Your browser is old and dusty. Try Google Chrome!

Details for ssr3188

ORF ssr3188
Accession NP_441018.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -333 -352 -21.4367 0.149
NP_440897.1_6 Forward -312 -293 -2.36125 0.21
NP_441453.1_7 Forward -324 -317 12.1338 0.295
NP_441818.1_9 Reverse -357 -376 -7.67036 0.273
NP_442752.1_4 Forward -319 -312 5.54565 0.194
NP_443027.1_4 Forward -218 -208 5.97822 0.294
NP_440878.1_9 Forward -342 -323 -2.55715 0.268
NP_442062.1_8 Forward -11 -1 3.12662 0.285
NP_441859.1_5 Reverse -360 -379 2.26107 0.295
NP_442242.1_4 Forward -341 -334 9.57722 0.227
NP_441200.1_4 Reverse -122 -141 6.4893 0.276
NP_440893.1_3 Reverse -322 -341 4.22689 0.262
NP_440014.1_3 Forward -385 -371 15.9698 0.262
NP_441772.1_4 Forward -35 -16 9.7334 0.17
NP_441083.1_5 Reverse -310 -320 7.15819 0.0637
NP_441083.1_5 Forward -319 -309 4.69992 0.134
NP_441434.1_1 Forward -36 -22 8.5104 0.254
NP_441738.1_2 Reverse -51 -58 8.29857 0.176
NP_441645.1_1 Forward -398 -379 13.7649 0.158
NP_440209.1_1 Forward -342 -334 2.08437 0.286
NP_440053.1_9 Forward -383 -364 16.5438 0.293
NP_442570.1_3 Reverse -367 -386 -4.52377 0.231
NP_441163.1_1 Forward -359 -342 4.16803 0.291
NP_440906.1_5 Forward -341 -334 9.47889 0.116
NP_440747.1_10 Forward -322 -310 -12.3507 0.27
NP_441265.1_1 Forward -394 -375 -16.9135 0.254
NP_440842.1_6 Forward -395 -376 10.6184 0.278
NP_443018.1_3 Forward -10 -3 10.7572 0.0907
NP_443018.1_3 Reverse -3 -10 4.56234 0.241
NP_440376.1_1 Forward -319 -310 3.44131 0.203
NP_440376.1_1 Forward -318 -309 1.1797 0.255
NP_442687.1_7 Forward -343 -333 9.51814 0.0994
NP_441797.1_7 Forward -336 -318 12.1139 0.262
NP_441077.1_2 Reverse -22 -41 6.54077 0.196
NP_442485.1_3 Reverse -214 -233 0.982764 0.234
NP_440642.1_10 Forward -20 -6 7.17714 0.222
NP_442720.1_8 Reverse -252 -270 10.5406 0.297
NP_442658.1_1 Forward -353 -343 4.99446 0.288
NP_440203.1_2 Reverse -371 -390 15.5357 0.201
NP_440203.1_5 Reverse -264 -274 12.1726 0.164
NP_440203.1_5 Forward -387 -377 10.5993 0.218
NP_439905.1_1 Forward -377 -364 6.50913 0.285
NP_440858.1_1 Reverse -139 -158 0.58944 0.212
NP_443055.1_6 Reverse -302 -320 -0.276578 0.256
NP_442236.1_3 Forward -348 -329 8.94757 0.238
NP_440993.1_3 Reverse -209 -228 -0.689632 0.273
NP_442002.1_1 Reverse -367 -385 -10.0106 0.288
NP_441294.1_7 Reverse -306 -320 13.3781 0.0692
NP_442431.1_10 Reverse -363 -381 0.117479 0.281
NP_440147.1_4 Forward -314 -301 1.29759 0.233
NP_441916.1_10 Forward -264 -245 2.65439 0.243
NP_441041.1_7 Reverse -128 -140 8.19502 0.143
