Your browser is old and dusty. Try Google Chrome!

Details for ssr3122

ORF ssr3122
Accession NP_440397.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -190 -176 11.111 0.253
NP_440557.1_1 Forward -45 -26 0.196116 0.265
NP_441418.1_6 Reverse -287 -306 -12.2919 0.0631
NP_441418.1_6 Forward -203 -184 -21.6334 0.156
NP_443032.1_8 Forward -31 -12 0.687771 0.238
NP_440897.1_6 Forward -296 -277 -0.29631 0.182
NP_441453.1_1 Reverse -379 -397 3.75497 0.263
NP_441453.1_4 Forward -296 -288 7.09925 0.0962
NP_441453.1_4 Reverse -287 -295 6.80426 0.121
NP_441453.1_4 Forward -395 -387 6.80426 0.121
NP_441453.1_4 Reverse -386 -394 6.11594 0.121
NP_442151.1_6 Forward -395 -381 10.6193 0.119
NP_442151.1_6 Reverse -287 -301 6.3911 0.236
NP_441818.1_1 Reverse -387 -398 14.8078 0.0426
NP_441630.1_3 Reverse -279 -298 -0.197208 0.285
NP_442623.1_1 Forward -395 -376 -17.6018 0.282
NP_442173.1_1 Reverse -387 -395 12.0158 0.0316
NP_442173.1_1 Reverse -288 -296 5.82095 0.2
NP_442173.1_1 Forward -295 -287 5.72262 0.203
NP_442173.1_1 Forward -394 -386 4.83764 0.241
NP_442752.1_4 Forward -395 -388 13.8055 0.0199
NP_442752.1_4 Reverse -287 -294 13.8055 0.0199
NP_443027.1_4 Reverse -285 -295 7.25653 0.24
NP_439997.1_6 Forward -30 -11 10.7175 0.212
NP_442975.1_10 Forward -300 -286 3.14559 0.263
NP_442975.1_10 Reverse -341 -355 1.86729 0.29
NP_440784.1_7 Forward -394 -387 6.23397 0.241
NP_440784.1_7 Reverse -288 -295 6.23397 0.241
NP_440784.1_7 Reverse -387 -394 6.13563 0.241
NP_440784.1_7 Forward -295 -288 6.13563 0.241
NP_440061.1_3 Forward -35 -16 8.45592 0.278
NP_440061.1_9 Reverse -133 -147 5.89884 0.266
NP_442062.1_4 Forward -317 -298 16.2241 0.235
NP_442062.1_8 Reverse -287 -297 15.2213 0.00881
NP_442062.1_8 Forward -296 -286 7.55152 0.0946
NP_441859.1_3 Reverse -286 -305 14.8466 0.0704
NP_441802.1_1 Reverse -16 -35 7.86593 0.233
NP_440304.1_4 Forward -298 -288 8.1415 0.0859
NP_442242.1_4 Forward -295 -288 10.8555 0.127
NP_441208.1_9 Reverse -98 -112 8.06273 0.219
NP_441208.1_9 Forward -193 -179 6.88276 0.229
NP_441594.1_6 Forward -305 -286 4.22769 0.222
NP_442196.1_10 Forward -313 -294 13.8641 0.181
NP_442110.1_2 Forward -200 -187 16.2587 0.166
NP_442110.1_7 Forward -203 -189 2.94952 0.221
NP_442110.1_7 Forward -296 -282 0.786239 0.248
NP_442110.1_7 Reverse -287 -301 0.294584 0.264
NP_441925.1_4 Reverse -181 -200 -14.9476 0.263
NP_441925.1_4 Reverse -77 -96 -17.2092 0.29
NP_441083.1_5 Reverse -386 -396 17.7779 0.00336
NP_441083.1_5 Forward -296 -286 10.9931 0.017
NP_441083.1_5 Reverse -287 -297 9.81313 0.0224
NP_441083.1_5 Forward -395 -385 7.05986 0.067
NP_442827.1_8 Forward -304 -285 -2.8529 0.29
NP_441434.1_7 Reverse -289 -303 15.2409 0.0961
NP_441738.1_2 Reverse -388 -395 15.28 0.0102
NP_441738.1_2 Forward -294 -287 15.28 0.0102
NP_441738.1_2 Forward -205 -198 8.1019 0.204
NP_441558.1_5 Reverse -285 -304 9.24257 0.126
NP_441558.1_5 Forward -298 -279 4.32602 0.283
NP_440209.1_1 Forward -296 -288 14.8674 0.012
NP_440209.1_1 Forward -395 -387 8.57422 0.0425
NP_440209.1_1 Reverse -287 -295 8.57422 0.0425
NP_440209.1_1 Reverse -386 -394 5.52596 0.0821
NP_442765.1_1 Forward -201 -182 10.3242 0.214
NP_442889.1_8 Reverse -383 -397 4.52221 0.263
NP_441713.1_1 Reverse -380 -399 5.50599 0.0568
NP_440178.1_7 Reverse -107 -126 -22.125 0.255
NP_442570.1_3 Reverse -316 -335 -6.98204 0.265
NP_441716.1_1 Forward -296 -282 7.66941 0.163
NP_441716.1_1 Reverse -386 -400 5.89945 0.211
NP_441716.1_2 Forward -215 -196 4.88691 0.229
NP_442111.1_4 Reverse -286 -300 11.8976 0.0469
NP_442111.1_4 Reverse -385 -399 5.60446 0.158
NP_442111.1_4 Forward -297 -283 2.65453 0.268
NP_441533.1_7 Reverse -83 -101 14.2763 0.282
NP_440851.1_6 Reverse -314 -331 1.31714 0.288
NP_440906.1_5 Forward -394 -387 6.23397 0.234
NP_440906.1_5 Reverse -288 -295 6.23397 0.234
NP_440906.1_5 Reverse -387 -394 6.13563 0.241
NP_440906.1_5 Forward -295 -288 6.13563 0.241
NP_440747.1_1 Reverse -179 -197 14.9655 0.183
NP_440747.1_10 Reverse -284 -296 16.8536 0.00143
NP_440747.1_10 Forward -299 -287 -11.7607 0.142
NP_440747.1_10 Forward -398 -386 -11.9574 0.178
NP_441130.1_10 Reverse -384 -398 6.19444 0.197
NP_441130.1_10 Reverse -285 -299 5.89945 0.211
NP_441486.1_1 Forward -398 -384 -3.34366 0.178
NP_442634.1_2 Forward -150 -131 6.58763 0.205
NP_442634.1_4 Forward -298 -284 -4.81863 0.22
NP_440403.1_4 Forward -305 -286 -6.88371 0.236
NP_440842.1_10 Forward -396 -382 3.93283 0.254
NP_440842.1_10 Reverse -383 -397 2.16287 0.277
