Your browser is old and dusty. Try Google Chrome!

Details for ssr3184

ORF ssr3184
Accession NP_441014.1
Symbol
Category Soluble electron carriers
Definition 4Fe-4S type iron-sulfur protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -248 -262 2.5562 0.174
NP_441061.1_2 Forward -255 -241 -1.5737 0.265
NP_441061.1_2 Forward -316 -302 -1.96703 0.278
NP_441453.1_4 Forward -256 -248 6.80426 0.121
NP_441453.1_4 Reverse -247 -255 6.11594 0.121
NP_441453.1_7 Reverse -321 -328 12.9205 0.23
NP_442151.1_6 Forward -256 -242 5.1128 0.294
NP_441818.1_1 Reverse -248 -259 15.2011 0.0343
NP_441465.1_5 Forward -249 -235 16.4209 0.286
NP_441465.1_8 Forward -267 -249 18.112 0.0785
NP_442169.1_1 Reverse -269 -288 -0.885524 0.262
NP_440813.1_1 Reverse -241 -255 17.4035 0.199
NP_442173.1_1 Reverse -248 -256 12.0158 0.0316
NP_442173.1_1 Forward -255 -247 4.83764 0.241
NP_442752.1_4 Forward -256 -249 13.8055 0.0199
NP_442975.1_10 Reverse -243 -257 2.35894 0.276
NP_440784.1_7 Forward -255 -248 6.23397 0.241
NP_440784.1_7 Reverse -248 -255 6.13563 0.241
NP_442909.1_7 Reverse -248 -262 10.422 0.136
NP_442861.1_4 Reverse -194 -213 -0.197979 0.297
NP_441250.1_3 Forward -316 -297 5.60432 0.24
NP_440061.1_9 Reverse -236 -250 5.1122 0.294
NP_440761.1_9 Reverse -6 -25 12.6841 0.195
NP_440304.1_4 Forward -249 -239 4.10993 0.272
NP_440044.1_8 Forward -73 -54 0.491109 0.197
NP_442359.1_5 Forward -98 -79 11.7008 0.26
NP_441935.1_2 Reverse -50 -69 -4.42544 0.27
NP_441208.1_9 Reverse -122 -136 5.70279 0.262
NP_442742.1_9 Forward -290 -271 -14.0619 0.292
NP_440300.1_1 Reverse -241 -260 9.53674 0.233
NP_440856.1_7 Forward -94 -75 -1.67217 0.182
NP_441083.1_5 Reverse -247 -257 17.7779 0.00336
NP_441083.1_5 Forward -256 -246 -0.904945 0.283
NP_441738.1_2 Reverse -249 -256 15.28 0.0102
NP_441558.1_5 Forward -258 -239 5.99764 0.232
NP_440209.1_1 Forward -256 -248 8.57422 0.0425
NP_440209.1_1 Reverse -247 -255 5.52596 0.0821
NP_442889.1_1 Forward -297 -278 -5.60541 0.179
NP_442889.1_8 Reverse -244 -258 6.78381 0.175
NP_440447.1_5 Forward -296 -286 12.9597 0.291
NP_440178.1_7 Reverse -246 -265 -16.1268 0.164
NP_442570.1_3 Reverse -231 -250 -3.93378 0.225
NP_441025.1_6 Forward -52 -33 3.92987 0.237
NP_441163.1_1 Forward -343 -326 8.88789 0.226
NP_441163.1_1 Forward -222 -205 4.46302 0.287
NP_440906.1_5 Forward -255 -248 6.23397 0.234
NP_440906.1_5 Reverse -248 -255 6.13563 0.241
NP_440438.2_8 Forward -54 -35 1.0811 0.282
NP_442801.1_5 Reverse -132 -149 16.1643 0.116
NP_440747.1_10 Forward -259 -247 -11.9574 0.178
NP_441130.1_10 Reverse -245 -259 8.35772 0.138
NP_441486.1_1 Forward -259 -245 -4.81863 0.209
NP_441486.1_1 Reverse -202 -216 -5.11362 0.222
NP_440944.1_2 Forward -121 -102 -3.04881 0.282
NP_443017.1_1 Reverse -37 -56 14.8375 0.274
NP_441695.1_4 Forward -293 -275 15.0638 0.17
NP_442848.1_1 Forward -262 -248 15.7325 0.0143
NP_441012.1_4 Reverse -185 -198 17.2272 0.137
NP_443018.1_3 Reverse -248 -255 11.7405 0.0655
NP_443018.1_3 Forward -255 -248 5.44732 0.193