NP_442996.1_1 Reverse -18 -37 8.06865 0.21
NP_440260.1_7 Reverse -377 -396 -4.42544 0.247
NP_441514.1_4 Reverse -16 -35 14.5416 0.236
NP_441678.1_9 Reverse -364 -383 -0.885524 0.235
NP_442281.1_1 Reverse -305 -319 7.07881 0.108
NP_441079.1_7 Reverse -18 -37 -2.36125 0.217
NP_441079.1_7 Forward -37 -18 -2.65624 0.22
NP_442172.1_1 Reverse -17 -36 10.077 0.29
NP_440479.1_9 Forward -321 -303 14.5721 0.297
NP_441556.1_7 Forward -362 -343 -1.08295 0.3
NP_440375.1_9 Forward -216 -197 14.6415 0.271
NP_442068.1_4 Forward -366 -347 5.99684 0.243
NP_441644.1_6 Reverse -2 -12 3.91283 0.256
NP_440652.1_3 Forward -357 -338 11.4058 0.23
NP_442215.1_2 Forward -334 -318 -5.448 0.25
NP_442215.1_2 Reverse -382 -398 -6.7263 0.278
NP_442029.1_1 Reverse -364 -383 -9.44032 0.192
NP_442933.1_1 Reverse -82 -101 10.1695 0.253
NP_442933.1_1 Forward -41 -22 8.25963 0.253
NP_442554.1_8 Forward -374 -364 2.24165 0.276
NP_442554.1_8 Reverse -3 -13 1.74999 0.298
NP_441762.1_7 Reverse -332 -344 -3.50094 0.11
NP_440357.1_6 Reverse -207 -226 6.68596 0.279
NP_440379.1_5 Reverse -365 -384 -8.752 0.254
NP_441468.1_1 Reverse -3 -10 4.07068 0.263
NP_441876.1_9 Forward -154 -144 14.0409 0.267
NP_441330.1_1 Forward -316 -297 -9.14533 0.183
NP_441637.1_9 Forward -26 -8 -1.84914 0.292
NP_441764.1_8 Forward -89 -79 13.3205 0.284
NP_442361.1_5 Reverse -137 -156 16.2241 0.3
NP_442808.1_1 Reverse -121 -131 4.20782 0.203
NP_440334.1_2 Reverse -11 -24 14.2773 0.256
NP_441114.1_3 Forward -383 -374 7.86621 0.231
NP_440558.1_2 Forward -355 -336 -3.04881 0.232
NP_441878.1_6 Reverse -1 -11 2.33998 0.0405
NP_441557.1_8 Forward -157 -147 11.9759 0.236
NP_441433.1_8 Reverse -262 -281 5.70265 0.178
NP_442795.1_10 Forward -156 -137 16.6174 0.233
NP_440101.1_3 Reverse -364 -383 6.09597 0.185
NP_440101.1_3 Reverse -341 -360 4.03102 0.224
NP_442166.1_3 Forward -320 -301 -1.57384 0.211
NP_441238.1_7 Forward -30 -11 14.8486 0.24
NP_442347.1_2 Reverse -311 -320 15.831 0.056
NP_442645.1_2 Reverse -114 -133 -18.4868 0.274
NP_442594.1_5 Forward -390 -371 9.53674 0.233
NP_441633.1_3 Reverse -214 -227 -6.17557 0.238
NP_442590.1_10 Reverse -310 -329 3.73603 0.286
NP_442998.1_5 Reverse -7 -17 8.33817 0.264
NP_440899.1_8 Reverse -280 -299 -8.16202 0.254
NP_440299.1_3 Forward -380 -361 11.3075 0.244
NP_442961.1_4 Reverse -253 -272 3.14605 0.294
NP_440709.1_1 Reverse -20 -39 1.57197 0.237
NP_441559.1_8 Reverse -257 -271 -5.40861 0.261
NP_440915.1_6 Forward -323 -309 6.78443 0.0791
NP_442158.1_4 Reverse -388 -398 11.8781 0.264
NP_442158.1_4 Reverse -82 -92 10.4031 0.297