NP_441014.1_8 Reverse -132 -151 -7.96535 0.282
NP_441014.1_10 Reverse -368 -387 -0.0996487 0.246
NP_442848.1_1 Forward -302 -288 4.81781 0.095
NP_443018.1_3 Reverse -288 -295 12.6255 0.0471
NP_443018.1_3 Reverse -387 -394 11.7405 0.0655
NP_443018.1_3 Reverse -132 -139 9.38056 0.128
NP_443018.1_3 Forward -394 -387 5.44732 0.193
NP_443018.1_3 Forward -295 -288 5.25066 0.214
NP_441634.1_8 Reverse -285 -299 11.8976 0.0529
NP_441634.1_8 Forward -199 -185 1.86788 0.178
NP_440376.1_1 Reverse -287 -296 9.83282 0.0339
NP_440376.1_1 Forward -296 -287 9.63616 0.0385
NP_440376.1_1 Forward -395 -386 5.99792 0.111
NP_440376.1_1 Reverse -386 -395 -0.196935 0.285
NP_440266.1_6 Reverse -170 -189 6.88182 0.27
NP_442687.1_7 Forward -297 -287 8.73149 0.101
NP_442687.1_7 Reverse -385 -395 5.97822 0.179
NP_442958.1_5 Reverse -345 -364 22.3197 0.0996
NP_440642.1_10 Forward -29 -15 6.19383 0.237
NP_440642.1_10 Reverse -323 -337 2.35894 0.277
NP_440042.1_2 Reverse -376 -395 1.76941 0.201
NP_440571.1_6 Forward -176 -157 9.7875 0.296
NP_441950.1_7 Forward -90 -71 0.982764 0.175
NP_442658.1_1 Forward -298 -288 8.04271 0.199
NP_442658.1_1 Reverse -384 -394 5.87944 0.246
NP_442161.1_7 Forward -37 -18 22.3206 0.00773
NP_440141.1_8 Forward -305 -286 4.32602 0.291
NP_441855.2_4 Forward -116 -97 9.33025 0.282
NP_441414.1_9 Forward -395 -376 3.53937 0.0582
NP_439959.1_6 Forward -156 -137 6.09597 0.274
NP_442937.1_5 Forward -280 -261 11.7992 0.13
NP_442321.1_4 Forward -119 -100 -9.34199 0.298
NP_441958.1_5 Forward -297 -287 10.6981 0.0112
NP_441958.1_5 Reverse -286 -296 2.83163 0.0372
NP_441958.1_5 Reverse -385 -395 0.865012 0.12
NP_441958.1_5 Forward -396 -386 0.865012 0.12
NP_441127.1_1 Forward -395 -381 10.816 0.242
NP_440203.1_5 Reverse -389 -399 11.1893 0.202
NP_439905.1_1 Forward -311 -298 9.55739 0.216
NP_443001.1_4 Forward -364 -345 17.699 0.0808
NP_443001.1_7 Reverse -12 -31 3.14605 0.279
NP_439990.1_5 Reverse -282 -295 10.7374 0.128
NP_442376.1_2 Forward -301 -282 -3.04881 0.202
NP_442690.1_1 Reverse -112 -131 -17.1101 0.297
NP_442911.1_2 Reverse -376 -395 -3.3438 0.111
NP_441580.1_6 Forward -307 -288 -0.0988766 0.153
NP_442064.1_1 Reverse -381 -400 -12.5869 0.277
NP_443055.1_6 Reverse -273 -291 6.90155 0.164
NP_443055.1_6 Forward -304 -286 0.805058 0.239
NP_440993.1_2 Reverse -282 -298 3.69678 0.256
NP_440993.1_3 Reverse -277 -296 5.70185 0.149
NP_440827.1_3 Forward -301 -282 15.2408 0.179
NP_441099.1_5 Reverse -376 -395 -6.58872 0.163
NP_441099.1_5 Reverse -277 -296 -10.817 0.262
NP_441099.1_5 Forward -306 -287 -11.8986 0.291
NP_441654.1_6 Forward -260 -242 15.1852 0.229
NP_442438.1_10 Reverse -282 -296 0.491246 0.225
NP_442438.1_10 Forward -301 -287 -0.393733 0.259
NP_441000.1_6 Reverse -385 -399 3.44117 0.111
NP_441110.1_10 Reverse -123 -142 12.7825 0.219
NP_440147.1_4 Reverse -285 -298 9.06573 0.0437
NP_440147.1_4 Forward -298 -285 1.78924 0.22
NP_440147.1_4 Forward -397 -384 0.707601 0.247
NP_441550.1_8 Reverse -384 -394 15.2208 0.0132
NP_441550.1_8 Forward -397 -387 11.091 0.0555
NP_441550.1_8 Forward -298 -288 10.5993 0.066
NP_441550.1_8 Reverse -285 -295 5.87944 0.224
NP_441916.1_7 Reverse -287 -297 7.15819 0.0745
NP_441916.1_7 Forward -296 -286 7.05986 0.0779
NP_441041.1_4 Reverse -287 -306 -12.6852 0.272
NP_441041.1_7 Forward -299 -287 12.1793 0.0682
NP_440569.1_7 Reverse -181 -200 8.65258 0.286
NP_442004.1_6 Reverse -386 -400 3.04785 0.251
NP_441725.1_5 Reverse -288 -298 9.02648 0.0553
NP_441725.1_5 Forward -394 -384 7.05986 0.106
NP_441725.1_5 Reverse -387 -397 1.455 0.135
NP_439966.1_7 Reverse -384 -394 7.84605 0.149
NP_439966.1_7 Forward -397 -387 6.0761 0.195
NP_439966.1_7 Forward -298 -288 5.87944 0.204
NP_439966.1_7 Reverse -285 -295 5.58445 0.216
NP_442941.1_3 Reverse -387 -397 10.1081 0.024
NP_442941.1_3 Forward -295 -285 9.41981 0.0319
NP_440289.1_2 Forward -299 -286 11.1307 0.0212
NP_440289.1_2 Reverse -383 -396 1.19926 0.135
NP_440289.1_2 Reverse -284 -297 -3.81562 0.271
NP_440289.1_2 Forward -398 -385 -4.30728 0.286
NP_440983.1_5 Reverse -138 -157 0.982764 0.214
NP_440983.1_5 Reverse -181 -200 -2.55715 0.231
NP_440260.1_8 Reverse -315 -333 -5.88071 0.279
NP_442281.1_1 Reverse -282 -296 12.2903 0.0385
NP_442281.1_1 Forward -301 -287 7.57046 0.0969
NP_442281.1_1 Forward -383 -369 3.44058 0.231
NP_442281.1_1 Reverse -126 -140 2.75226 0.257
NP_441334.1_7 Forward -205 -186 -14.3569 0.26
NP_441334.1_7 Forward -298 -279 -21.3384 0.296
NP_442012.1_1 Reverse -281 -300 5.11266 0.154
