Your browser is old and dusty. Try Google Chrome!

Details for ssr3451

ORF ssr3451
Accession NP_440412.1
Symbol psbE
Category Photosystem II
Definition cytochrome b559 alpha subunit
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440897.1_6 Reverse -170 -189 -0.787962 0.185
NP_441453.1_4 Forward -382 -374 5.0343 0.209
NP_441623.1_1 Forward -108 -90 -1.84914 0.241
NP_441818.1_9 Forward -101 -82 -2.55715 0.206
NP_441818.1_9 Forward -158 -139 -9.34199 0.29
NP_442173.1_1 Forward -352 -344 5.0343 0.24
NP_442752.1_4 Reverse -373 -380 5.25066 0.256
NP_439997.1_6 Reverse -105 -124 12.5858 0.18
NP_441675.1_4 Reverse -187 -206 5.89931 0.236
NP_441250.1_3 Forward -37 -18 9.43923 0.197
NP_440061.1_9 Reverse -261 -275 15.7319 0.0384
NP_440061.1_9 Reverse -267 -281 11.307 0.114
NP_440061.1_9 Reverse -168 -182 5.1122 0.294
NP_440110.1_8 Reverse -96 -115 -1.96717 0.256
NP_441054.1_2 Forward -145 -126 16.4207 0.132
NP_441900.1_2 Reverse -133 -151 -2.24319 0.275
NP_441859.1_3 Forward -102 -83 4.71854 0.215
NP_441859.1_3 Reverse -262 -281 2.55527 0.258
NP_441035.1_3 Reverse -88 -107 -0.590531 0.292
NP_442048.1_9 Reverse -371 -390 11.2092 0.267
NP_439918.1_2 Forward -163 -144 -3.93378 0.263
NP_441594.1_2 Reverse -341 -360 17.0107 0.136
NP_441594.1_6 Forward -104 -85 1.0811 0.274
NP_441925.1_4 Reverse -163 -182 -17.4058 0.294
NP_441925.1_4 Reverse -133 -152 -17.6025 0.297
NP_441083.1_5 Forward -392 -382 0.275027 0.237
NP_442827.1_8 Forward -109 -90 -2.75457 0.288
NP_440447.1_5 Forward -93 -83 15.9097 0.277
NP_442111.1_4 Reverse -343 -357 1.67122 0.296
NP_442330.1_3 Forward -379 -360 22.7139 0.016
NP_442634.1_4 Forward -360 -346 0.294584 0.149
NP_440403.1_10 Reverse -98 -117 3.14605 0.278
NP_440842.1_10 Forward -229 -215 4.91614 0.251
NP_442848.1_4 Forward -154 -140 7.47274 0.282
NP_440376.1_1 Forward -324 -315 -0.491928 0.29
NP_442687.1_7 Forward -273 -263 4.69992 0.238
NP_440642.1_10 Forward -94 -80 1.86729 0.287
NP_440042.1_2 Forward -392 -373 4.42435 0.191
NP_440667.1_2 Reverse -107 -126 -0.000545616 0.209
NP_442658.1_1 Reverse -342 -352 5.58445 0.262
NP_442782.1_2 Reverse -259 -273 0.88457 0.282
NP_442205.1_9 Forward -368 -352 -0.0397962 0.264
NP_439959.1_3 Forward -277 -258 9.63589 0.26
NP_439959.1_6 Forward -249 -230 16.9124 0.0839
NP_442937.1_5 Forward -106 -87 6.78429 0.27
NP_442321.1_1 Reverse -216 -235 -5.50708 0.218
NP_441958.1_5 Forward -273 -263 -2.28158 0.27
NP_442486.1_4 Reverse -220 -239 7.57094 0.273
NP_440950.1_1 Forward -182 -163 0.196116 0.276
NP_440984.1_7 Reverse -264 -278 5.40779 0.257
NP_442376.1_8 Reverse -223 -237 7.37441 0.297
NP_442690.1_1 Forward -138 -119 -14.3569 0.272
NP_442690.1_1 Reverse -185 -204 -16.8151 0.291
NP_441580.1_6 Forward -393 -374 -6.68705 0.235
NP_440153.1_8 Reverse -269 -282 -1.65234 0.225
NP_442002.1_9 Forward -238 -231 12.2322 0.185