NP_441634.1_8 Forward -258 -244 3.93283 0.14
NP_440376.1_1 Forward -256 -247 5.99792 0.111
NP_440376.1_1 Reverse -280 -289 0.196389 0.283
NP_440376.1_1 Reverse -247 -256 -0.196935 0.285
NP_441588.1_4 Reverse -249 -259 8.63316 0.14
NP_442687.1_7 Forward -79 -69 3.61828 0.299
NP_441077.1_6 Reverse -12 -28 4.34438 0.255
NP_440642.1_10 Forward -160 -146 2.35894 0.277
NP_441013.1_1 Reverse -140 -158 22.1436 0.045
NP_441013.1_2 Forward -228 -210 -3.12744 0.289
NP_442658.1_1 Forward -216 -206 10.3043 0.125
NP_442658.1_1 Forward -264 -254 7.55106 0.214
NP_442658.1_1 Reverse -245 -255 6.96107 0.214
NP_440141.1_8 Forward -223 -204 9.73422 0.214
NP_442782.1_2 Reverse -281 -295 3.73617 0.263
NP_442782.1_2 Reverse -234 -248 0.687908 0.286
NP_442496.1_5 Reverse -286 -304 5.72234 0.285
NP_442205.1_9 Forward -182 -166 -2.98973 0.277
NP_441414.1_9 Forward -256 -237 12.7825 0.0151
NP_441414.1_9 Reverse -247 -266 -1.18052 0.0993
NP_440184.1_5 Forward -266 -247 5.30933 0.241
NP_442937.1_2 Forward -271 -252 12.7816 0.293
NP_441958.1_5 Forward -257 -247 0.865012 0.12
NP_442836.1_10 Forward -255 -245 13.943 0.212
NP_439905.1_1 Forward -255 -242 6.70579 0.279
NP_440984.1_3 Reverse -253 -272 12.6841 0.283
NP_440984.1_7 Reverse -242 -256 11.3077 0.122
NP_441162.1_3 Forward -69 -50 9.53756 0.24
NP_441338.2_5 Reverse -273 -292 12.4875 0.223
NP_442911.1_2 Reverse -228 -247 -5.11376 0.15
NP_443055.1_6 Forward -256 -238 1.00172 0.237
NP_440993.1_4 Forward -248 -231 14.7885 0.171
NP_440934.1_4 Reverse -114 -133 10.6192 0.187
NP_439975.1_2 Forward -192 -174 6.41066 0.249
NP_441099.1_5 Reverse -237 -256 -7.86702 0.181
NP_442002.1_1 Forward -265 -247 -7.749 0.254
NP_441752.1_6 Forward -354 -335 7.96426 0.211
NP_440377.1_1 Forward -40 -23 13.5929 0.231
NP_441000.1_6 Reverse -246 -260 -5.60527 0.285
NP_440484.1_1 Forward -336 -317 9.53674 0.244
NP_441550.1_8 Forward -258 -248 11.091 0.0555
NP_441550.1_8 Reverse -245 -255 5.87944 0.224
NP_441916.1_10 Forward -331 -312 16.0274 0.0888
NP_441916.1_10 Forward -318 -299 4.42435 0.223
NP_441041.1_4 Reverse -247 -266 -4.52377 0.138
NP_441041.1_4 Forward -188 -169 -12.7836 0.274
NP_442004.1_6 Reverse -168 -182 1.57289 0.285
NP_440703.1_3 Forward -264 -245 16.078 0.297
NP_441725.1_5 Reverse -248 -258 1.455 0.135
NP_439966.1_7 Reverse -245 -255 17.1874 0.0068
NP_439966.1_7 Forward -258 -248 6.0761 0.195
NP_439966.1_9 Reverse -245 -254 9.83282 0.215
NP_442941.1_3 Reverse -248 -258 10.1081 0.024
NP_440289.1_2 Reverse -244 -257 -0.0790467 0.182
NP_440289.1_2 Forward -259 -246 -4.40561 0.288
NP_440983.1_5 Forward -341 -322 -7.76869 0.291
NP_440260.1_8 Reverse -324 -342 -1.16082 0.232
NP_441514.1_1 Reverse -154 -164 14.2496 0.274
NP_441678.1_9 Reverse -280 -299 -1.47551 0.253
NP_442281.1_1 Forward -252 -238 2.75226 0.257
NP_442281.1_1 Forward -212 -198 1.67063 0.293
NP_442575.1_8 Forward -226 -207 4.03102 0.171
NP_442256.1_2 Reverse -245 -263 -9.71562 0.288
NP_442012.1_1 Reverse -286 -305 2.16274 0.204