NP_442012.1_1 Reverse -175 -194 2.45773 0.2
NP_441087.1_5 Reverse -174 -193 3.14526 0.187
NP_442288.1_3 Reverse -318 -335 7.512 0.257
NP_441644.1_6 Reverse -386 -396 14.4342 0.0126
NP_441644.1_6 Forward -296 -286 8.43603 0.0998
NP_441644.1_6 Reverse -287 -297 6.0761 0.167
NP_443049.1_6 Forward -396 -386 14.4711 0.114
NP_442215.1_2 Forward -36 -20 -4.56302 0.235
NP_442215.1_2 Forward -298 -282 -4.85801 0.24
NP_442215.1_2 Forward -149 -133 -4.85801 0.24
NP_440929.1_8 Forward -296 -287 9.63616 0.0262
NP_440929.1_8 Reverse -287 -296 9.53783 0.0296
NP_440929.1_8 Reverse -386 -395 7.07956 0.0713
NP_442933.1_10 Forward -296 -287 15.1427 0.00958
NP_442933.1_10 Reverse -287 -296 7.96454 0.0937
NP_441751.2_8 Forward -295 -281 -4.4253 0.173
NP_442554.1_8 Reverse -288 -298 7.55152 0.0893
NP_442554.1_8 Forward -295 -285 6.37155 0.12
NP_442554.1_8 Forward -139 -129 6.37155 0.12
NP_442554.1_8 Reverse -387 -397 6.07655 0.126
NP_442554.1_8 Forward -394 -384 5.09324 0.161
NP_442167.1_6 Reverse -382 -398 12.3492 0.229
NP_441762.1_7 Forward -396 -384 -5.07423 0.187
NP_441762.1_7 Reverse -286 -298 -7.13918 0.285
NP_442142.1_4 Forward -299 -286 3.36198 0.258
NP_442142.1_4 Reverse -284 -297 2.772 0.278
NP_442292.1_1 Reverse -387 -396 8.65285 0.0335
NP_442292.1_1 Forward -295 -286 8.65285 0.0335
NP_442292.1_1 Reverse -288 -297 -0.196935 0.239
NP_440919.1_1 Reverse -297 -316 -5.01543 0.244
NP_442476.1_6 Forward -295 -281 1.47456 0.214
NP_440895.1_6 Reverse -281 -294 9.45906 0.22
NP_443009.1_5 Reverse -286 -297 6.05637 0.177
NP_443009.1_5 Forward -328 -317 5.85971 0.185
NP_442301.1_2 Reverse -173 -192 4.71854 0.274
NP_440397.1_10 Forward -36 -17 21.828 0.0245
NP_441715.1_4 Forward -295 -285 7.55152 0.108
NP_441715.1_4 Reverse -387 -397 4.99491 0.24
NP_440357.1_3 Reverse -300 -319 0.0977854 0.285
NP_440183.1_9 Forward -310 -291 -19.7651 0.282
NP_441468.1_1 Forward -394 -387 6.13563 0.209
NP_441468.1_1 Reverse -288 -295 6.13563 0.209
NP_441468.1_1 Reverse -387 -394 6.0373 0.223
NP_441468.1_1 Forward -295 -288 6.0373 0.223
NP_441020.2_6 Reverse -285 -302 6.33202 0.267
NP_441020.2_7 Reverse -181 -200 8.55343 0.26
NP_441015.1_10 Forward -301 -282 -2.0655 0.178
NP_441015.1_10 Forward -202 -183 -7.76869 0.271
NP_441673.1_1 Reverse -287 -296 11.1111 0.0121
NP_441673.1_1 Forward -296 -287 11.0128 0.018
NP_441673.1_1 Forward -395 -386 1.37636 0.114
NP_441673.1_1 Reverse -386 -395 1.1797 0.163
NP_441876.1_9 Reverse -278 -288 11.2876 0.278
NP_441876.1_9 Reverse -347 -357 10.8943 0.284
NP_441172.1_8 Forward -330 -316 18.3875 0.151
NP_441826.1_2 Forward -302 -288 3.14618 0.115
NP_441826.1_2 Reverse -281 -295 -2.75368 0.275
NP_442868.1_6 Reverse -285 -295 9.51814 0.0447
NP_442868.1_6 Forward -298 -288 6.96153 0.0919
NP_442868.1_6 Reverse -384 -394 6.66654 0.103
NP_442868.1_6 Forward -397 -387 0.176696 0.247
NP_442719.1_2 Reverse -266 -284 -7.15971 0.232
NP_442361.1_3 Reverse -188 -201 8.67241 0.285
NP_442427.1_8 Reverse -377 -396 9.24257 0.186
NP_442808.1_1 Reverse -385 -395 9.71433 0.0481
NP_442808.1_1 Forward -297 -287 7.45273 0.0783
NP_442718.1_2 Forward -311 -292 -6.58872 0.295
NP_442542.1_2 Reverse -384 -397 15.9489 0.0762
NP_442542.1_2 Forward -298 -285 11.1307 0.114
NP_442050.1_5 Reverse -384 -394 11.7793 0.0832
NP_442050.1_5 Forward -298 -288 10.8943 0.126
NP_442050.1_5 Forward -209 -199 8.43603 0.234
NP_442050.1_5 Forward -397 -387 6.76441 0.282
NP_440558.1_2 Forward -321 -302 0.884433 0.185
NP_440558.1_2 Reverse -299 -318 -2.36049 0.226
NP_440111.2_2 Forward -307 -288 -0.197208 0.215
NP_441878.1_6 Forward -297 -287 10.4031 0.0176
NP_441878.1_6 Reverse -286 -296 0.668351 0.139
NP_441878.1_6 Reverse -385 -395 0.57002 0.14
NP_441878.1_6 Forward -191 -181 -7.19813 0.21
NP_441036.1_8 Reverse -286 -296 7.25653 0.203
NP_441557.1_5 Reverse -287 -296 10.2261 0.0144
NP_441557.1_5 Forward -296 -287 10.1278 0.0188
NP_441557.1_5 Forward -395 -386 1.08137 0.0794
NP_441557.1_5 Reverse -386 -395 0.589713 0.134
NP_441445.1_1 Forward -196 -177 3.93269 0.204
NP_441445.1_1 Forward -305 -286 -0.4922 0.294
NP_442066.2_9 Reverse -382 -395 9.2624 0.176
NP_441433.1_8 Forward -296 -277 1.76941 0.234
NP_441433.1_8 Forward -365 -346 -1.67217 0.263
NP_441458.1_8 Forward -224 -205 5.07931 0.265
NP_442183.1_1 Reverse -287 -301 13.4709 0.0423
NP_442183.1_1 Forward -395 -381 8.16106 0.121
NP_442183.1_1 Reverse -198 -212 5.1128 0.231
NP_440276.1_8 Forward -30 -11 7.17762 0.274
NP_441549.1_9 Reverse -382 -400 -10.7973 0.288