NP_442002.1_9 Reverse -343 -350 9.97054 0.246
NP_441646.1_1 Forward -234 -215 3.93269 0.204
NP_442438.1_10 Forward -184 -170 -0.197071 0.253
NP_442438.1_10 Forward -273 -259 -0.590395 0.269
NP_442431.1_7 Forward -341 -322 8.45592 0.248
NP_441550.1_8 Forward -274 -264 5.97777 0.22
NP_441041.1_4 Forward -382 -363 -5.40875 0.152
NP_441041.1_7 Forward -385 -373 6.83453 0.19
NP_440569.1_6 Forward -230 -211 8.75091 0.205
NP_439966.1_7 Forward -384 -374 5.68278 0.214
NP_440674.1_3 Forward -179 -160 3.34271 0.26
NP_440260.1_8 Reverse -98 -116 -6.4707 0.291
NP_441678.1_9 Forward -239 -220 1.76941 0.223
NP_442281.1_1 Forward -232 -218 2.5556 0.263
NP_441860.1_10 Forward -247 -228 12.2908 0.295
NP_440867.1_10 Reverse -209 -228 0.786102 0.299
NP_441751.2_8 Reverse -345 -359 -3.44199 0.145
NP_440919.1_1 Forward -277 -258 -8.85033 0.296
NP_442381.1_8 Forward -385 -366 -15.0452 0.292
NP_440357.1_3 Reverse -90 -109 0.196116 0.285
NP_441198.1_8 Reverse -342 -352 12.49 0.129
NP_441015.1_10 Forward -277 -258 1.17943 0.161
NP_441015.1_10 Forward -283 -264 -3.24547 0.186
NP_441731.1_3 Forward -361 -342 -6.88371 0.299
NP_441876.1_9 Reverse -234 -244 12.2709 0.267
NP_441826.1_2 Forward -359 -345 -2.45868 0.271
NP_442868.1_6 Reverse -267 -277 0.668351 0.213
NP_442719.1_2 Reverse -119 -137 -9.42131 0.264
NP_441612.1_2 Reverse -170 -180 10.6792 0.21
NP_441612.1_2 Forward -227 -217 7.58116 0.25
NP_442227.1_2 Reverse -324 -343 1.37609 0.246
NP_442227.1_2 Reverse -94 -113 -0.197208 0.253
NP_440789.1_8 Reverse -301 -320 12.8808 0.28
NP_442808.1_1 Reverse -272 -282 5.78111 0.141
NP_441101.1_10 Reverse -265 -284 -6.78538 0.29
NP_440752.1_7 Forward -175 -156 19.6648 0.148
NP_442820.1_3 Reverse -228 -238 18.0724 0.187
NP_440038.1_4 Reverse -140 -159 2.0644 0.275
NP_440558.1_2 Reverse -89 -108 2.85105 0.164
NP_441878.1_6 Forward -228 -218 1.06167 0.116
NP_441036.1_6 Reverse -89 -107 8.7706 0.292
NP_441445.1_8 Reverse -220 -239 -12.4886 0.277
NP_441433.1_8 Forward -115 -96 -1.7705 0.263
NP_442347.1_2 Forward -348 -339 8.25953 0.102
NP_442347.1_2 Forward -381 -372 4.12963 0.284
NP_440547.1_1 Reverse -207 -226 19.0748 0.0952
NP_442594.1_8 Forward -154 -135 3.14605 0.288
NP_440136.1_2 Reverse -374 -381 3.97235 0.288
NP_442998.1_5 Forward -239 -229 7.94484 0.278
NP_440299.1_1 Reverse -94 -107 4.73861 0.201
NP_440299.1_1 Reverse -265 -278 3.7553 0.232
NP_441799.1_1 Reverse -340 -354 8.94708 0.103
NP_442334.1_2 Forward -275 -258 -5.86102 0.214
NP_442334.1_2 Forward -282 -265 -13.2358 0.297
NP_441559.1_8 Reverse -223 -237 -0.590395 0.178
NP_441559.1_8 Reverse -225 -239 -5.31028 0.259
NP_441559.1_8 Reverse -224 -238 -6.88358 0.281
NP_440915.1_6 Forward -386 -372 -0.0987402 0.182
NP_440164.1_5 Reverse -308 -327 2.16274 0.211
NP_440748.1_5 Reverse -94 -113 -2.0655 0.271
NP_441464.1_10 Reverse -105 -119 14.7492 0.166