NP_441087.1_6 Forward -356 -338 0.706727 0.258
NP_442288.1_5 Reverse -218 -232 15.0442 0.228
NP_441644.1_6 Reverse -247 -257 14.4342 0.0126
NP_443049.1_6 Forward -257 -247 14.4711 0.114
NP_442215.1_2 Reverse -209 -225 -6.43131 0.271
NP_442215.1_2 Reverse -245 -261 -7.41462 0.294
NP_442177.1_5 Forward -91 -77 13.9626 0.22
NP_442029.1_6 Reverse -80 -99 5.40766 0.25
NP_440253.1_2 Reverse -247 -265 -1.35749 0.238
NP_440929.1_8 Reverse -247 -256 7.07956 0.0713
NP_441751.2_8 Reverse -248 -262 -3.93365 0.157
NP_441751.2_8 Reverse -239 -253 -6.39192 0.265
NP_442554.1_8 Reverse -248 -258 6.07655 0.126
NP_442554.1_8 Forward -255 -245 4.10993 0.198
NP_442167.1_6 Reverse -243 -259 22.0839 0.125
NP_441762.1_7 Forward -257 -245 4.75886 0.0453
NP_442142.1_4 Forward -259 -246 3.85363 0.243
NP_442142.1_4 Reverse -370 -383 2.28034 0.295
NP_442292.1_1 Reverse -248 -257 8.65285 0.0335
NP_441715.1_4 Reverse -248 -258 4.99491 0.24
NP_441198.1_4 Reverse -279 -298 8.84924 0.276
NP_441468.1_1 Forward -255 -248 6.13563 0.209
NP_441468.1_1 Reverse -248 -255 6.0373 0.223
NP_441673.1_1 Forward -256 -247 1.37636 0.114
NP_441673.1_1 Reverse -247 -256 1.1797 0.163
NP_441826.1_2 Forward -262 -248 10.4227 0.0475
NP_441826.1_2 Reverse -247 -261 -0.492064 0.213
NP_441637.1_9 Forward -362 -344 -2.43913 0.292
NP_442868.1_6 Forward -258 -248 0.176696 0.247
NP_442719.1_2 Forward -49 -31 -6.37307 0.225
NP_442719.1_2 Forward -243 -225 -10.7979 0.283
NP_442559.1_3 Forward -346 -327 8.35759 0.285
NP_442361.1_3 Forward -262 -249 14.0806 0.129
NP_442427.1_8 Reverse -32 -51 6.98095 0.224
NP_442808.1_1 Reverse -246 -256 19.449 0.00201
NP_442808.1_1 Reverse -178 -188 4.60114 0.195
NP_442808.1_1 Reverse -389 -399 3.12618 0.248
NP_442808.1_1 Forward -282 -272 3.02785 0.25
NP_442808.1_1 Reverse -71 -81 1.15957 0.292
NP_442775.1_6 Reverse -206 -225 14.3558 0.268
NP_442542.1_2 Reverse -245 -258 14.3756 0.114
NP_442050.1_5 Forward -258 -248 6.76441 0.282
NP_442342.1_1 Forward -219 -205 17.5288 0.259
NP_442342.1_9 Reverse -245 -261 5.6634 0.233
NP_441036.1_8 Reverse -246 -256 6.07655 0.242
NP_441557.1_5 Forward -256 -247 1.08137 0.0794
NP_441557.1_5 Reverse -247 -256 0.589713 0.134
NP_441557.1_8 Forward -288 -278 14.2375 0.201
NP_441557.1_8 Forward -346 -336 11.4843 0.246
NP_442066.2_9 Reverse -243 -256 16.5389 0.0475
NP_442777.1_1 Reverse -246 -265 11.7983 0.194
NP_440084.1_8 Forward -28 -14 15.1948 0.18
NP_440084.1_8 Reverse -158 -172 12.1391 0.241
NP_441739.1_2 Forward -41 -25 3.59778 0.264
NP_440101.1_10 Forward -311 -292 2.85105 0.245
NP_442183.1_1 Forward -256 -242 9.2427 0.0999
NP_441574.1_1 Reverse -287 -306 -5.99873 0.272
NP_440276.1_8 Forward -96 -77 7.07928 0.274
NP_442347.1_2 Reverse -248 -257 10.3245 0.058
NP_442645.1_2 Reverse -284 -303 -17.5035 0.256
NP_442594.1_8 Reverse -324 -343 3.04771 0.289
NP_441633.1_3 Reverse -236 -249 -4.40561 0.195
NP_440136.1_2 Forward -255 -248 6.23397 0.171
NP_440136.1_2 Reverse -248 -255 6.13563 0.193
NP_442998.1_5 Forward -43 -33 10.2065 0.222
