0373
NP_440670.1_8 Forward -247 -238 18.3876 0.000699
NP_440670.1_8 Reverse -238 -247 18.3876 0.000699
NP_440670.1_8 Forward -391 -382 8.75118 0.0606
NP_440670.1_8 Reverse -382 -391 6.19458 0.124
NP_440670.1_8 Reverse -67 -76 5.70292 0.14
NP_441886.1_6 Forward -372 -353 17.699 0.117
NP_441930.1_1 Reverse -369 -388 5.89931 0.266
NP_441930.1_1 Forward -73 -54 5.30933 0.286
NP_440886.1_7 Reverse -237 -247 17.7774 0.0011
NP_440886.1_7 Reverse -381 -391 16.4991 0.0104
NP_440886.1_7 Forward -248 -238 8.04271 0.0805
NP_440886.1_7 Forward -70 -60 6.56775 0.118
NP_440886.1_7 Reverse -372 -382 3.91283 0.26
NP_440767.1_2 Forward -29 -10 -0.787193 0.269
NP_442072.1_9 Forward -77 -59 -2.53746 0.0317
NP_442072.1_9 Forward -248 -230 -3.81576 0.0388
NP_442072.1_9 Reverse -237 -255 -12.5672 0.0852
NP_441753.1_10 Forward -256 -237 0.491109 0.291
NP_440907.2_8 Reverse -239 -249 19.1541 0.00362
NP_440907.2_8 Forward -246 -236 17.4824 0.00685
NP_440907.2_8 Reverse -383 -393 5.87944 0.184
NP_441021.1_1 Forward -246 -227 6.58763 0.0704
NP_441463.1_3 Reverse -228 -247 1.47442 0.127
NP_441463.1_3 Forward -257 -238 -4.91709 0.217
NP_441626.1_2 Forward -246 -239 15.7721 0.0124
NP_441626.1_2 Reverse -239 -246 15.7721 0.0124
NP_441626.1_2 Forward -390 -383 12.2322 0.0511
NP_441626.1_2 Reverse -61 -68 10.7572 0.0837
NP_441626.1_2 Reverse -383 -390 5.93897 0.231
NP_442365.1_7 Forward -251 -232 -2.95047 0.208
NP_442362.1_7 Reverse -308 -326 11.4255 0.244
NP_440107.1_5 Forward -392 -373 -1.7705 0.178
NP_442794.1_1 Reverse -378 -390 9.18376 0.0821
NP_442794.1_1 Forward -251 -239 3.57889 0.286
NP_442615.1_1 Reverse -229 -247 -2.43913 0.144
NP_442615.1_1 Forward -400 -382 -6.27403 0.241
NP_441962.1_4 Forward -252 -233 10.4225 0.0495
NP_441962.1_4 Reverse -233 -252 -10.9153 0.235
NP_441962.1_4 Reverse -368 -387 -13.6686 0.277
NP_440387.1_1 Forward -247 -231 25.4279 0.00118
NP_440387.1_1 Reverse -238 -254 7.53169 0.0282
NP_440387.1_1 Reverse -60 -76 5.6634 0.0311
NP_440387.1_1 Reverse -67 -83 -4.07137 0.174
NP_440387.1_1 Forward -391 -375 -5.64466 0.243
NP_441431.1_2 Forward -250 -236 13.7653 0.0806
NP_441431.1_2 Reverse -235 -249 8.45543 0.216
NP_441431.1_2 Reverse -379 -393 7.76712 0.234
NP_441431.1_2 Reverse -64 -78 6.0955 0.28
NP_441488.1_7 Forward -253 -234 1.57275 0.289
NP_441488.1_8 Forward -396 -382 10.422 0.146
NP_441836.1_2 Reverse -232 -251 -0.983855 0.215
NP_441836.1_2 Forward -253 -234 -6.58872 0.3
NP_441993.1_1 Reverse -12 -31 2.72635 0.254
NP_441993.1_1 Forward -253 -234 2.04414 0.265
NP_441174.1_2 Forward -250 -236 21.4357 0.00137
NP_440114.1_10 Forward -69 -55 7.27608 0.239
NP_441817.1_10 Forward -249 -230 12.4875 0.24
NP_441510.2_2 Reverse -353 -372 4.81688 0.26