NP_442993.1_1 Forward -275 -259 -12.4295 0.271
NP_442386.1_9 Forward -383 -374 10.1274 0.139
NP_442386.1_9 Reverse -372 -381 4.52254 0.297
NP_441750.1_4 Forward -272 -253 1.0811 0.289
NP_441750.1_7 Forward -331 -321 15.8113 0.254
NP_440327.1_6 Reverse -95 -114 9.83255 0.206
NP_440161.1_3 Reverse -185 -204 8.25926 0.273
NP_442714.1_7 Reverse -270 -289 2.65439 0.213
NP_441160.1_5 Forward -289 -270 -5.9004 0.288
NP_440027.1_3 Forward -278 -260 1.78836 0.295
NP_439937.1_9 Reverse -227 -244 -12.9415 0.278
NP_441595.1_2 Reverse -121 -134 11.8073 0.277
NP_440372.1_2 Reverse -374 -381 4.07068 0.262
NP_441789.1_7 Reverse -264 -283 -0.787962 0.251
NP_440819.1_5 Forward -166 -158 15.8507 0.185
NP_440316.1_10 Forward -221 -211 13.943 0.199
NP_441803.1_2 Reverse -368 -387 -0.787193 0.286
NP_440589.1_3 Forward -244 -225 2.0644 0.288
NP_441903.1_7 Forward -286 -267 13.1758 0.231
NP_442384.1_10 Forward -278 -265 2.37923 0.228
NP_442384.1_10 Forward -382 -369 1.10092 0.268
NP_442114.1_4 Reverse -373 -384 11.2684 0.139
NP_440364.1_6 Forward -383 -370 13.785 0.275
NP_442262.1_10 Reverse -308 -315 8.39725 0.234
NP_442262.1_10 Reverse -350 -357 7.11894 0.287
NP_442244.1_3 Reverse -259 -278 5.99764 0.236
NP_440344.1_10 Forward -389 -372 -9.40093 0.146
NP_441965.1_7 Reverse -84 -103 11.3067 0.292
NP_442065.1_5 Reverse -230 -249 -3.63879 0.273
NP_442693.1_7 Forward -245 -226 7.7676 0.282
NP_441592.1_4 Forward -272 -253 0.294447 0.234
NP_440894.1_10 Reverse -207 -226 6.98095 0.209
NP_440894.1_10 Reverse -261 -280 4.71934 0.244
NP_442067.1_4 Forward -118 -99 2.65439 0.289
NP_440999.1_9 Forward -269 -255 8.25939 0.0782
NP_442033.1_10 Reverse -263 -282 -9.93197 0.224
NP_442033.1_10 Reverse -355 -374 -14.4552 0.298
NP_442845.1_2 Reverse -367 -381 5.30946 0.237
NP_441178.1_6 Reverse -133 -152 5.60352 0.268
NP_441469.1_8 Forward -108 -99 10.6195 0.206
NP_442315.1_2 Forward -329 -317 11.347 0.291
NP_443064.1_6 Reverse -170 -180 10.8217 0.13
NP_442337.1_8 Forward -59 -40 4.12936 0.21
NP_442578.1_7 Forward -267 -260 6.62729 0.18
NP_440071.1_4 Reverse -92 -111 16.8141 0.234
NP_440220.1_4 Reverse -277 -296 -3.83621 0.297
NP_440148.1_1 Forward -22 -3 -7.57203 0.29
NP_441462.1_5 Forward -147 -128 3.93269 0.285
NP_441601.1_4 Reverse -261 -280 -3.83545 0.293
NP_440516.1_6 Reverse -218 -232 6.68548 0.293
NP_442428.1_5 Forward -352 -345 3.67736 0.298
NP_441443.1_7 Forward -104 -85 -0.885524 0.248
NP_442120.1_10 Forward -164 -145 -11.5053 0.262
NP_442823.1_8 Forward -238 -219 11.1109 0.291
NP_440673.1_3 Forward -351 -344 9.08556 0.202
NP_440673.1_3 Reverse -94 -101 8.98723 0.203
NP_440865.1_9 Reverse -301 -320 -5.99873 0.218
NP_441052.1_2 Forward -227 -217 0.963343 0.255
NP_442219.1_8 Reverse -88 -107 7.39404 0.267
NP_442219.1_9 Forward -381 -372 5.60459 0.146