NP_442998.1_10 Reverse -249 -256 15.5754 0.0102
NP_441799.1_1 Reverse -243 -257 4.32555 0.255
NP_441007.1_10 Reverse -242 -255 0.0192843 0.254
NP_441449.1_8 Forward -339 -320 18.3419 0.188
NP_441559.1_8 Forward -295 -281 -1.77037 0.185
NP_441559.1_8 Reverse -386 -400 -6.19526 0.275
NP_441559.1_8 Reverse -385 -399 -6.78525 0.279
NP_440915.1_6 Forward -260 -246 2.94952 0.11
NP_440915.1_6 Reverse -81 -95 -0.688726 0.205
NP_441296.1_8 Reverse -327 -346 14.0608 0.258
NP_441704.1_8 Reverse -74 -93 6.58682 0.258
NP_442452.1_8 Reverse -79 -93 11.602 0.273
NP_442866.1_1 Reverse -242 -261 6.29264 0.122
NP_442866.1_4 Reverse -228 -247 9.43923 0.164
NP_440748.1_1 Forward -356 -337 15.0441 0.255
NP_441464.1_1 Forward -293 -274 7.86593 0.261
NP_441464.1_10 Reverse -324 -338 7.86607 0.287
NP_440695.1_6 Reverse -156 -170 15.1623 0.193
NP_442386.1_9 Reverse -246 -255 13.8639 0.0289
NP_442386.1_9 Forward -215 -206 7.86578 0.215
NP_441340.1_5 Forward -255 -248 13.5105 0.0314
NP_441340.1_5 Reverse -248 -255 5.84064 0.208
NP_441947.1_4 Forward -231 -212 12.0942 0.236
NP_442791.1_5 Reverse -246 -265 -10.0303 0.279
NP_442791.1_5 Reverse -119 -138 -10.1286 0.279
NP_440168.1_9 Reverse -236 -255 1.47442 0.248
NP_440586.1_1 Reverse -298 -317 -5.40875 0.285
NP_440586.1_8 Reverse -248 -255 9.47853 0.146
NP_440586.1_8 Forward -226 -219 5.8403 0.283
NP_440586.1_8 Forward -255 -248 5.74197 0.283
NP_442959.1_5 Forward -42 -23 8.55425 0.224
NP_441262.1_3 Forward -256 -249 14.7888 0.0223
NP_440027.1_6 Forward -270 -257 19.5871 0.216
NP_443051.1_1 Forward -257 -248 7.47288 0.0571
NP_439937.1_9 Forward -292 -275 -16.1864 0.287
NP_441595.1_2 Forward -116 -103 9.99293 0.277
NP_441595.1_2 Reverse -149 -162 8.75154 0.28
NP_441167.1_1 Forward -56 -37 8.06259 0.213
NP_441740.2_10 Reverse -205 -224 12.0942 0.274
NP_443039.1_7 Forward -301 -287 5.40719 0.227
NP_439943.1_1 Reverse -314 -333 -7.27704 0.249
NP_439943.1_1 Reverse -293 -312 -9.73531 0.288
NP_440372.1_2 Forward -255 -248 13.8055 0.0214
NP_440372.1_2 Reverse -248 -255 6.52896 0.188
NP_441789.1_7 Forward -354 -335 -3.34455 0.272
NP_440819.1_5 Reverse -351 -359 7.8859 0.266
NP_441803.1_2 Reverse -206 -225 9.3409 0.1
NP_439977.1_5 Reverse -241 -260 -2.45882 0.282
NP_441877.1_5 Reverse -155 -174 6.4893 0.195
NP_442790.1_3 Reverse -206 -225 9.83255 0.203
NP_442262.1_10 Reverse -248 -255 13.2155 0.0213
NP_441689.1_5 Forward -258 -248 12.7626 0.113
NP_442244.1_7 Forward -101 -82 13.2741 0.214
NP_440163.1_10 Forward -259 -249 11.3864 0.169
NP_440344.1_10 Reverse -172 -189 -10.4826 0.182
NP_440344.1_10 Reverse -383 -400 -13.6292 0.29
NP_440282.1_2 Forward -389 -370 8.16093 0.258
NP_440531.1_8 Reverse -323 -342 2.45773 0.298
NP_440562.1_3 Forward -388 -371 2.69378 0.268
NP_441965.1_3 Forward -266 -247 1.27776 0.223
NP_441965.1_10 Reverse -211 -227 3.79511 0.253
NP_440297.1_9 Reverse -248 -258 -0.511621 0.289
NP_442187.1_3 Forward -257 -247 15.6147 0.105
NP_442280.1_10 Reverse -304 -322 14.0257 0.13