NP_442347.1_2 Forward -295 -286 12.2911 0.056
NP_442347.1_2 Reverse -387 -396 10.3245 0.058
NP_442645.1_2 Reverse -317 -336 -19.1751 0.285
NP_442888.1_6 Reverse -177 -196 3.14605 0.244
NP_441037.1_4 Forward -298 -288 9.16938 0.231
NP_442594.1_8 Reverse -374 -393 4.42435 0.264
NP_441633.1_3 Reverse -285 -298 12.9006 0.0192
NP_441633.1_3 Forward -397 -384 -6.2739 0.242
NP_440136.1_2 Forward -394 -387 6.23397 0.171
NP_440136.1_2 Reverse -288 -295 6.23397 0.171
NP_440136.1_2 Reverse -387 -394 6.13563 0.193
NP_440136.1_2 Forward -295 -288 6.13563 0.193
NP_442590.1_10 Reverse -284 -303 3.6377 0.289
NP_442590.1_10 Reverse -312 -331 3.53937 0.29
NP_442998.1_10 Reverse -388 -395 15.5754 0.0102
NP_442998.1_10 Forward -294 -287 15.5754 0.0102
NP_442998.1_10 Reverse -289 -296 5.84064 0.235
NP_440299.1_1 Reverse -283 -296 16.4399 0.0101
NP_441799.1_1 Reverse -382 -396 6.58715 0.167
NP_441007.1_10 Forward -301 -288 2.87088 0.183
NP_441007.1_10 Reverse -381 -394 0.0192843 0.254
NP_440256.1_1 Reverse -284 -303 1.76941 0.0717
NP_440456.1_7 Forward -391 -377 9.63603 0.294
NP_441559.1_8 Reverse -314 -328 5.30946 0.0934
NP_441559.1_8 Reverse -282 -296 -6.78525 0.279
NP_440915.1_6 Reverse -283 -297 9.63603 0.0401
NP_440915.1_6 Forward -300 -286 6.09611 0.0862
NP_440915.1_6 Forward -399 -385 -0.492064 0.197
NP_440915.1_6 Forward -144 -130 -3.54032 0.298
NP_442158.1_4 Reverse -367 -377 13.0581 0.239
NP_440717.1_3 Reverse -183 -197 6.98048 0.289
NP_441704.1_8 Reverse -276 -295 7.57013 0.234
NP_440134.1_2 Forward -397 -378 1.27776 0.298
NP_442452.1_8 Reverse -386 -400 19.7634 0.257
NP_442452.1_8 Reverse -281 -295 14.0603 0.273
NP_440748.1_5 Reverse -305 -324 0.0977854 0.252
NP_441464.1_8 Forward -395 -381 5.89945 0.248
NP_441464.1_10 Forward -155 -141 9.93102 0.262
NP_440695.1_5 Reverse -287 -306 -0.885524 0.284
NP_441939.1_3 Reverse -288 -307 5.11266 0.288
NP_442993.1_1 Reverse -357 -373 -11.4462 0.247
NP_442386.1_9 Reverse -385 -394 4.52254 0.297
NP_441340.1_5 Forward -394 -387 13.5105 0.0314
NP_441340.1_5 Reverse -288 -295 6.23397 0.132
NP_441340.1_5 Reverse -387 -394 5.84064 0.208
NP_441340.1_5 Forward -295 -288 5.84064 0.208
NP_440639.1_4 Forward -29 -10 15.7316 0.25
NP_441132.1_3 Reverse -278 -297 5.11266 0.266
NP_439976.1_4 Reverse -185 -204 6.58682 0.278
NP_439976.1_5 Reverse -101 -115 11.2087 0.268
NP_442240.1_1 Reverse -279 -298 5.40686 0.264
NP_442240.1_2 Forward -295 -276 -12.7836 0.163
NP_441027.1_1 Reverse -339 -353 10.9137 0.277
NP_440586.1_1 Forward -194 -175 1.86774 0.231
NP_440586.1_8 Reverse -288 -295 14.69 0.026
NP_440586.1_8 Reverse -387 -394 9.47853 0.146
NP_440586.1_8 Forward -394 -387 5.74197 0.283
NP_442251.1_6 Forward -295 -288 12.0355 0.0627
NP_441262.1_3 Reverse -287 -294 14.7888 0.0223
NP_441262.1_3 Forward -395 -388 14.7888 0.0223
NP_440027.1_3 Reverse -175 -193 3.55831 0.27
NP_443051.1_1 Forward -297 -288 8.25953 0.0414
NP_443051.1_1 Forward -396 -387 7.47288 0.0571
NP_443051.1_1 Reverse -286 -295 0.884706 0.125
NP_443051.1_1 Reverse -385 -394 -1.18024 0.297
NP_442294.1_3 Reverse -373 -387 15.9285 0.17
NP_440408.1_7 Forward -324 -305 9.14423 0.264
NP_440439.1_1 Reverse -284 -297 1.69091 0.147
NP_440439.1_1 Forward -398 -385 1.10092 0.162
NP_440372.1_2 Forward -394 -387 13.8055 0.0214
NP_440372.1_2 Reverse -288 -295 6.82395 0.0854
NP_440372.1_2 Reverse -387 -394 6.52896 0.188
NP_440372.1_2 Forward -295 -288 6.52896 0.188
NP_441803.1_2 Reverse -282 -301 12.5858 0.0594
NP_439977.1_5 Reverse -281 -300 4.32602 0.153
NP_440139.1_1 Forward -146 -127 0.490334 0.291
NP_441572.1_7 Reverse -380 -399 -5.80207 0.273
NP_442384.1_10 Forward -296 -283 11.3273 0.0367
NP_442384.1_10 Reverse -386 -399 5.91914 0.116
NP_442035.1_6 Forward -387 -368 8.25926 0.246
NP_441018.1_7 Forward -201 -182 11.3075 0.188
NP_441018.1_7 Reverse -299 -318 6.98095 0.278
NP_442262.1_10 Reverse -387 -394 13.2155 0.0213
NP_442262.1_10 Reverse -288 -295 12.9205 0.0422
NP_442262.1_10 Reverse -132 -139 9.47889 0.187
NP_441689.1_5 Forward -397 -387 12.7626 0.113
NP_440344.1_10 Forward -303 -286 7.31533 0.0142
NP_440344.1_10 Reverse -379 -396 -9.99092 0.163
NP_440297.1_9 Forward -139 -129 0.176696 0.282
NP_440297.1_9 Reverse -288 -298 -0.216628 0.282
NP_440297.1_9 Reverse -387 -397 -0.511621 0.289
NP_440350.1_5 Forward -30 -11 0.687771 0.158
NP_442187.1_3 Forward -396 -386 15.6147 0.105
NP_441592.1_4 Reverse -131 -150 9.0459 0.124
NP_441896.1_3 Forward -305 -286 5.60432 0.121