NP_440436.1_4 Reverse -93 -102 7.76745 0.124
NP_442412.1_4 Forward -195 -176 17.3057 0.188
NP_442907.1_2 Forward -100 -82 18.997 0.118
NP_441733.1_10 Reverse -370 -383 4.64084 0.251
NP_442813.1_2 Reverse -194 -213 -0.885524 0.273
NP_442813.1_4 Reverse -278 -297 -8.752 0.299
NP_442366.1_3 Forward -39 -21 -0.472507 0.191
NP_442208.1_5 Forward -241 -222 -9.34199 0.293
NP_442622.1_1 Forward -102 -83 -11.7019 0.257
NP_441501.1_9 Reverse -320 -339 14.5516 0.268
NP_441683.1_7 Forward -221 -202 -13.0786 0.3
NP_440593.1_3 Reverse -213 -232 10.1275 0.107
NP_440593.1_3 Reverse -258 -277 2.85105 0.168
NP_441982.1_6 Forward -167 -158 11.053 0.288
NP_442709.1_3 Forward -246 -227 2.45773 0.295
NP_440940.1_7 Reverse -334 -352 7.58986 0.2
NP_441349.1_10 Reverse -259 -278 -4.52377 0.173
NP_441409.1_6 Reverse -122 -141 -9.047 0.178
NP_441394.1_10 Reverse -134 -152 8.17984 0.298
NP_440432.1_9 Forward -267 -252 -6.11662 0.284
NP_440474.1_8 Reverse -345 -359 7.57046 0.204
NP_441124.1_5 Forward -26 -16 13.1036 0.215
NP_440431.1_8 Forward -400 -381 10.1275 0.244
NP_441031.1_8 Forward -118 -99 -2.16383 0.248
NP_441031.1_8 Reverse -93 -112 -5.31042 0.285
NP_442006.1_2 Forward -110 -93 -7.04099 0.169
NP_441570.1_1 Reverse -98 -116 -16.8938 0.257
NP_441570.1_1 Forward -382 -364 -16.9921 0.26
NP_442729.1_8 Forward -89 -76 5.52582 0.242
NP_441432.1_5 Forward -350 -336 10.7177 0.271
NP_441432.1_8 Forward -102 -93 5.40793 0.158
NP_442320.1_8 Forward -388 -374 -2.95034 0.1
NP_442274.1_7 Reverse -372 -386 22.3207 0.0766
NP_441057.1_4 Forward -102 -84 4.34571 0.231
NP_441057.1_4 Reverse -253 -271 -2.3408 0.272
NP_440280.1_2 Reverse -81 -100 12.9791 0.155
NP_440713.1_4 Reverse -363 -382 11.1109 0.119
NP_441659.2_8 Reverse -235 -245 -0.118297 0.287
NP_442008.1_2 Forward -242 -223 2.55606 0.285
NP_440708.1_6 Reverse -220 -239 5.50599 0.132
NP_440335.1_9 Reverse -38 -56 15.4571 0.184
NP_442346.1_5 Forward -102 -92 11.2881 0.0706
NP_442346.1_5 Reverse -343 -353 8.4365 0.137
NP_442346.1_10 Forward -103 -84 -2.45882 0.294
NP_440545.1_3 Reverse -340 -357 -2.22277 0.181
NP_440545.1_3 Forward -357 -340 -3.79607 0.212
NP_440545.1_3 Reverse -259 -276 -5.95935 0.265
NP_441629.1_3 Reverse -211 -230 3.53858 0.218
NP_441923.1_6 Reverse -369 -383 8.16106 0.28
NP_440459.1_2 Reverse -365 -382 8.98696 0.243
NP_440459.1_8 Reverse -376 -394 11.7205 0.211
NP_442551.1_4 Reverse -216 -231 -3.46169 0.29
NP_442311.1_5 Forward -104 -85 0.196116 0.277
NP_441329.1_3 Reverse -18 -28 13.3642 0.265
NP_441329.1_3 Reverse -122 -132 12.0145 0.273
NP_441329.1_6 Reverse -184 -203 13.3207 0.106
NP_441329.1_6 Forward -23 -4 -1.09858 0.289
NP_442796.1_2 Forward -381 -362 15.4582 0.219
NP_440671.1_4 Reverse -301 -315 5.60446 0.279
NP_442821.1_3 Forward -378 -359 10.5209 0.178
NP_440590.1_4 Reverse -374 -387 12.2123 0.0156
NP_440821.1_4 Reverse -371 -381 3.02829 0.131