NP_440894.1_2 Forward -301 -282 4.81767 0.172
NP_440894.1_10 Reverse -242 -261 16.1257 0.0772
NP_440894.1_10 Forward -394 -375 3.34271 0.274
NP_440999.1_2 Forward -316 -297 14.4541 0.164
NP_440999.1_5 Forward -315 -296 5.2102 0.291
NP_440999.1_9 Reverse -243 -257 1.96621 0.156
NP_440888.1_2 Reverse -247 -261 14.1586 0.02
NP_440803.1_3 Reverse -82 -101 5.70265 0.23
NP_440822.1_1 Forward -342 -323 17.3386 0.13
NP_440491.1_1 Forward -259 -240 15.6882 0.0804
NP_442033.1_10 Reverse -245 -264 -11.8003 0.258
NP_441543.1_2 Reverse -248 -257 7.07956 0.131
NP_442845.1_2 Forward -262 -248 5.01447 0.247
NP_440739.1_3 Forward -253 -234 17.994 0.0474
NP_441469.1_8 Reverse -246 -255 5.60459 0.258
NP_442337.1_8 Forward -99 -80 -1.27885 0.28
NP_442578.1_7 Forward -255 -248 6.0373 0.18
NP_441462.1_2 Forward -256 -246 7.55152 0.0543
NP_443062.1_1 Reverse -247 -265 16.639 0.0304
NP_443062.1_6 Forward -394 -375 2.55606 0.253
NP_440519.1_8 Reverse -267 -283 6.15506 0.21
NP_442204.1_1 Forward -260 -249 0.353664 0.281
NP_442204.1_5 Forward -230 -211 1.57275 0.232
NP_441351.1_8 Forward -310 -291 7.66927 0.192
NP_440255.1_5 Reverse -149 -163 17.2002 0.211
NP_440516.1_8 Forward -256 -247 18.9776 0.00442
NP_440516.1_8 Reverse -247 -256 5.01461 0.118
NP_442428.1_5 Forward -255 -248 6.13563 0.209
NP_442428.1_5 Reverse -248 -255 6.0373 0.212
NP_442428.1_8 Reverse -210 -229 -1.67217 0.289
NP_441835.1_3 Forward -399 -385 15.9292 0.283
NP_441867.1_2 Reverse -217 -236 -7.27704 0.189
NP_440673.1_3 Reverse -249 -256 12.4288 0.0426
NP_440673.1_3 Reverse -169 -176 6.3323 0.283
NP_440865.1_9 Reverse -264 -283 -8.45701 0.264
NP_441052.1_2 Reverse -247 -257 10.6981 0.0285
NP_441052.1_2 Reverse -179 -189 2.43831 0.204
NP_442219.1_8 Forward -312 -293 10.293 0.209
NP_442219.1_8 Forward -60 -41 6.42771 0.298
NP_442219.1_9 Reverse -248 -257 7.96454 0.0696
NP_440436.1_4 Reverse -248 -257 7.57079 0.124
NP_440648.1_1 Forward -256 -237 2.55606 0.292
NP_441719.1_4 Forward -255 -248 6.82395 0.0855
NP_441719.1_4 Reverse -248 -255 6.52896 0.188
NP_441733.1_10 Forward -259 -246 10.639 0.106
NP_441004.1_1 Reverse -287 -306 0.196116 0.117
NP_441004.1_1 Reverse -322 -341 -16.9135 0.287
NP_441004.1_1 Reverse -79 -98 -17.8968 0.295
NP_441004.1_4 Reverse -325 -335 10.1081 0.254
NP_442813.1_4 Reverse -319 -338 -0.983855 0.236
NP_442366.1_3 Forward -228 -210 2.96908 0.118
NP_442366.1_3 Reverse -182 -200 -5.29072 0.286
NP_441034.1_2 Reverse -156 -175 15.5901 0.237
NP_442694.1_4 Reverse -326 -335 16.126 0.164
NP_442206.1_10 Reverse -247 -262 -0.413427 0.292
NP_443054.1_2 Forward -216 -202 9.73436 0.0876
NP_441851.1_10 Forward -182 -172 6.17489 0.182
NP_442011.1_1 Forward -257 -238 -2.85214 0.283
NP_442515.1_1 Forward -257 -243 -3.04867 0.285
NP_441396.1_5 Forward -187 -178 9.24284 0.21
NP_441683.1_5 Forward -391 -372 10.5209 0.202
NP_441349.1_10 Forward -266 -247 -9.44032 0.292
NP_442843.1_1 Reverse -219 -238 1.86774 0.165
NP_441477.1_5 Reverse -359 -378 6.19431 0.291
NP_441031.1_1 Forward -58 -39 9.61851 0.212