NP_441896.1_5 Forward -153 -146 15.3787 0.268
NP_441103.1_9 Reverse -278 -288 13.6614 0.243
NP_440894.1_4 Forward -32 -13 8.06259 0.219
NP_440894.1_10 Forward -301 -282 3.04771 0.279
NP_443036.1_1 Forward -198 -179 9.43841 0.273
NP_440834.1_2 Reverse -316 -335 11.7983 0.275
NP_440999.1_9 Forward -300 -286 4.12949 0.117
NP_440999.1_9 Reverse -283 -297 -1.8687 0.252
NP_440888.1_2 Reverse -386 -400 14.0603 0.0211
NP_440888.1_2 Forward -296 -282 8.25877 0.167
NP_440491.1_1 Forward -299 -280 7.30684 0.273
NP_439969.1_3 Forward -301 -282 0.58944 0.265
NP_442277.1_7 Reverse -166 -182 -1.99853 0.289
NP_442033.1_10 Forward -298 -279 -11.1119 0.25
NP_440575.1_8 Reverse -341 -360 0.687771 0.185
NP_441543.1_2 Reverse -288 -297 7.47288 0.117
NP_441543.1_2 Reverse -387 -396 7.07956 0.131
NP_441543.1_2 Forward -295 -286 7.07956 0.131
NP_441543.1_2 Forward -13 -4 4.32629 0.26
NP_442845.1_2 Forward -296 -282 3.93283 0.272
NP_443064.1_3 Forward -100 -81 9.0459 0.179
NP_443064.1_6 Forward -296 -286 11.6943 0.124
NP_443064.1_6 Reverse -74 -84 11.1125 0.13
NP_442578.1_7 Reverse -288 -295 14.6904 0.026
NP_442578.1_7 Forward -394 -387 6.0373 0.18
NP_440071.1_1 Reverse -180 -197 10.9528 0.252
NP_441462.1_2 Forward -395 -385 16.1063 0.00406
NP_441462.1_2 Reverse -287 -297 10.7964 0.00567
NP_441462.1_2 Forward -296 -286 1.74999 0.0811
NP_441621.1_7 Forward -298 -284 -4.81863 0.246
NP_442204.1_1 Reverse -283 -294 11.5634 0.0565
NP_442204.1_5 Forward -200 -181 1.27776 0.24
NP_442204.1_5 Forward -338 -319 -0.000545616 0.274
NP_441560.1_4 Forward -159 -140 18.4857 0.217
NP_440516.1_8 Forward -395 -386 18.9776 0.00442
NP_440516.1_8 Reverse -287 -296 8.45619 0.0364
NP_440516.1_8 Forward -296 -287 7.37455 0.0648
NP_440516.1_8 Reverse -386 -395 5.01461 0.118
NP_442428.1_5 Forward -394 -387 6.13563 0.209
NP_442428.1_5 Reverse -288 -295 6.13563 0.209
NP_442428.1_5 Reverse -387 -394 6.0373 0.212
NP_442428.1_5 Forward -295 -288 6.0373 0.212
NP_442120.1_10 Reverse -357 -376 -10.817 0.261
NP_440673.1_2 Forward -306 -287 15.3647 0.0888
NP_440673.1_3 Forward -294 -287 12.4288 0.0426
NP_440673.1_3 Reverse -388 -395 12.4288 0.0426
NP_440865.1_9 Forward -302 -283 -5.31042 0.213
NP_441052.1_2 Reverse -386 -396 10.6981 0.0285
NP_441052.1_2 Forward -296 -286 10.1081 0.0295
NP_441052.1_2 Reverse -287 -297 7.05986 0.0818
NP_442219.1_9 Reverse -387 -396 7.96454 0.0696
NP_442219.1_9 Forward -295 -286 7.96454 0.0696
NP_440436.1_4 Reverse -387 -396 7.57079 0.124
NP_440436.1_4 Forward -295 -286 7.57079 0.124
NP_440436.1_4 Reverse -288 -297 6.39082 0.162
NP_441884.1_9 Forward -299 -280 -4.81876 0.0594
NP_441884.1_9 Forward -315 -296 -25.3699 0.29
NP_440314.1_9 Forward -394 -375 -8.85033 0.254
NP_441719.1_4 Reverse -288 -295 13.5105 0.026
NP_441719.1_4 Forward -394 -387 6.82395 0.0855
NP_441719.1_4 Reverse -387 -394 6.52896 0.188
NP_441719.1_4 Forward -295 -288 6.52896 0.188
NP_441004.1_1 Forward -152 -133 -12.4886 0.247
NP_441004.1_1 Forward -196 -177 -14.6519 0.269
NP_441115.1_4 Reverse -17 -35 10.1465 0.187
NP_442694.1_4 Reverse -376 -385 10.8161 0.294
NP_442206.1_1 Reverse -272 -291 -13.2752 0.25
NP_443054.1_2 Reverse -285 -299 7.76774 0.14
NP_441851.1_10 Reverse -286 -296 11.8781 0.0602
NP_441851.1_10 Forward -297 -287 7.64985 0.135
NP_442856.1_7 Reverse -278 -297 -6.58872 0.299
NP_441668.1_4 Reverse -98 -117 -2.45882 0.288
NP_442515.1_1 Forward -396 -382 6.48943 0.0975
NP_442515.1_1 Reverse -286 -300 -2.55701 0.277
NP_440593.1_3 Reverse -282 -301 -6.68705 0.28
NP_440463.1_8 Reverse -293 -312 12.4373 0.199
NP_442689.1_8 Reverse -116 -133 -5.07437 0.268
NP_440940.1_7 Forward -306 -288 2.67334 0.295
NP_441349.1_10 Reverse -277 -296 -1.47551 0.104
NP_441409.1_6 Reverse -380 -399 -13.3736 0.236
NP_440432.1_9 Reverse -288 -303 -2.08505 0.167
NP_439960.1_10 Reverse -280 -298 13.4905 0.0769
NP_439960.1_10 Reverse -293 -311 -2.0458 0.248
NP_440396.1_2 Reverse -115 -133 22.4386 0.024
NP_440396.1_3 Reverse -24 -43 19.5673 0.0174
NP_440396.1_6 Reverse -221 -240 20.354 0.0163
NP_442450.1_5 Forward -298 -288 8.04317 0.13
NP_440588.1_2 Reverse -278 -297 4.22769 0.0854
NP_440195.1_5 Forward -302 -283 0.196116 0.3
NP_442006.1_2 Forward -290 -273 -9.59759 0.197
NP_442243.1_1 Reverse -281 -299 15.653 0.106
NP_441570.1_1 Reverse -287 -305 -10.3056 0.166
NP_441078.1_4 Reverse -287 -296 9.93116 0.0203
NP_441078.1_4 Forward -296 -287 9.83282 0.0226
NP_441078.1_4 Forward -395 -386 0.196389 0.205
NP_441078.1_4 Reverse -386 -395 -0.000272808 0.205
