Your browser is old and dusty. Try Google Chrome!

Details for ssr3304

ORF ssr3304
Accession NP_441930.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442752.1_4 Reverse -296 -303 5.25066 0.256
NP_442975.1_10 Forward -343 -329 5.1122 0.233
NP_441476.1_5 Reverse -298 -317 -2.55715 0.229
NP_441935.1_2 Forward -93 -74 -4.03212 0.253
NP_442827.1_8 Forward -20 -1 2.55527 0.157
NP_441434.1_1 Forward -46 -32 8.89237 0.251
NP_441434.1_1 Reverse -32 -46 7.26901 0.287
NP_442570.1_3 Reverse -84 -103 -5.01543 0.237
NP_441486.1_1 Reverse -293 -307 -6.29359 0.288
NP_441634.1_8 Reverse -97 -111 16.3225 0.0248
NP_442485.1_3 Reverse -106 -125 2.0644 0.215
NP_441422.1_2 Reverse -241 -260 11.3067 0.173
NP_440533.1_6 Reverse -83 -102 9.73422 0.276
NP_440353.1_4 Forward -352 -342 17.6491 0.26
NP_440141.1_8 Reverse -315 -334 3.93269 0.296
NP_440607.1_3 Forward -314 -295 15.7316 0.201
NP_442937.1_5 Reverse -274 -293 6.09597 0.288
NP_442937.1_5 Reverse -88 -107 6.09597 0.288
NP_442937.1_5 Reverse -325 -344 5.99764 0.293
NP_440984.1_7 Forward -113 -99 6.3911 0.217
NP_441348.1_7 Forward -160 -141 7.57094 0.289
NP_441938.1_3 Forward -125 -106 11.3075 0.116
NP_441646.1_1 Forward -177 -158 -1.7705 0.294
NP_441041.1_7 Reverse -166 -178 7.70913 0.162
NP_441369.1_1 Forward -54 -35 -9.14533 0.206
NP_441725.1_4 Reverse -63 -77 5.50552 0.278
NP_442281.1_1 Forward -310 -296 10.1271 0.0622
NP_442281.1_1 Reverse -349 -363 5.21053 0.166
NP_441644.1_6 Reverse -117 -127 8.73102 0.0944
NP_441644.1_6 Forward -305 -295 3.42118 0.282
NP_442029.1_6 Reverse -234 -253 5.11266 0.255
NP_442142.1_4 Forward -291 -278 2.37867 0.294
NP_442142.1_4 Forward -167 -154 2.28034 0.295
NP_442476.1_6 Reverse -100 -114 5.01447 0.139
NP_441448.1_1 Forward -83 -64 5.40766 0.261
NP_442076.1_5 Reverse -155 -174 15.6341 0.186
NP_441020.2_6 Forward -67 -50 7.02034 0.245
NP_441015.1_8 Reverse -96 -115 -0.295539 0.292
NP_441015.1_10 Reverse -88 -107 -3.54046 0.19
NP_441015.1_10 Forward -80 -61 -10.9153 0.289
NP_442719.1_2 Forward -305 -287 -9.91296 0.268
NP_441056.1_1 Forward -108 -89 -3.14714 0.225
NP_442808.1_1 Forward -109 -99 4.69947 0.192
NP_442718.1_2 Reverse -279 -298 6.19431 0.126
NP_440385.1_5 Reverse -332 -351 16.1257 0.255
NP_441114.1_3 Forward -304 -295 15.1427 0.193
NP_441114.1_3 Forward -169 -160 7.66954 0.231
NP_441878.1_6 Reverse -101 -111 0.176696 0.147
NP_442721.1_3 Forward -126 -107 13.7658 0.261
NP_441433.1_7 Forward -65 -46 17.7278 0.198
NP_442419.1_2 Reverse -191 -210 -4.72043 0.292
NP_442830.1_5 Reverse -218 -232 -1.57428 0.299
NP_442347.1_2 Forward -304 -295 3.83464 0.284
NP_442347.1_2 Reverse -197 -206 2.94966 0.292
NP_442645.1_2 Forward -158 -139 -20.1584 0.288
NP_442594.1_8 Reverse -84 -103 5.40766 0.247
NP_442998.1_5 Forward -76 -66 10.1081 0.225
NP_442998.1_5 Reverse -26 -36 7.94484 0.278
NP_440899.1_1 Reverse -285 -304 21.4847 0.0131