NP_440195.1_4 Forward -268 -249 3.93269 0.297
NP_441570.1_1 Reverse -247 -265 0.117479 0.0414
NP_441078.1_4 Forward -256 -247 0.196389 0.205
NP_441078.1_4 Reverse -247 -256 -0.000272808 0.205
NP_442348.1_2 Reverse -292 -301 13.4711 0.191
NP_442348.1_2 Reverse -291 -300 7.17789 0.285
NP_442348.1_2 Reverse -31 -40 7.17789 0.285
NP_442443.1_1 Reverse -336 -355 0.0977854 0.219
NP_440526.1_3 Reverse -248 -259 0.54986 0.275
NP_441432.1_8 Forward -257 -248 14.0611 0.0258
NP_442320.1_8 Forward -262 -248 2.2612 0.0779
NP_441732.1_2 Forward -327 -311 -8.2996 0.131
NP_442003.1_9 Forward -255 -236 6.29264 0.235
NP_440760.1_1 Forward -256 -237 -22.2233 0.252
NP_440199.1_10 Forward -259 -249 16.7946 0.0381
NP_441945.1_10 Reverse -286 -305 10.9142 0.238
NP_442968.1_8 Reverse -277 -296 11.1109 0.299
NP_442751.1_2 Forward -283 -264 17.4032 0.0881
NP_442489.1_2 Forward -328 -309 0.58944 0.297
NP_442489.1_7 Forward -256 -247 0.688044 0.152
NP_442489.1_7 Reverse -247 -256 0.688044 0.152
NP_441830.1_2 Reverse -273 -292 -3.3438 0.275
NP_442079.1_6 Forward -222 -203 13.8641 0.273
NP_440559.1_1 Reverse -248 -257 7.76787 0.0918
NP_441659.2_8 Reverse -247 -257 5.48657 0.106
NP_442749.1_5 Forward -39 -22 6.58478 0.298
NP_440860.1_8 Reverse -245 -264 12.9791 0.296
NP_441040.1_2 Reverse -230 -249 -16.0285 0.292
NP_441800.1_3 Reverse -206 -224 4.34571 0.289
NP_440545.1_5 Reverse -322 -339 6.33202 0.219
NP_440025.1_5 Forward -266 -247 18.1907 0.151
NP_440459.1_2 Forward -258 -241 9.57695 0.224
NP_440459.1_2 Forward -338 -321 8.29864 0.266
NP_442603.1_7 Forward -256 -242 10.0287 0.134
NP_442603.1_7 Reverse -247 -261 5.60385 0.284
NP_441833.1_4 Reverse -248 -255 6.52896 0.0924
NP_441833.1_4 Forward -255 -248 6.23397 0.163
NP_441329.1_6 Reverse -141 -160 -2.14899 0.293
NP_442699.1_8 Reverse -332 -351 -11.1119 0.238
NP_442162.1_9 Forward -255 -248 12.9205 0.0282
NP_442162.1_9 Reverse -248 -255 12.9205 0.0282
NP_442796.1_2 Forward -340 -321 17.9599 0.177
NP_440671.1_4 Forward -262 -248 17.0108 0.0246
NP_442140.1_3 Forward -255 -245 10.0098 0.0949
NP_442140.1_3 Forward -226 -216 8.53483 0.119
NP_441813.1_5 Reverse -245 -255 6.8632 0.0784
NP_441813.1_5 Forward -258 -248 6.17489 0.1
NP_440590.1_4 Forward -255 -242 0.314277 0.16
NP_440590.1_4 Reverse -248 -261 -4.30728 0.26
NP_440567.1_1 Forward -255 -241 6.78443 0.0803
NP_442497.1_10 Reverse -248 -257 0.589713 0.153
NP_440821.1_4 Forward -258 -248 8.53483 0.0468
NP_440821.1_4 Reverse -245 -255 6.56821 0.0853
NP_441239.1_9 Reverse -245 -257 14.4936 0.0272
NP_440665.1_2 Reverse -76 -95 -4.72043 0.246
NP_442669.1_1 Forward -178 -159 2.85105 0.175
NP_442193.1_1 Reverse -326 -344 7.98396 0.277
NP_442629.1_3 Reverse -210 -229 5.70265 0.272
NP_440833.1_6 Forward -303 -289 9.34041 0.264
NP_442216.1_4 Forward -299 -291 8.08217 0.255
NP_440876.1_5 Reverse -249 -268 5.80098 0.283
NP_440949.1_7 Reverse -239 -258 8.4551 0.284
NP_440546.1_4 Forward -256 -246 14.0213 0.0459
NP_441656.1_6 Reverse -182 -201 6.78429 0.252