NP_440329.1_2 Forward -302 -283 16.4207 0.146
NP_440748.1_5 Forward -243 -224 0.196116 0.252
NP_441464.1_10 Forward -133 -119 8.16106 0.287
NP_441340.1_5 Forward -10 -3 3.97235 0.274
NP_442791.1_5 Forward -359 -340 -0.688862 0.21
NP_440327.1_6 Forward -22 -3 3.24438 0.285
NP_440586.1_8 Forward -48 -41 5.93863 0.283
NP_442251.1_6 Reverse -334 -341 10.4622 0.12
NP_440192.1_4 Reverse -129 -148 10.1738 0.248
NP_442959.1_7 Reverse -121 -140 -0.688862 0.245
NP_440027.1_3 Forward -384 -366 3.45998 0.272
NP_440027.1_3 Reverse -323 -341 2.08335 0.293
NP_441595.1_3 Reverse -319 -329 17.5813 0.202
NP_440408.1_7 Forward -276 -257 11.9958 0.212
NP_440271.1_2 Forward -279 -260 7.47261 0.23
NP_440316.1_10 Forward -271 -261 7.25653 0.251
NP_440316.1_10 Reverse -1 -11 6.96153 0.251
NP_441803.1_2 Forward -233 -214 1.76941 0.226
NP_442384.1_10 Reverse -310 -323 7.29578 0.0844
NP_442384.1_10 Reverse -333 -346 1.9859 0.24
NP_440476.1_2 Forward -29 -10 11.995 0.284
NP_441018.1_2 Forward -276 -257 15.5357 0.267
NP_441018.1_7 Forward -135 -116 13.3725 0.136
NP_441018.1_7 Reverse -242 -261 7.7676 0.265
NP_441018.1_7 Reverse -97 -116 6.19431 0.297
NP_442262.1_10 Forward -10 -3 9.87221 0.164
NP_440163.1_10 Reverse -339 -349 13.2547 0.13
NP_440531.1_8 Reverse -341 -360 6.29264 0.243
NP_442910.1_6 Reverse -217 -231 8.25939 0.24
NP_442280.1_10 Reverse -258 -276 9.44784 0.233
NP_440888.1_2 Reverse -310 -324 14.0603 0.0211
NP_441748.1_9 Forward -21 -2 9.34008 0.185
NP_441123.1_8 Reverse -380 -399 11.1109 0.251
NP_442845.1_2 Reverse -369 -383 14.0609 0.0872
NP_441304.1_10 Forward -143 -134 13.3727 0.249
NP_441469.1_8 Reverse -1 -10 9.63616 0.227
NP_443064.1_6 Forward -319 -309 16.3482 0.0796
NP_443064.1_6 Reverse -115 -125 8.39772 0.292
NP_442578.1_5 Reverse -215 -234 6.78429 0.227
NP_442578.1_7 Forward -227 -220 6.72562 0.18
NP_440148.1_8 Forward -271 -261 17.0896 0.28
NP_441462.1_2 Forward -319 -309 -1.10161 0.281
NP_443062.1_1 Forward -342 -324 3.57305 0.293
NP_443062.1_6 Forward -350 -331 2.26107 0.258
NP_440519.1_6 Reverse -256 -270 12.9793 0.29
NP_440516.1_6 Forward -351 -337 9.73373 0.234
NP_442428.1_4 Reverse -368 -387 10.6192 0.134
NP_442428.1_5 Reverse -3 -10 4.46401 0.267
NP_441267.1_3 Reverse -272 -290 7.58986 0.291
NP_440673.1_3 Forward -9 -2 8.98723 0.203
NP_440673.1_3 Reverse -263 -270 6.72562 0.277
NP_441052.1_2 Reverse -310 -320 5.97822 0.0968
NP_441052.1_2 Forward -384 -374 2.63497 0.197
NP_442219.1_9 Reverse -311 -320 1.76968 0.298
NP_440436.1_4 Forward -10 -1 9.73406 0.0871
NP_441884.1_9 Reverse -340 -359 -11.2103 0.103