NP_442729.1_5 Forward -198 -188 11.0914 0.235
NP_442729.1_8 Forward -300 -287 6.01747 0.217
NP_440526.1_3 Reverse -288 -299 11.4645 0.0646
NP_441432.1_8 Forward -396 -387 14.0611 0.0258
NP_441432.1_8 Reverse -286 -295 7.27622 0.101
NP_442320.1_8 Forward -302 -288 -2.16369 0.0867
NP_442320.1_8 Reverse -281 -295 -4.52363 0.171
NP_441732.1_2 Reverse -283 -299 -16.1661 0.165
NP_440760.1_1 Reverse -287 -306 -14.2585 0.128
NP_440760.1_1 Forward -296 -277 -17.1101 0.192
NP_442797.1_7 Reverse -280 -298 -0.0791831 0.281
NP_440199.1_10 Forward -398 -388 15.5163 0.0861
NP_441945.1_10 Forward -103 -84 8.45592 0.273
NP_441057.1_4 Reverse -315 -333 -4.01242 0.299
NP_440913.1_1 Reverse -285 -303 23.7169 0.0109
NP_440713.1_4 Forward -201 -182 4.71934 0.223
NP_442489.1_7 Forward -296 -287 17.306 0.00302
NP_442489.1_7 Reverse -287 -296 10.4228 0.0151
NP_442489.1_7 Forward -395 -386 0.688044 0.152
NP_442489.1_7 Reverse -386 -395 0.688044 0.152
NP_440559.1_1 Reverse -288 -297 14.2577 0.0264
NP_440559.1_1 Reverse -387 -396 7.76787 0.0918
NP_440559.1_1 Forward -295 -286 7.76787 0.0918
NP_440559.1_1 Forward -394 -385 6.39124 0.134
NP_441659.2_8 Reverse -287 -297 9.81313 0.0269
NP_441659.2_8 Forward -296 -286 8.53483 0.0412
NP_441659.2_8 Reverse -386 -396 5.48657 0.106
NP_441659.2_8 Forward -395 -385 0.275027 0.27
NP_440426.1_7 Reverse -277 -296 2.16274 0.207
NP_441040.1_2 Forward -198 -179 -11.5053 0.255
NP_441040.1_2 Reverse -279 -298 -12.2919 0.255
NP_442346.1_5 Forward -276 -266 8.4365 0.137
NP_442346.1_5 Forward -297 -287 8.1415 0.146
NP_442346.1_5 Reverse -286 -296 7.55152 0.165
NP_442346.1_5 Reverse -385 -395 4.3066 0.291
NP_442346.1_10 Reverse -270 -289 -1.7705 0.294
NP_440352.1_5 Forward -294 -275 15.8678 0.113
NP_440352.1_5 Forward -55 -36 9.83295 0.289
NP_440545.1_3 Forward -300 -283 -1.0428 0.162
NP_440545.1_3 Reverse -283 -300 -1.73112 0.173
NP_440545.1_5 Forward -200 -183 4.56207 0.244
NP_441856.1_3 Forward -398 -379 -3.73712 0.299
NP_441923.1_8 Reverse -317 -331 19.2725 0.138
NP_440486.1_6 Forward -297 -278 8.75091 0.235
NP_440459.1_2 Reverse -9 -26 13.3135 0.131
NP_440459.1_2 Forward -298 -281 9.77361 0.219
NP_441653.1_2 Forward -307 -288 4.39932 0.258
NP_440847.1_3 Reverse -274 -288 15.2402 0.18
NP_442603.1_7 Forward -395 -381 16.5185 0.0304
NP_442603.1_7 Forward -296 -282 15.9285 0.038
NP_442603.1_7 Reverse -386 -400 7.07881 0.216
NP_441585.1_5 Reverse -266 -285 0.195343 0.291
NP_441888.1_3 Forward -343 -324 11.7992 0.264
NP_440449.1_6 Forward -198 -180 8.3531 0.201
NP_441047.1_2 Forward -333 -314 -3.73712 0.3
NP_441833.1_4 Reverse -387 -394 6.52896 0.0924
NP_441833.1_4 Forward -295 -288 6.52896 0.0924
NP_441833.1_4 Forward -394 -387 6.23397 0.163
NP_441833.1_4 Reverse -288 -295 6.23397 0.163
NP_442162.1_9 Forward -394 -387 12.9205 0.0282
NP_442162.1_9 Reverse -387 -394 12.9205 0.0282
NP_442162.1_9 Reverse -288 -295 6.62729 0.142
NP_442162.1_9 Forward -295 -288 6.52896 0.178
NP_440671.1_4 Reverse -281 -295 5.89945 0.27
NP_440224.1_1 Reverse -276 -295 9.53756 0.0591
NP_440772.1_3 Reverse -293 -312 20.2556 0.161
NP_442140.1_3 Forward -394 -384 7.35486 0.142
NP_442140.1_3 Reverse -288 -298 5.5849 0.202
NP_442140.1_3 Reverse -132 -142 4.40493 0.243
NP_440875.1_9 Forward -294 -284 8.37203 0.233
NP_441813.1_3 Forward -329 -310 13.3647 0.291
NP_441813.1_5 Reverse -285 -295 8.4365 0.0432
NP_441813.1_5 Forward -397 -387 6.17489 0.1
NP_441813.1_5 Reverse -384 -394 5.78156 0.109
NP_441813.1_5 Forward -298 -288 -0.708283 0.272
NP_440590.1_4 Reverse -288 -301 3.75586 0.0686
NP_440590.1_4 Forward -295 -282 3.16588 0.0756
NP_440590.1_4 Reverse -387 -400 -4.79893 0.267
NP_440567.1_1 Forward -295 -281 5.01447 0.108
NP_440567.1_1 Forward -394 -380 0.294584 0.25
NP_440567.1_1 Reverse -288 -302 0.0979218 0.256
NP_442497.1_10 Reverse -288 -297 10.1278 0.0166
NP_442497.1_10 Forward -394 -385 1.08137 0.115
NP_442497.1_10 Reverse -387 -396 0.589713 0.153
NP_442497.1_10 Forward -295 -286 0.589713 0.153
NP_440821.1_4 Forward -298 -288 9.7148 0.0274
NP_440821.1_4 Forward -397 -387 8.53483 0.0468
NP_440821.1_4 Reverse -384 -394 7.35486 0.072
NP_440821.1_4 Reverse -285 -295 -0.314959 0.251
NP_441239.1_9 Reverse -384 -396 12.9203 0.0402
NP_441239.1_9 Reverse -129 -141 8.9871 0.117
NP_441239.1_9 Forward -298 -286 5.15219 0.227
NP_441727.1_3 Forward -27 -8 10.6192 0.162
NP_441892.1_1 Forward -305 -288 7.217 0.0915
NP_442044.1_1 Reverse -18 -37 -11.1119 0.271
NP_442044.1_1 Reverse -69 -88 -14.7502 0.299