NP_440462.1_6 Reverse -245 -255 14.0414 0.0235
NP_440868.1_4 Reverse -243 -255 3.87389 0.131
NP_441249.1_8 Reverse -281 -300 3.44104 0.276
NP_442479.1_9 Reverse -156 -175 -6.88371 0.266
NP_442402.1_1 Forward -297 -278 10.1275 0.254
NP_442402.1_4 Reverse -251 -270 -7.47443 0.276
NP_442402.1_6 Reverse -288 -297 13.2744 0.289
NP_441848.1_7 Forward -153 -134 -1.57461 0.253
NP_439942.1_5 Reverse -14 -28 18.4416 0.173
NP_442039.1_4 Forward -255 -248 11.6422 0.0747
NP_442039.1_4 Reverse -239 -246 8.39725 0.202
NP_442039.1_7 Reverse -220 -230 11.1898 0.257
NP_441811.1_1 Reverse -238 -257 7.57094 0.28
NP_442837.1_3 Forward -255 -248 6.0373 0.25
NP_442837.1_3 Reverse -248 -255 6.0373 0.25
NP_442053.1_1 Reverse -247 -256 14.4544 0.0114
NP_442053.1_1 Forward -256 -247 7.86621 0.0863
NP_440505.1_3 Forward -258 -248 14.7297 0.0176
NP_441102.1_2 Reverse -23 -42 12.8808 0.159
NP_442532.1_7 Forward -256 -242 5.01447 0.171
NP_441408.2_7 Forward -331 -312 3.14605 0.199
NP_441408.2_7 Forward -325 -306 -3.24547 0.272
NP_440914.1_1 Reverse -247 -257 13.1043 0.0386
NP_440914.1_1 Forward -262 -252 10.3717 0.142
NP_441011.1_8 Forward -255 -246 11.7994 0.0629
NP_440037.1_2 Forward -132 -113 15.6341 0.186
NP_442533.1_6 Reverse -247 -256 4.42462 0.179
NP_440661.1_6 Reverse -60 -79 1.86774 0.279
NP_441482.1_7 Forward -262 -248 -1.37704 0.0683
NP_439944.1_9 Reverse -248 -258 9.22315 0.1
NP_440115.1_6 Forward -179 -169 7.15819 0.158
NP_440007.1_9 Forward -260 -246 7.57108 0.203
NP_442728.1_7 Forward -336 -322 12.4876 0.289
NP_440903.1_1 Reverse -147 -157 18.2696 0.14
NP_441170.1_3 Forward -83 -64 13.7658 0.0632
NP_442890.1_9 Forward -264 -245 11.2092 0.295
NP_441972.1_5 Forward -104 -85 -1.47551 0.177
NP_441106.1_3 Forward -56 -37 12.3892 0.217
NP_439903.1_6 Reverse -244 -263 -0.197979 0.277
NP_441286.1_1 Forward -257 -245 4.36554 0.0342
NP_441286.1_1 Reverse -237 -249 -6.15587 0.251
NP_440670.1_8 Forward -256 -247 8.75118 0.0606
NP_440670.1_8 Reverse -247 -256 6.19458 0.124
NP_440886.1_7 Reverse -246 -256 16.4991 0.0104
NP_440886.1_7 Reverse -178 -188 3.91283 0.26
NP_441399.1_6 Reverse -66 -85 13.3716 0.185
NP_442072.1_9 Forward -257 -239 -13.3539 0.11
NP_442213.1_5 Reverse -327 -346 9.3409 0.14
NP_442773.2_1 Reverse -229 -248 13.3725 0.248
NP_442022.1_4 Reverse -326 -345 8.35759 0.268
NP_442842.1_4 Reverse -315 -334 1.37609 0.29
NP_441626.1_2 Forward -255 -248 12.2322 0.0511
NP_441626.1_2 Reverse -248 -255 5.93897 0.231
NP_442211.1_3 Forward -220 -201 9.51453 0.257
NP_442794.1_6 Forward -340 -326 12.4876 0.298
NP_441962.1_4 Forward -261 -242 -14.3569 0.286
NP_441962.1_5 Reverse -174 -193 19.9606 0.113
NP_441962.1_9 Forward -226 -207 7.86593 0.258
NP_441962.1_9 Reverse -375 -394 6.58763 0.258
NP_441742.1_7 Forward -282 -263 12.3892 0.29
NP_440387.1_1 Forward -256 -240 -3.38305 0.158
NP_440387.1_1 Reverse -247 -263 -6.43131 0.285
NP_441993.1_1 Reverse -293 -312 3.60346 0.231
NP_441993.1_1 Reverse -321 -340 1.94669 0.267