NP_441239.1_9 Reverse -347 -359 6.72548 0.178
NP_441892.1_1 Forward -236 -219 0.432165 0.168
NP_441892.1_1 Forward -281 -264 -4.97604 0.271
NP_441892.1_4 Forward -279 -260 13.4708 0.0554
NP_440665.1_1 Forward -119 -100 -16.8151 0.293
NP_440412.1_1 Forward -283 -264 24.3855 0.0143
NP_440412.1_2 Forward -159 -140 24.0905 0.0261
NP_440412.1_3 Forward -238 -219 18.9773 0.188
NP_440412.1_5 Forward -193 -174 21.4437 0.154
NP_440412.1_6 Forward -262 -243 19.9606 0.108
NP_440412.1_7 Forward -361 -342 19.6656 0.103
NP_440412.1_8 Forward -132 -113 26.6462 0.00423
NP_440412.1_9 Forward -400 -382 26.1752 0.00155
NP_440412.1_10 Forward -301 -287 25.2707 0.00948
NP_440546.1_4 Reverse -373 -383 8.49468 0.186
NP_441603.1_5 Reverse -233 -252 14.3549 0.212
NP_440462.1_6 Forward -384 -374 4.50326 0.197
NP_442611.1_1 Forward -358 -339 -2.75381 0.295
NP_440868.1_4 Reverse -369 -381 2.20226 0.161
NP_442402.1_4 Reverse -222 -241 1.37531 0.173
NP_440653.1_10 Forward -226 -207 3.34271 0.277
NP_440696.1_3 Reverse -259 -277 -0.472507 0.243
NP_440696.1_3 Forward -324 -306 -2.0458 0.272
NP_442039.1_10 Forward -132 -114 16.2429 0.219
NP_440825.1_7 Forward -352 -342 10.7626 0.294
NP_440160.1_2 Forward -239 -220 19.469 0.0621
NP_439994.1_3 Forward -354 -335 12.4382 0.153
NP_440505.1_3 Forward -103 -93 4.60159 0.277
NP_440914.1_1 Forward -382 -372 12.5188 0.0569
NP_440914.1_1 Reverse -344 -354 9.00547 0.186
NP_440914.1_1 Reverse -170 -180 6.85846 0.263
NP_440914.1_4 Reverse -90 -106 13.8241 0.265
NP_441011.1_8 Reverse -374 -383 5.11294 0.283
NP_442533.1_1 Forward -244 -225 -17.7001 0.293
NP_442533.1_6 Forward -272 -263 3.04799 0.228
NP_442541.1_10 Reverse -92 -106 10.0287 0.198
NP_440263.1_3 Reverse -288 -307 4.42435 0.243
NP_441028.1_6 Reverse -233 -243 13.5492 0.158
NP_441028.1_6 Forward -348 -338 10.9926 0.193
NP_440116.1_8 Reverse -374 -393 -5.11376 0.187
NP_441527.1_4 Forward -23 -4 -5.39572 0.201
NP_440115.1_6 Reverse -341 -351 12.0747 0.107
NP_440115.1_6 Forward -104 -94 6.17489 0.197
NP_440115.1_6 Forward -240 -230 5.38824 0.25
NP_441602.1_4 Forward -118 -99 12.8808 0.278
NP_442673.1_6 Reverse -187 -206 16.1855 0.213
NP_442673.1_6 Reverse -28 -47 13.9891 0.241
NP_441286.1_1 Forward -102 -90 -7.04085 0.3
NP_441705.1_2 Reverse -247 -266 19.2723 0.105
NP_441705.1_3 Forward -227 -208 0.786102 0.245
NP_440886.1_7 Forward -383 -373 3.8145 0.265
NP_442614.1_2 Reverse -294 -308 7.17775 0.275
NP_440404.1_9 Forward -211 -192 9.59652 0.227
NP_442717.1_2 Forward -162 -143 -6.58872 0.282
NP_442022.1_4 Forward -158 -139 8.16093 0.268
NP_441463.1_3 Reverse -363 -382 -4.72043 0.211
NP_440107.1_5 Reverse -366 -385 -7.17871 0.281
NP_441962.1_1 Forward -108 -89 -2.75381 0.271
NP_441431.1_3 Reverse -101 -120 2.45773 0.283
NP_441521.1_4 Forward -392 -373 12.7825 0.259