NP_442044.1_9 Reverse -287 -306 9.53756 0.146
NP_442643.1_3 Reverse -182 -201 -8.35868 0.295
NP_441017.1_6 Forward -382 -368 11.602 0.255
NP_441617.1_6 Reverse -363 -382 -6.98204 0.29
NP_440264.1_1 Forward -17 -3 17.5018 0.227
NP_440546.1_4 Forward -395 -385 14.9908 0.0459
NP_441509.1_1 Reverse -252 -271 6.29264 0.292
NP_441509.1_2 Forward -162 -144 5.32902 0.296
NP_441230.1_5 Forward -301 -282 1.86774 0.232
NP_440462.1_6 Reverse -384 -394 6.46988 0.115
NP_440462.1_6 Reverse -285 -295 6.37155 0.118
NP_440868.1_4 Forward -399 -387 13.2153 0.022
NP_440868.1_7 Reverse -268 -287 19.1731 0.0702
NP_442499.1_4 Forward -336 -322 13.2743 0.226
NP_441582.1_5 Reverse -315 -334 3.44025 0.266
NP_441848.1_4 Forward -270 -254 8.21911 0.288
NP_439948.1_2 Reverse -162 -180 14.0393 0.259
NP_440696.1_6 Forward -95 -76 3.44104 0.288
NP_442039.1_4 Forward -394 -387 11.6422 0.0747
NP_441811.1_8 Forward -302 -288 8.25939 0.238
NP_442380.1_10 Forward -306 -288 17.5221 0.142
NP_442837.1_3 Forward -295 -288 12.1338 0.0702
NP_442837.1_3 Forward -394 -387 6.0373 0.25
NP_442837.1_3 Reverse -387 -394 6.0373 0.25
NP_442837.1_3 Reverse -288 -295 6.0373 0.25
NP_442053.1_1 Forward -296 -287 16.3227 0.00389
NP_442053.1_1 Reverse -386 -395 14.4544 0.0114
NP_442053.1_1 Reverse -287 -296 8.65285 0.0741
NP_442053.1_1 Forward -395 -386 7.86621 0.0863
NP_440505.1_3 Forward -397 -387 14.7297 0.0176
NP_440505.1_3 Reverse -285 -295 9.51814 0.122
NP_442471.1_7 Forward -195 -177 20.1484 0.125
NP_440914.1_1 Reverse -386 -396 13.1043 0.0386
NP_440914.1_1 Forward -296 -286 8.51751 0.186
NP_441011.1_8 Forward -394 -385 9.24284 0.131
NP_442533.1_1 Forward -344 -325 -14.0619 0.239
NP_442533.1_6 Forward -296 -287 7.57121 0.0898
NP_442533.1_6 Reverse -287 -296 7.47288 0.0898
NP_442533.1_6 Reverse -386 -395 4.42462 0.179
NP_442533.1_6 Reverse -131 -140 1.67135 0.293
NP_442533.1_6 Reverse -138 -147 1.37636 0.3
NP_442533.1_6 Reverse -77 -86 1.37636 0.3
NP_439981.1_3 Forward -323 -304 7.17762 0.263
NP_442541.1_10 Forward -312 -298 3.73557 0.252
NP_442541.1_10 Reverse -272 -286 2.65393 0.254
NP_442232.1_3 Forward -319 -300 -12.3902 0.282
NP_441482.1_7 Forward -302 -288 1.17956 0.0554
NP_441482.1_7 Forward -334 -320 -9.73518 0.209
NP_441482.1_7 Reverse -281 -295 -10.4235 0.209
NP_439944.1_9 Reverse -387 -397 9.22315 0.1
NP_439944.1_9 Reverse -288 -298 8.1415 0.116
NP_441028.1_6 Reverse -322 -332 10.9926 0.193
NP_441028.1_6 Reverse -347 -357 5.48612 0.255
NP_441028.1_6 Reverse -278 -288 3.42118 0.296
NP_440116.1_8 Reverse -12 -31 -8.16202 0.247
NP_440115.1_6 Reverse -284 -294 16.008 0.0325
NP_440115.1_6 Forward -398 -388 8.4365 0.13
NP_439965.1_1 Reverse -278 -297 -2.45882 0.177
NP_441544.1_1 Reverse -300 -312 15.6736 0.242
NP_441602.1_3 Reverse -282 -301 -3.44213 0.246
NP_441972.1_5 Reverse -288 -307 -4.52377 0.211
NP_441972.1_5 Forward -295 -276 -4.91709 0.212
NP_441420.1_1 Reverse -286 -305 -0.4922 0.246
NP_442306.1_10 Forward -400 -381 -21.7317 0.286
NP_441186.1_5 Forward -384 -365 15.0396 0.28
NP_441286.1_1 Reverse -286 -298 14.7886 0.00418
NP_441286.1_1 Forward -396 -384 13.8053 0.00558
NP_441286.1_1 Forward -297 -285 -6.35254 0.26
NP_440670.1_8 Reverse -287 -296 9.53783 0.0559
NP_440670.1_8 Forward -296 -287 9.14451 0.0583
NP_440670.1_8 Forward -395 -386 8.75118 0.0606
NP_440670.1_8 Reverse -386 -395 6.19458 0.124
NP_440886.1_7 Reverse -385 -395 6.76441 0.114
NP_442614.1_2 Forward -395 -381 10.521 0.234
NP_442072.1_9 Reverse -286 -304 -13.4522 0.112
NP_442072.1_9 Forward -191 -173 -13.6489 0.118
NP_442072.1_9 Reverse -107 -125 -22.4986 0.241
NP_440907.2_8 Reverse -288 -298 16.2041 0.0161
NP_442264.1_2 Reverse -382 -399 6.43035 0.259
NP_441021.1_1 Reverse -132 -151 -9.63698 0.218
NP_441626.1_2 Forward -394 -387 12.2322 0.0511
NP_441626.1_2 Reverse -288 -295 6.13563 0.177
NP_441626.1_2 Reverse -387 -394 5.93897 0.231
NP_441626.1_2 Forward -295 -288 5.93897 0.231
NP_441626.1_6 Forward -300 -282 15.7513 0.13
NP_442794.1_1 Reverse -283 -295 10.2654 0.0721
NP_442615.1_1 Forward -305 -287 -3.52077 0.163
NP_442615.1_1 Reverse -377 -395 -7.25734 0.283
NP_441962.1_4 Forward -301 -282 -6.29373 0.175
NP_441962.1_4 Forward -316 -297 -13.9635 0.28
NP_440387.1_1 Reverse -287 -303 -3.48138 0.16
NP_441431.1_2 Forward -143 -129 9.24208 0.19
NP_441993.1_1 Forward -302 -283 2.72635 0.254
NP_440114.1_10 Forward -395 -381 8.55439 0.2
NP_440935.1_6 Forward -221 -204 6.06813 0.276
NP_440737.1_2 Forward -311 -294 18.7217 0.0476