NP_440256.1_1 Forward -366 -347 -9.93197 0.291
NP_441090.1_6 Reverse -155 -169 7.66941 0.284
NP_441559.1_8 Forward -112 -98 -5.40861 0.261
NP_441931.1_1 Forward -54 -35 22.2214 0.0319
NP_441931.1_2 Forward -152 -133 18.879 0.0763
NP_440748.1_5 Reverse -143 -162 -3.44213 0.297
NP_442386.1_9 Forward -306 -297 6.19416 0.23
NP_440570.1_5 Forward -121 -102 -2.45882 0.279
NP_439976.1_4 Forward -345 -326 12.7816 0.278
NP_440161.1_6 Reverse -61 -80 5.99764 0.251
NP_442959.1_5 Forward -74 -55 6.58763 0.251
NP_439937.1_9 Reverse -230 -247 -13.3348 0.285
NP_441657.1_5 Forward -160 -141 0.58944 0.205
NP_440408.1_7 Reverse -290 -309 13.3725 0.19
NP_440408.1_10 Reverse -297 -316 10.2259 0.176
NP_441803.1_2 Reverse -291 -310 -0.197208 0.269
NP_441155.1_2 Reverse -285 -304 13.3725 0.292
NP_442384.1_10 Forward -305 -292 2.37923 0.228
NP_441689.1_4 Reverse -368 -387 15.135 0.172
NP_440344.1_10 Forward -115 -98 -10.7776 0.19
NP_440344.1_10 Forward -346 -329 -13.2358 0.278
NP_442750.1_9 Reverse -342 -361 20.3608 0.148
NP_442187.1_3 Reverse -98 -108 14.533 0.186
NP_440894.1_10 Forward -114 -95 3.6377 0.27
NP_440999.1_9 Forward -112 -98 1.57289 0.162
NP_440888.1_2 Forward -108 -94 5.1122 0.293
NP_440600.1_9 Reverse -366 -385 12.9387 0.243
NP_442225.1_10 Forward -174 -155 5.11187 0.3
NP_442845.1_2 Reverse -290 -304 3.34284 0.294
NP_440349.1_3 Forward -290 -271 12.4867 0.272
NP_442204.1_5 Forward -118 -99 2.3594 0.213
NP_442204.1_5 Reverse -293 -312 1.57275 0.232
NP_440673.1_3 Reverse -5 -12 7.51227 0.252
NP_441052.1_2 Forward -108 -98 -0.314959 0.273
NP_441719.1_2 Reverse -236 -250 13.1562 0.289
NP_441719.1_10 Reverse -285 -303 18.407 0.042
NP_441733.1_10 Forward -208 -195 3.5592 0.295
NP_442813.1_4 Reverse -224 -243 -6.68705 0.299
NP_442366.1_3 Forward -313 -295 7.78729 0.0724
NP_441851.1_9 Reverse -113 -132 19.6656 0.0617
NP_441396.1_5 Reverse -94 -103 7.27622 0.29
NP_440593.1_9 Reverse -96 -110 11.406 0.24
NP_442843.1_1 Forward -234 -215 -4.22878 0.235
NP_442843.1_1 Reverse -280 -299 -8.65367 0.258
NP_440943.1_5 Forward -398 -384 14.7492 0.22
NP_442006.1_2 Forward -90 -73 3.18543 0.0846
NP_441003.1_1 Forward -248 -229 21.0423 0.169
NP_442348.1_2 Forward -178 -169 12.2911 0.218
NP_440707.1_9 Forward -80 -61 1.27776 0.292
NP_441432.1_8 Forward -13 -4 5.21127 0.185
NP_441030.1_7 Forward -169 -150 21.8289 0.0323
NP_442489.1_2 Forward -101 -82 3.44104 0.236
NP_440941.1_3 Reverse -30 -49 17.4032 0.164
NP_441452.1_1 Reverse -150 -169 13.3725 0.292
NP_441629.1_3 Forward -103 -84 3.63691 0.218
NP_442551.1_4 Forward -113 -98 3.12649 0.245
NP_441585.1_5 Forward -46 -27 -0.0996487 0.291
NP_441948.1_4 Reverse -92 -110 2.57575 0.122
NP_441895.1_2 Forward -333 -314 -26.9432 0.275
NP_441895.1_2 Reverse -317 -336 -26.9432 0.275
NP_442162.1_8 Reverse -227 -246 -3.83545 0.291
NP_441973.1_1 Forward -173 -158 -7.88658 0.293