NP_441884.1_9 Reverse -363 -382 -23.5016 0.284
NP_440314.1_9 Forward -374 -355 -4.32711 0.205
NP_442414.1_8 Forward -154 -135 7.27595 0.293
NP_441004.1_2 Reverse -37 -56 -4.52377 0.291
NP_441115.1_4 Forward -50 -32 9.94979 0.194
NP_440328.1_4 Forward -325 -306 0.687771 0.243
NP_441851.1_10 Reverse -1 -11 6.07655 0.187
NP_442856.1_7 Forward -125 -106 -1.86883 0.231
NP_441668.1_5 Reverse -7 -26 9.14423 0.232
NP_442515.1_1 Forward -394 -380 0.0979218 0.203
NP_442515.1_1 Reverse -1 -15 -1.37704 0.253
NP_441683.1_7 Forward -271 -252 2.94938 0.241
NP_440593.1_3 Reverse -318 -337 -2.45882 0.226
NP_441046.1_2 Reverse -341 -360 -1.96717 0.294
NP_440432.1_9 Forward -157 -142 -6.11662 0.284
NP_441477.1_10 Forward -385 -367 3.65739 0.217
NP_440431.1_3 Forward -296 -277 -4.03212 0.178
NP_440431.1_3 Forward -257 -238 -9.44032 0.246
NP_442237.1_3 Reverse -20 -34 16.1498 0.289
NP_442335.1_10 Reverse -377 -391 20.9441 0.146
NP_442006.1_2 Reverse -1 -18 -11.0726 0.197
NP_441078.1_4 Reverse -2 -11 -1.57357 0.266
NP_442388.1_3 Reverse -363 -382 5.80098 0.282
NP_442348.1_2 Reverse -342 -351 14.7494 0.146
NP_441094.1_3 Forward -273 -256 8.29864 0.272
NP_441432.1_8 Reverse -1 -10 6.5879 0.112
NP_443024.1_3 Reverse -129 -139 14.238 0.255
NP_442447.1_1 Forward -66 -47 5.70265 0.258
NP_441131.1_5 Reverse -322 -341 3.24438 0.255
NP_440199.1_4 Reverse -19 -37 20.1508 0.156
NP_441057.1_4 Reverse -365 -383 -1.25915 0.272
NP_442178.1_10 Forward -238 -219 16.8141 0.281
NP_440713.1_4 Reverse -371 -390 6.09597 0.196
NP_442489.1_7 Reverse -2 -11 -1.57357 0.213
NP_442489.1_7 Forward -11 -2 -2.06522 0.288
NP_441659.2_8 Forward -49 -39 3.91327 0.149
NP_442749.1_5 Reverse -334 -351 8.3201 0.239
NP_442913.1_9 Forward -325 -306 7.86593 0.277
NP_442913.1_10 Reverse -301 -320 -5.50708 0.268
NP_442346.1_5 Reverse -1 -11 13.1564 0.029
NP_442346.1_10 Reverse -214 -233 -2.85214 0.294
NP_440352.1_5 Reverse -35 -54 9.73562 0.289
NP_440025.1_3 Reverse -44 -58 10.998 0.29
NP_442603.1_7 Reverse -310 -324 5.40719 0.296
NP_441585.1_5 Forward -361 -342 -0.197979 0.291
NP_441047.1_2 Reverse -117 -136 -2.16383 0.273
NP_441833.1_3 Forward -297 -283 16.4209 0.213
NP_442799.1_2 Reverse -295 -314 2.55606 0.216
NP_440671.1_2 Reverse -313 -327 17.6008 0.135
NP_441813.1_5 Forward -344 -334 -0.216628 0.237
NP_442497.1_1 Reverse -111 -130 13.0766 0.146
NP_442497.1_10 Forward -10 -1 0.196389 0.208
NP_442270.1_9 Forward -343 -324 -8.752 0.226
NP_442643.1_5 Reverse -372 -391 4.42435 0.25
NP_440546.1_4 Reverse -375 -385 10.143 0.109