NP_442323.1_7 Reverse -282 -301 13.175 0.0911
NP_440766.1_4 Forward -399 -385 9.34103 0.0871
NP_440766.1_4 Forward -300 -286 5.60446 0.11
NP_439988.1_3 Forward -399 -385 4.62115 0.295
NP_441237.1_9 Reverse -288 -298 15.2213 0.0242
NP_441237.1_9 Forward -394 -384 14.1397 0.0488
NP_442743.1_4 Forward -340 -321 -8.35868 0.291
NP_442930.1_1 Forward -58 -48 10.1076 0.278
NP_442867.1_8 Forward -101 -82 10.6192 0.206
NP_440457.1_1 Forward -399 -387 13.707 0.0795
NP_440457.1_1 Reverse -283 -295 7.31547 0.105
NP_440457.1_1 Forward -300 -288 5.34885 0.141
NP_440457.1_1 Forward -144 -132 -0.944332 0.285
NP_440987.1_4 Forward -43 -24 4.22769 0.248
NP_441984.1_1 Forward -302 -284 9.16393 0.23
NP_442509.1_9 Forward -395 -385 13.1559 0.061
NP_442509.1_9 Reverse -287 -297 7.84605 0.2
NP_440660.1_6 Reverse -135 -154 10.8159 0.28
NP_442439.1_8 Forward -276 -257 7.7676 0.273
NP_440554.1_4 Reverse -387 -397 4.10993 0.201
NP_441885.1_5 Forward -296 -286 11.0914 0.00874
NP_441885.1_5 Reverse -287 -297 1.94665 0.0935
NP_441885.1_5 Reverse -386 -396 1.25834 0.11
NP_441885.1_5 Forward -395 -385 -0.0199663 0.186
NP_441885.1_5 Forward -20 -10 -1.29827 0.259
NP_440478.1_4 Forward -300 -281 14.3558 0.168
NP_440478.1_10 Forward -298 -284 6.98109 0.279
NP_442341.1_7 Reverse -286 -300 9.43936 0.0751
NP_442341.1_7 Forward -297 -283 8.65272 0.0858
NP_442341.1_7 Forward -396 -382 1.47456 0.288
NP_441756.1_5 Forward -332 -313 -2.85214 0.283
NP_440423.1_6 Forward -304 -285 -12.8819 0.204
NP_443000.1_7 Reverse -285 -295 10.2065 0.0355
NP_443000.1_7 Forward -397 -387 7.35486 0.0859
NP_440275.1_3 Forward -298 -288 9.91146 0.046
NP_440275.1_3 Reverse -285 -295 5.5849 0.14
NP_440275.1_3 Forward -397 -387 5.5849 0.14
NP_440275.1_3 Reverse -384 -394 1.25834 0.291
NP_440091.1_1 Forward -399 -387 6.1355 0.1
NP_443010.1_10 Forward -398 -381 3.3506 0.255
NP_442451.1_2 Reverse -279 -298 0.58944 0.152
NP_442753.1_8 Reverse -375 -394 16.5191 0.239
NP_440175.1_4 Forward -298 -279 -13.7669 0.261
NP_440175.1_7 Forward -102 -84 10.4366 0.253
NP_440175.1_10 Reverse -315 -334 9.53756 0.281
NP_440804.1_7 Forward -176 -159 7.3146 0.261
NP_440149.1_8 Forward -203 -184 -4.22878 0.203
NP_441105.1_3 Reverse -298 -317 0.491109 0.124
NP_441105.1_3 Forward -307 -288 -5.50708 0.22
NP_441105.1_3 Reverse -276 -295 -8.65367 0.275
NP_440216.1_1 Forward -296 -282 -0.295402 0.0284
NP_440216.1_1 Reverse -108 -122 -5.60527 0.133
NP_440216.1_1 Reverse -287 -301 -11.3085 0.178
NP_440216.1_1 Reverse -386 -400 -12.2918 0.256
NP_440216.1_9 Reverse -190 -199 6.68623 0.289
NP_440216.1_9 Reverse -20 -29 5.99792 0.289
NP_440216.1_9 Forward -377 -368 5.70292 0.29
NP_440172.1_1 Forward -395 -385 7.55152 0.0761
NP_440172.1_1 Reverse -287 -297 6.56821 0.102
NP_440172.1_1 Forward -296 -286 5.38824 0.145
NP_440172.1_1 Reverse -386 -396 2.24165 0.279
NP_442015.1_10 Reverse -283 -296 11.6223 0.0372
NP_442015.1_10 Forward -194 -181 4.05085 0.178
NP_441226.1_7 Forward -394 -387 12.7234 0.0312
NP_441226.1_7 Reverse -387 -394 11.5435 0.0757
NP_441111.1_7 Reverse -288 -296 8.96754 0.0463
NP_441111.1_7 Reverse -387 -395 8.86921 0.0589
NP_441111.1_7 Forward -295 -287 8.86921 0.0589
NP_440415.1_7 Forward -30 -11 18.879 0.051
NP_441766.1_2 Reverse -386 -395 14.7494 0.00772
NP_441766.1_2 Reverse -287 -296 7.76787 0.0714
NP_441766.1_2 Forward -296 -287 7.76787 0.0714
NP_440416.1_9 Reverse -292 -311 -14.6519 0.179
NP_440416.1_9 Reverse -280 -299 -16.9135 0.226
NP_443052.1_8 Forward -306 -287 -10.3253 0.207
NP_442154.1_1 Forward -95 -77 -17.5821 0.26
NP_440261.1_5 Forward -295 -282 -3.02898 0.108
NP_440261.1_5 Forward -394 -381 -3.12731 0.115
NP_440261.1_5 Reverse -288 -301 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGATGGCGATCGGGCCAAAATACCAATGTAAAAACCTGGTGCCTAGGGGATAAATTAATTTGATTAGCCAGGGGGAAACCCTGGAAGGGCCAATGACAGCAGGGTCGATCGCCAGGGGAGAATTGGTCATGGTTACGAAAAAAATATGGGTTCTTCCTCCGACAGACGATTAAACTAGAACCTTAGTATTAATTAAATCGCTTGCCGTGGGGGGTGGTCTCTGTTTTTAAGTTAGATTAACTACTCTGGTTTGGGGACGAGCCATGGGACAGTTAAACAACAGTTGAACGGCCAAATTCCCTCCGCTATGTTGGGGGCTGAGCCTTTCAGCTACAGTGGTTAAATAATTACCCTGGGATTATATCGGCCCTATTCCTTGGCCTATTGCTATAAATAACT

CDS

ATGATTAGTCTTGATCAAGTCAAACAACAAATCCAAGCCGCCCTACCTGATGCCGAAGTAATGGTCAATGACCTGGGGGGAGGGGATCACCTGGAGGCCGTGGTGGTATCTTCAGCCTTTACCGGCCAGTCCCGGGTCAAACAACATCAAATGGTCTATGGTGCCCTCAAGGATGCTTTGGCTTCGGAGGCAATCCATGCCCTGGCGCTGAAAACCTTTACTCCAGAAGCCTGGGCCGTGGCCCGGCAGACTGCTTAG

Protein

MISLDQVKQQIQAALPDAEVMVNDLGGGDHLEAVVVSSAFTGQSRVKQHQMVYGALKDALASEAIHALALKTFTPEAWAVARQTA