NP_441836.1_2 Forward -239 -220 -2.16383 0.226
NP_441836.1_2 Forward -284 -265 -5.01543 0.269
NP_440143.1_1 Reverse -296 -315 12.0942 0.297
NP_440114.1_10 Forward -142 -128 9.43936 0.172
NP_442437.1_4 Reverse -165 -184 8.65258 0.25
NP_442323.1_7 Reverse -182 -201 3.24359 0.245
NP_440293.1_10 Forward -361 -342 -1.67217 0.271
NP_440766.1_4 Reverse -369 -383 2.35953 0.187
NP_442743.1_4 Forward -249 -230 0.294447 0.174
NP_440457.1_1 Reverse -369 -381 0.923956 0.25
NP_440457.1_1 Forward -276 -264 0.0389777 0.25
NP_440798.1_2 Reverse -140 -154 16.7152 0.23
NP_441801.1_4 Forward -347 -337 2.92996 0.231
NP_441436.1_2 Forward -373 -354 -3.04881 0.28
NP_441436.1_2 Forward -244 -225 -5.99873 0.296
NP_440473.1_9 Forward -369 -350 2.65439 0.0985
NP_441489.1_3 Forward -132 -118 7.74647 0.249
NP_441845.1_6 Forward -394 -376 -0.669169 0.274
NP_441885.1_5 Forward -272 -262 -1.29827 0.259
NP_442703.1_4 Reverse -307 -326 11.7 0.167
NP_441756.1_5 Forward -243 -224 -0.197208 0.242
NP_441756.1_5 Reverse -82 -101 -5.21209 0.299
NP_440119.1_1 Forward -119 -103 1.5335 0.297
NP_442395.2_4 Reverse -211 -230 5.99684 0.152
NP_441842.1_7 Reverse -131 -150 9.83173 0.261
NP_440091.1_1 Reverse -340 -352 -0.256015 0.273
NP_442275.1_1 Forward -237 -218 5.211 0.267
NP_443010.1_10 Forward -385 -368 4.8001 0.219
NP_442638.1_3 Forward -27 -8 10.1695 0.298
NP_440149.1_8 Reverse -92 -111 -6.58872 0.255
NP_441105.1_3 Reverse -258 -277 -7.4737 0.254
NP_442373.1_2 Forward -153 -134 -7.57203 0.236
NP_442127.1_5 Forward -334 -315 16.2241 0.227
NP_440172.1_1 Forward -101 -91 2.7333 0.268
NP_442788.1_3 Forward -179 -160 12.0942 0.249
NP_441226.1_7 Forward -381 -374 8.59356 0.197
NP_442379.1_10 Reverse -256 -273 -2.81276 0.245
NP_442417.1_5 Forward -116 -102 4.81781 0.288
NP_442179.1_3 Forward -195 -176 11.5042 0.163
NP_440416.1_9 Reverse -366 -385 -19.5684 0.276
NP_442116.1_6 Reverse -17 -34 13.7075 0.172
NP_442116.1_6 Forward -204 -187 5.68616 0.291
NP_441019.1_2 Forward -289 -270 10.0292 0.197
NP_442154.1_1 Forward -100 -82 -14.9272 0.218
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGACAACTCCAGTTCAGCACCGATCCCGATGCAGAGGAATGGAGCGATGTGATTGCTCCCCAGGATAAAGGTAGTTGGGGTCTGCTCGATCTGTCTTTCCGTACCCCTGAAGAAGTATGGGTAGCGGGGGCCAGCGGTAACCTCTTGATGAGTCAAGACGGGGGGCAAACCTGGGCCAAGGACACTGGGGTAGAAGATATTCCAGCCAATCTTTATCGGGTGGTGTTCCTCAGTCCGGAAAAAGGATTTGTGTTGGGGCAGGATGGGATTTTGCTCAAATATAACCCCAGCACCGAGGTGGCAATGGTTCCCTAGGCGGCTCACAAAATAGTAGACTAGACTCTACTTGCTTTGCATTTGTCAGTCAATGTTGTTTTGAAAAATTGAAGGAGAACACAAA

CDS

ATGTCAGGGACTACCGGCGAGCGTCCATTTTCCGATATTGTCACCAGCATTCGCTACTGGGTGATCCACAGCATCACCATCCCGATGTTGTTTATTGCTGGTTGGTTGTTTGTCAGCACGGGCTTAGCCTACGATGCTTTTGGCACTCCCCGCCCCGATGAATATTTCACCCAGACCCGTCAAGAGTTGCCCATTCTCCAGGAACGCTACGACATTAATCAGGAAATTCAAGAGTTTAATCAATAA

Protein

MSGTTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYFTQTRQELPILQERYDINQEIQEFNQ