NP_441510.2_7 Forward -397 -383 10.6187 0.28
NP_441510.2_7 Reverse -376 -390 9.53707 0.281
NP_441510.2_10 Reverse -236 -255 14.6508 0.194
NP_440293.1_9 Reverse -204 -218 11.3443 0.257
NP_440766.1_4 Forward -251 -237 16.4209 0.0256
NP_440766.1_4 Forward -395 -381 3.34284 0.15
NP_440766.1_5 Reverse -122 -134 18.2554 0.0839
NP_439910.1_2 Reverse -230 -247 -21.299 0.183
NP_439910.1_2 Forward -255 -238 -22.184 0.215
NP_439910.1_2 Reverse -52 -69 -22.479 0.25
NP_440457.1_1 Forward -251 -239 6.72548 0.113
NP_440457.1_1 Reverse -234 -246 5.34885 0.141
NP_440457.1_1 Reverse -56 -68 2.59558 0.207
NP_440798.1_6 Forward -397 -384 0.215946 0.278
NP_442680.1_5 Forward -46 -27 -0.123152 0.277
NP_441436.1_8 Reverse -237 -256 7.7676 0.293
NP_442509.1_9 Forward -247 -237 16.2041 0.00739
NP_442509.1_9 Forward -391 -381 11.9759 0.107
NP_442509.1_9 Reverse -238 -248 8.04271 0.192
NP_442509.1_9 Reverse -67 -77 7.84605 0.2
NP_441489.1_3 Reverse -120 -134 8.12843 0.244
NP_440734.1_9 Reverse -372 -391 13.5691 0.213
NP_440554.1_4 Reverse -239 -249 15.418 0.0199
NP_440554.1_4 Forward -246 -236 13.943 0.0218
NP_441885.1_5 Forward -247 -237 11.4848 0.00668
NP_441885.1_5 Reverse -238 -248 11.3864 0.00668
NP_441885.1_5 Reverse -382 -392 1.25834 0.11
NP_441885.1_5 Forward -391 -381 0.0783647 0.183
NP_441885.1_5 Forward -333 -323 -1.00328 0.248
NP_441885.1_5 Forward -69 -59 -1.00328 0.248
NP_441428.1_8 Reverse -230 -249 8.25926 0.206
NP_442341.1_7 Forward -248 -234 12.8809 0.0408
NP_442341.1_7 Reverse -237 -251 10.816 0.0596
NP_442341.1_7 Forward -392 -378 4.62115 0.185
NP_442341.1_7 Reverse -381 -395 4.52282 0.188
NP_442341.1_9 Reverse -380 -394 8.94708 0.162
NP_441756.1_5 Reverse -378 -397 4.42435 0.199
NP_441756.1_7 Forward -252 -233 13.8641 0.21
NP_441173.1_9 Reverse -103 -111 12.1137 0.21
NP_442395.2_4 Reverse -237 -256 10.3234 0.101
NP_442395.2_4 Forward -334 -315 -0.0996487 0.282
NP_442534.1_1 Forward -39 -20 13.0775 0.181
NP_440750.1_5 Forward -168 -154 14.4542 0.126
NP_440423.1_6 Forward -399 -380 -20.5517 0.261
NP_443000.1_7 Forward -249 -239 10.7964 0.0345
NP_443000.1_7 Reverse -322 -332 7.55152 0.0778
NP_443000.1_7 Reverse -236 -246 2.04498 0.226
NP_443000.1_7 Forward -393 -383 0.57002 0.294
NP_441842.1_10 Forward -398 -384 13.1759 0.0809
NP_441842.1_10 Reverse -231 -245 9.04604 0.2
NP_440275.1_3 Forward -249 -239 18.6629 0.0082
NP_440275.1_3 Reverse -236 -246 17.9746 0.0082
NP_440275.1_3 Forward -393 -383 5.48657 0.145
NP_440091.1_1 Reverse -234 -246 3.2839 0.163
NP_440679.1_10 Forward -389 -370 -14.6519 0.242
NP_442451.1_2 Forward -359 -340 -11.0136 0.284
NP_440149.1_8 Forward -247 -228 -7.67036 0.29
NP_441105.1_3 Forward -258 -239 3.04771 0.0936
NP_440216.1_1 Forward -76 -62 -2.06536 0.0458