NP_440594.1_6 Forward -354 -335 11.8967 0.169
NP_440590.1_4 Reverse -297 -310 -2.144 0.237
NP_441951.1_9 Reverse -225 -244 1.76941 0.254
NP_441769.1_1 Forward -116 -97 6.88262 0.287
NP_440833.1_6 Forward -334 -320 9.14375 0.265
NP_440833.1_6 Reverse -28 -42 6.78381 0.296
NP_442216.1_4 Reverse -221 -229 17.6202 0.23
NP_442138.1_1 Forward -314 -295 -0.00131823 0.298
NP_440546.1_4 Reverse -296 -306 7.71902 0.224
NP_442402.1_2 Forward -298 -284 10.8154 0.292
NP_442409.1_10 Reverse -71 -85 15.2402 0.293
NP_440825.1_6 Forward -75 -56 11.2092 0.282
NP_440505.1_3 Reverse -97 -107 9.12481 0.125
NP_440505.1_3 Reverse -294 -304 4.60159 0.277
NP_440914.1_1 Forward -305 -295 12.6163 0.0518
NP_442533.1_6 Forward -111 -102 8.65285 0.0727
NP_442533.1_6 Forward -305 -296 2.85133 0.236
NP_441527.1_7 Forward -41 -22 9.53674 0.282
NP_440115.1_6 Forward -15 -5 11.0914 0.115
NP_441059.1_4 Forward -197 -178 12.7825 0.125
NP_440429.1_2 Forward -247 -228 8.55425 0.272
NP_441930.1_2 Forward -241 -231 16.4013 0.19
NP_441930.1_3 Forward -190 -171 26.9923 0.00219
NP_440886.1_7 Forward -109 -99 4.40448 0.237
NP_440886.1_7 Forward -340 -330 4.30615 0.243
NP_441463.1_3 Reverse -209 -228 -5.40875 0.226
NP_441488.1_8 Forward -169 -155 8.16044 0.204
NP_441174.1_2 Reverse -96 -110 13.0776 0.222
NP_440467.1_3 Reverse -297 -316 10.8656 0.296
NP_442087.1_2 Reverse -101 -120 14.8577 0.202
NP_442867.1_8 Reverse -73 -92 9.0459 0.229
NP_440801.1_10 Reverse -95 -114 9.3409 0.272
NP_440524.1_2 Reverse -118 -137 -3.54046 0.27
NP_440524.1_3 Forward -124 -105 9.53756 0.278
NP_441885.1_5 Reverse -296 -306 -1.59326 0.273
NP_440478.1_9 Reverse -105 -124 7.7676 0.28
NP_442341.1_7 Forward -243 -229 3.14618 0.234
NP_442341.1_7 Reverse -295 -309 2.94952 0.239
NP_440191.1_4 Forward -292 -282 14.3116 0.266
NP_440507.2_3 Reverse -90 -109 6.78348 0.299
NP_442275.1_1 Reverse -99 -118 0.294447 0.285
NP_442451.1_2 Reverse -301 -320 -8.65367 0.252
NP_442451.1_7 Reverse -17 -36 11.9958 0.158
NP_441122.1_1 Forward -175 -160 4.01147 0.28
NP_442495.1_4 Forward -236 -226 12.0747 0.25
NP_440216.1_9 Reverse -164 -173 6.19458 0.289
NP_440172.1_1 Forward -12 -2 2.7333 0.268
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTTATTATTGGCTTAACTTCCTTTATTAAACAACAGGAAATTGGTGGTTTATTCACTTCCACTACCCCCAATTTACTAGGGGGAGCTTCCATTACCGATGCCCATATTTCCACCATTACCGATTCGATTATTCTTTTGCGTTACGTGGAAATGTATGGCGAAATGCGCCGGGGAATTACGGTGCTAAAGATGCGGGGTTCTATGCACGACAAAGATATCCGGGAATTTTCCATTGACCATCAAGGGATGCACATTGGTAAACCTTTCCGTAATGTCACCGGCATTCTGGCCGGGACCCCCATGTACACAGCCCAGAGTGAGGTGGAAAGATTGAGCGGTTTATTCGATGAGAAAATATAGTCAATTCTTCCCTTTGTAAACCTGGAGGCAATCAATCC

CDS

ATGCAGTGGCAAGAATCTTTACCCTGGACCCCCGAAGCTCGGCAAAAGTTGAAGAATATTCCCTATTTTGCCCGGGTGCAAGCCCGTCAGCGCATTGAGCAGTTAGCTCGGCAGGCCGATCTAGATGAGGTCACTGTGGATTTGGTAGAACAAGCCCGTCTGGAGTTTGGCCAATGA

Protein

MQWQESLPWTPEARQKLKNIPYFARVQARQRIEQLARQADLDEVTVDLVEQARLEFGQ