NP_440675.1_3 Reverse -258 -277 13.4708 0.161
NP_440462.1_4 Reverse -368 -382 7.27608 0.278
NP_440868.1_4 Forward -346 -334 3.97222 0.129
NP_442039.1_7 Reverse -4 -14 13.943 0.211
NP_441811.1_1 Forward -159 -140 3.93269 0.299
NP_440008.1_9 Reverse -268 -287 6.09597 0.293
NP_442409.1_10 Reverse -258 -272 17.9935 0.197
NP_440825.1_6 Reverse -366 -385 13.9625 0.242
NP_439994.1_3 Forward -105 -86 10.0969 0.222
NP_440505.1_3 Forward -321 -311 6.37155 0.183
NP_440013.1_1 Forward -54 -35 11.2084 0.222
NP_442532.1_1 Reverse -21 -35 10.308 0.249
NP_442532.1_4 Forward -37 -19 7.86797 0.289
NP_441576.1_10 Forward -38 -19 9.83255 0.291
NP_441408.2_7 Reverse -114 -133 -4.81876 0.286
NP_440914.1_1 Reverse -2 -12 12.226 0.0652
NP_440914.1_1 Forward -270 -260 7.15123 0.249
NP_441011.1_8 Forward -341 -332 5.70292 0.237
NP_442533.1_6 Reverse -310 -319 3.7363 0.204
NP_442533.1_6 Forward -384 -375 3.04799 0.228
NP_440263.1_5 Reverse -243 -257 8.45605 0.294
NP_441697.1_5 Forward -37 -18 -1.38506 0.206
NP_440816.1_2 Reverse -6 -25 15.3417 0.141
NP_441028.1_6 Forward -155 -145 17.4824 0.132
NP_441028.1_6 Reverse -311 -321 8.73102 0.216
NP_441028.1_6 Reverse -189 -199 3.91283 0.279
NP_441527.1_4 Forward -285 -266 -9.31089 0.256
NP_441527.1_4 Forward -296 -277 -12.7486 0.293
NP_442716.1_5 Reverse -296 -315 17.7452 0.165
NP_441106.1_1 Reverse -332 -341 4.22796 0.231
NP_441106.1_1 Reverse -39 -48 2.458 0.283
NP_440429.1_9 Forward -141 -122 7.27595 0.211
NP_442674.1_1 Forward -258 -239 10.2702 0.285
NP_442674.1_2 Forward -70 -51 7.27595 0.283
NP_442674.1_3 Reverse -289 -308 5.40686 0.269
NP_440670.1_6 Forward -386 -367 12.8808 0.292
NP_441930.1_2 Forward -271 -261 14.1397 0.226
NP_441930.1_2 Reverse -1 -11 12.2714 0.262
NP_440886.1_4 Reverse -341 -360 13.9625 0.267
NP_441001.1_10 Reverse -260 -279 11.7992 0.249
NP_442614.1_2 Reverse -149 -163 10.816 0.228
NP_442382.1_9 Reverse -319 -338 7.66846 0.29
NP_442800.1_7 Reverse -364 -383 3.93269 0.275
NP_442264.1_2 Reverse -380 -397 4.6604 0.295
NP_442912.1_9 Reverse -141 -160 16.4207 0.199
NP_442794.1_1 Reverse -299 -311 8.79043 0.0914
NP_442615.1_1 Forward -20 -2 -6.37237 0.244
NP_441962.1_4 Forward -145 -126 -9.53865 0.218
NP_441796.1_8 Forward -277 -259 15.6538 0.127
NP_441431.1_3 Reverse -368 -387 3.83436 0.263
NP_441836.1_2 Reverse -363 -382 -3.3438 0.237
NP_440634.1_10 Forward -381 -362 4.03023 0.3
NP_441206.1_4 Forward -356 -337 -5.9004 0.263
NP_440293.1_3 Forward -133 -114 -2.16383 0.239
NP_442930.1_1 Forward -26 -16 11.4843 0.258
NP_441133.1_1 Reverse -369 -388 18.1907 0.126