NP_440216.1_1 Reverse -238 -252 -2.45868 0.0513
NP_440216.1_1 Forward -247 -233 -2.55701 0.0521
NP_440216.1_1 Reverse -382 -396 -11.8985 0.228
NP_440216.1_1 Reverse -67 -81 -12.5868 0.288
NP_440172.1_1 Reverse -238 -248 17.5813 0.00421
NP_440172.1_1 Forward -247 -237 8.73149 0.0586
NP_440172.1_1 Forward -69 -59 5.97822 0.121
NP_440172.1_1 Reverse -67 -77 4.99491 0.157
NP_440172.1_1 Reverse -382 -392 2.24165 0.279
NP_442015.1_10 Reverse -378 -391 9.55739 0.0475
NP_442015.1_10 Reverse -320 -333 6.31247 0.119
NP_442015.1_10 Forward -251 -238 4.54251 0.167
NP_442015.1_10 Reverse -234 -247 3.85419 0.178
NP_441226.1_7 Forward -246 -239 14.4934 0.0123
NP_441226.1_7 Reverse -239 -246 14.4934 0.0123
NP_441226.1_7 Forward -390 -383 12.7234 0.0312
NP_441226.1_7 Reverse -383 -390 11.5435 0.0757
NP_441226.1_7 Forward -125 -118 5.34865 0.289
NP_441111.1_7 Forward -246 -238 18.7023 0.00294
NP_441111.1_7 Reverse -239 -247 18.7023 0.00294
NP_441111.1_7 Reverse -383 -391 8.86921 0.0589
NP_441111.1_7 Forward -75 -67 -0.570565 0.233
NP_441111.1_7 Reverse -68 -76 -0.570565 0.233
NP_442379.1_10 Reverse -60 -77 9.28195 0.0944
NP_442379.1_10 Reverse -231 -248 -2.71443 0.242
NP_439971.2_8 Forward -27 -13 16.9125 0.178
NP_441766.1_2 Forward -247 -238 17.5026 0.00297
NP_441766.1_2 Reverse -238 -247 17.5026 0.00297
NP_441766.1_2 Reverse -382 -391 14.7494 0.00772
NP_441766.1_2 Forward -69 -60 4.52295 0.179
NP_441766.1_2 Reverse -67 -76 4.22796 0.193
NP_442417.1_5 Forward -247 -233 13.3726 0.0786
NP_442417.1_5 Forward -391 -377 11.8976 0.0981
NP_440416.1_1 Reverse -238 -257 -6.78538 0.181
NP_440416.1_9 Forward -398 -379 -21.83 0.297
NP_443052.1_8 Reverse -228 -247 -6.49039 0.143
NP_442116.1_6 Reverse -132 -149 5.2087 0.299
NP_440591.1_9 Forward -392 -374 7.78729 0.195
NP_442154.1_1 Forward -384 -366 -5.97904 0.129
NP_440261.1_5 Reverse -239 -252 6.4108 0.0368
NP_440261.1_5 Forward -246 -233 -10.4038 0.201
NP_440261.1_5 Reverse -383 -396 -10.7971 0.21
NP_440261.1_5 Reverse -374 -387 -10.8955 0.221
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCCTATTGGCGATCGGGGTGGTTGCCCTAGAAGGGGAATTCAGTGCCACCGATGCCGTCATAATCTGTGATCCCCAGGGTCAAGAATTAGGGCGGGGATTAGTTAATTACAACTGTAACGAGCTAGAAAAAATTAAGGGACTCCATTCCGAGGCGATCGCCGCAGTGTTAGGCTACGTGGGGCCAGATACAGTGATCCATCGAGATAATTTAGTATTACAAGAAAATTAGAAGAGTCTGAAGACAGACAAATGATTTTACGAATTATTTTTGTCCCAACCCGGTATGTTGGCAGAATTAATCCCAGATATTGAAGAAAGTTGGGAGTTCGCCTATCGCTCTTCTATCATTGTAGGAAGGATAAAACAGAGAAGAGAGGGTGAAAGGCAGAGGTGATAT

CDS

ATGGTTGCCCCCGTCAAGCAAAAGAAACAGTACAGTTTATCGACAAATATTGTGAAAGCTACAGAGACTTACTTTCCAGAAGTAAGAAGCTTTGAGTACTTTAAATATTTGCATCTAGGATTAATAGCGAATATCAGGAGAAAAACATTTCCAGAAATAGCCAGGGTAGTATAG

Protein

MVAPVKQKKQYSLSTNIVKATETYFPEVRSFEYFKYLHLGLIANIRRKTFPEIARVV