NP_441993.1_1 Reverse -327 -346 0.777198 0.292
NP_440114.1_10 Forward -256 -242 8.45605 0.202
NP_441425.1_3 Reverse -23 -33 16.4996 0.273
NP_442323.1_7 Forward -99 -80 8.25844 0.163
NP_441510.2_7 Forward -262 -248 16.7152 0.226
NP_440287.1_7 Forward -334 -315 17.109 0.292
NP_440293.1_3 Reverse -326 -345 -6.78538 0.293
NP_440293.1_9 Reverse -233 -247 19.6548 0.0935
NP_440766.1_4 Forward -260 -246 21.9274 0.0197
NP_440766.1_5 Reverse -150 -162 6.50989 0.299
NP_441979.1_5 Reverse -241 -260 -11.9969 0.228
NP_442743.1_4 Reverse -378 -397 1.37609 0.174
NP_440457.1_1 Forward -260 -248 9.28209 0.0929
NP_440801.1_8 Reverse -217 -236 0.58944 0.253
NP_440801.1_10 Forward -260 -241 16.2241 0.126
NP_441984.1_6 Forward -254 -242 15.4769 0.219
NP_441436.1_6 Forward -195 -176 6.58763 0.285
NP_442509.1_9 Forward -256 -246 11.9759 0.107
YP_003858595.1_7 Reverse -141 -159 11.5239 0.151
NP_440554.1_4 Reverse -248 -258 4.10993 0.201
NP_441885.1_5 Reverse -247 -257 1.25834 0.11
NP_441885.1_5 Forward -256 -246 0.0783647 0.183
NP_442341.1_5 Forward -251 -232 13.5691 0.218
NP_442341.1_7 Reverse -246 -260 8.25939 0.0898
NP_442341.1_7 Forward -257 -243 4.42448 0.191
NP_442341.1_7 Forward -390 -376 3.73617 0.214
NP_441173.1_9 Reverse -37 -45 11.8187 0.222
NP_440423.1_6 Forward -264 -245 -12.7836 0.2
NP_443000.1_7 Forward -258 -248 7.35486 0.0859
NP_443059.1_10 Forward -270 -251 8.4551 0.194
NP_440275.1_3 Forward -258 -248 5.5849 0.14
NP_442932.1_9 Reverse -221 -240 5.11266 0.27
NP_440091.1_1 Forward -260 -248 -0.846001 0.293
NP_440149.1_8 Reverse -247 -266 -7.4737 0.285
NP_440216.1_1 Forward -256 -242 -12.1934 0.247
NP_440216.1_9 Forward -327 -318 5.99792 0.289
NP_440172.1_1 Reverse -247 -257 2.24165 0.279
NP_442015.1_10 Forward -393 -380 2.96921 0.187
NP_441226.1_7 Forward -255 -248 12.7234 0.0312
NP_441226.1_7 Reverse -248 -255 11.5435 0.0757
NP_441111.1_7 Reverse -248 -256 8.86921 0.0589
NP_441766.1_2 Reverse -247 -256 14.7494 0.00772
NP_441766.1_8 Reverse -66 -85 21.7125 0.0544
NP_440416.1_9 Reverse -232 -251 -20.4534 0.285
NP_441940.1_1 Forward -345 -326 10.4217 0.227
NP_442154.1_1 Reverse -326 -344 -17.1888 0.249
NP_440261.1_5 Reverse -239 -252 -10.6005 0.201
NP_440261.1_5 Forward -255 -242 -10.9938 0.23
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGAATCCTGGCCGATAATCACTGGTCCAGCAGTATCAGTTTGTTCCCGTAATACCTGCCCCGCCCAAAAGCCCAAGGATAAAGCCAAAGGAGCCGTCAACAATTCCCCAGCCTTACCCCGGATACCGTCCGTGCCAAACAATGGCGATCGGGGCAAGCTCAAGCCGAATTCTCCCATCGTTGACGGCAAAGGCAGATCTAAACCACGACTGTGGATGGGGGAAGCAACCATCTGAAAATTTTCCTCACACAATTCTTCCTCTCAGGATAACTGCTCCGGGAAATTTCAGGTAAATCACGCCCCACTGGATTGCCTCAGGGGTTGAACGTCCGCTACCCTTAGAACTGTGACGATTTGTAAAAATCCGCCCAATTTTTAAATTCTGATTCCGGCGAAAT

CDS

ATGCCCCATACCATTGTTACGGAAACCTGCGAAGGCGTGGCCGACTGCGTTGAAGCCTGCCCCGTAGCCTGCATTCACCCCGGAGACGGGAAAAACACCATTGGCACCGATTGGTACTGGATTGACTTTGCCACCTGCATCGATTGCGGCATCTGCCTCCAAGTTTGCCCGGTGGAAGGGGCCATTCTGCCGGAGGAACGGCCTGATTTACAGAAAAGCCCTGCCTAG

Protein

MPHTIVTETCEGVADCVEACPVACIHPGDGKNTIGTDWYWIDFATCIDCGICLQVCPVEGAILPEERPDLQKSPA