NP_440457.1_1 Forward -274 -262 0.923956 0.25
NP_442680.1_5 Forward -291 -272 5.24982 0.227
NP_442297.1_9 Reverse -281 -300 15.6332 0.223
NP_441984.1_1 Reverse -363 -381 9.26226 0.226
NP_441885.1_5 Reverse -310 -320 -1.00328 0.248
NP_440898.1_5 Forward -140 -121 12.8808 0.244
NP_442341.1_7 Forward -333 -319 1.17956 0.297
NP_442341.1_7 Forward -320 -306 1.17956 0.297
NP_442341.1_9 Forward -321 -307 6.29216 0.233
NP_441173.1_9 Forward -154 -146 10.1471 0.261
NP_442395.2_2 Forward -383 -364 19.2715 0.0887
NP_440750.1_5 Forward -293 -279 5.40779 0.271
NP_440750.1_8 Reverse -197 -215 13.0964 0.255
NP_440552.1_8 Reverse -24 -41 12.3706 0.231
NP_440091.1_1 Reverse -329 -341 5.64384 0.111
NP_442275.1_3 Reverse -147 -166 16.7157 0.131
NP_440679.1_5 Reverse -258 -277 9.73422 0.29
NP_443010.1_10 Reverse -128 -145 2.57753 0.273
NP_442638.1_3 Reverse -14 -33 11.2199 0.298
NP_442753.1_6 Forward -387 -368 9.24175 0.231
NP_440175.1_4 Reverse -308 -327 -13.5702 0.25
NP_440804.1_7 Forward -64 -47 6.3313 0.291
NP_441105.1_3 Forward -330 -311 -7.86702 0.261
NP_440216.1_1 Reverse -310 -324 -11.9968 0.236
NP_440216.1_9 Forward -398 -389 14.2577 0.183
NP_440216.1_9 Reverse -4 -13 7.17789 0.286
NP_440172.1_1 Reverse -2 -12 2.43831 0.279
NP_441766.1_9 Reverse -367 -386 1.17943 0.246
NP_440416.1_1 Forward -319 -300 -14.7502 0.299
NP_440416.1_9 Reverse -100 -119 -17.7001 0.245
NP_440416.1_9 Forward -385 -366 -18.8801 0.266
NP_442403.1_9 Forward -345 -326 5.30933 0.211
NP_442154.1_1 Reverse -367 -385 -16.7954 0.245
NP_442154.1_1 Reverse -366 -384 -17.1888 0.249
NP_442154.1_1 Reverse -358 -376 -17.1888 0.249
NP_440988.1_10 Forward -386 -372 7.51277 0.216
NP_440988.1_10 Reverse -321 -335 6.54464 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACCAAGGGAAATCAACCCCATGCCCAACATCGGCACTATACCCCGGTCAACAATGCCCGTGATCGTTGTCAACTGCCACTGGGGATCAGCCATTTGCAGAGGGAAGATGAGGCTAAAAAAATCCAGCAGGGCAATGAGGACGAAAATAACGCCAAACAACTTTAATGTCAGGGCGGTAAAGGCAGGGATGTTCATAAATTCCAGAGAGCAACGCAATATACTATACGCCATCTTAGCTAAGCACTTTCCCCCCATGAGGCGCAATTTCAGCTTTGGGGGTGCCTCCTATCGAAAGTGCAAACAAGATCCAAGATCAAAGTTAGATGGTCTAGATTAGATTAGGCGAATTAAGCCAACGTCTGTCAAATTATCTAAATTATTTCCATTTTGCCATTGCCC

CDS

ATGAGCCTCCCCGCACCGGAAACTCCCCTCTATAACCATCCCCTGCCCCAATTAGAACGCTGGCTCATGGCCCTGGGTTGTCAGCAAGACCGTGGCGATCGCCATTGTTGGCTACTCCATCAAGGGGACTGGGATGCGGAACTGAGTTTGGACACAGAAGAACTTGTGATCTGCTACTTCCCCCACCAACCCCAACGCAAAGTGGTGCGGAGCTTTAAATATTCCCTCAGTCGCCAAGACGTGGAAGCTGCGGTCCTGGAAGGTCCCTAG

Protein

MSLPAPETPLYNHPLPQLERWLMALGCQQDRGDRHCWLLHQGDWDAELSLDTEELVICYFPHQPQRKVVRSFKYSLSRQDVEAAVLEGP