Your browser is old and dusty. Try Google Chrome!

Details for ssr3000

ORF ssr3000
Accession NP_440136.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -392 -378 10.816 0.057
NP_441061.1_2 Forward -165 -151 3.24451 0.166
NP_442761.1_5 Reverse -379 -398 12.2908 0.0933
NP_440795.1_7 Forward -392 -385 14.6904 0.0123
NP_440795.1_7 Reverse -385 -392 14.6904 0.0123
NP_441418.1_6 Forward -393 -374 -0.688862 0.0105
NP_441418.1_6 Forward -166 -147 -10.817 0.0397
NP_441418.1_6 Reverse -148 -167 -29.7948 0.238
NP_440815.1_5 Forward -393 -374 6.29264 0.275
NP_440897.1_6 Forward -393 -374 -1.37794 0.188
NP_441453.1_1 Reverse -377 -395 15.1613 0.0938
NP_441453.1_1 Forward -400 -382 2.96833 0.281
NP_441453.1_4 Reverse -384 -392 16.539 0.00633
NP_441453.1_4 Forward -393 -385 16.539 0.00633
NP_442151.1_6 Forward -393 -379 19.7641 0.0045
NP_442151.1_6 Reverse -157 -171 5.40779 0.278
NP_442328.1_3 Forward -60 -41 18.0915 0.228
NP_440561.1_6 Reverse -379 -398 22.7139 0.0564
NP_442623.1_3 Forward -392 -373 -8.35868 0.127
NP_440150.1_6 Reverse -299 -318 7.86593 0.223
NP_442655.1_2 Reverse -263 -282 13.9625 0.0689
NP_442655.1_10 Forward -396 -377 -10.6203 0.22
NP_442173.1_1 Forward -392 -384 15.4574 0.00633
NP_442173.1_1 Reverse -385 -393 15.4574 0.00633
NP_442752.1_4 Forward -393 -386 13.8055 0.0199
NP_442752.1_4 Reverse -384 -391 13.8055 0.0199
NP_442752.1_4 Reverse -157 -164 13.5105 0.0314
NP_443027.1_4 Forward -395 -385 13.2547 0.0521
NP_443027.1_4 Reverse -382 -392 13.1564 0.0521
NP_443027.1_4 Reverse -357 -367 7.25653 0.24
NP_441812.1_3 Reverse -383 -397 10.4227 0.222
NP_442975.1_10 Forward -397 -383 3.93223 0.249
NP_442975.1_10 Reverse -380 -394 3.93223 0.249
NP_442975.1_10 Forward -170 -156 1.37564 0.299
NP_440784.1_7 Forward -392 -385 15.9687 0.0123
NP_440784.1_7 Reverse -385 -392 15.9687 0.0123
NP_440061.1_9 Forward -395 -381 19.1735 0.00631
NP_442062.1_3 Forward -229 -210 -3.44213 0.292
NP_442062.1_8 Forward -393 -383 17.3846 0.00193
NP_442062.1_8 Reverse -384 -394 10.3048 0.0493
NP_440761.1_3 Forward -131 -112 9.01981 0.263
NP_441859.1_3 Forward -394 -375 14.4533 0.0704
NP_440304.1_4 Forward -395 -385 10.8948 0.051
NP_440304.1_4 Reverse -382 -392 9.91146 0.051
NP_442242.1_4 Forward -392 -385 14.3954 0.0124
NP_442242.1_4 Reverse -385 -392 14.3954 0.0124
NP_442242.1_4 Reverse -158 -165 9.57722 0.227
NP_441208.1_9 Reverse -381 -395 16.5192 0.0647
NP_440370.1_10 Reverse -375 -394 8.75091 0.24
NP_442110.1_7 Forward -393 -379 9.34103 0.0755
NP_442110.1_7 Reverse -384 -398 2.2612 0.222
NP_440856.1_4 Forward -400 -381 9.83255 0.0546
NP_440856.1_7 Forward -169 -150 -5.80207 0.233
NP_441083.1_5 Forward -393 -383 20.3345 0.00053
NP_441083.1_5 Reverse -384 -394 11.2881 0.0159
NP_441083.1_5 Forward -166 -156 8.53483 0.0342
NP_441083.1_5 Reverse -157 -167 0.0783647 0.245
NP_442827.1_8 Reverse -376 -395 5.89851 0.113
NP_442827.1_8 Forward -174 -155 -0.39464 0.226
NP_441738.1_2 Forward -391 -384 15.28 0.0102
NP_441738.1_2 Reverse -386 -393 15.28 0.0102
NP_441558.1_5 Forward -395 -376 21.1406 0.00385
NP_440209.1_1 Reverse -384 -392 18.1123 0.00295
NP_440209.1_1 Forward -393 -385 18.1123 0.00295
NP_440209.1_1 Reverse -157 -165 5.0343 0.194
NP_442889.1_8 Forward -169 -155 4.03056 0.27
NP_440447.1_6 Reverse -376 -394 18.8987 0.0347
NP_441713.1_1 Reverse -378 -397 2.16274 0.0651
NP_440178.1_7 Forward -312 -293 -16.1268 0.164
NP_441716.1_1 Forward -393 -379 19.9608 0.00829
NP_441716.1_1 Reverse -157 -171 9.2427 0.122
NP_441716.1_1 Forward -166 -152 7.07942 0.181
NP_441716.1_1 Reverse -151 -165 5.50613 0.227
NP_441716.1_1 Reverse -335 -349 4.81781 0.248
NP_441327.1_4 Forward -81 -67 15.1426 0.282
NP_442111.1_4 Reverse -383 -397 13.1759 0.0394
NP_442111.1_4 Forward -394 -380 11.2093 0.0515
NP_440906.1_5 Forward -392 -385 15.8704 0.0124
NP_440906.1_5 Reverse -385 -392 15.8704 0.0124
NP_440906.1_5 Reverse -158 -165 9.47889 0.116
NP_440747.1_10 Reverse -381 -393 17.2469 0.000522
NP_440747.1_10 Forward -396 -384 17.1486 0.000663
NP_440747.1_10 Reverse -154 -166 -2.4193 0.0434
NP_440747.1_10 Reverse -332 -344 -12.5474 0.297
NP_441130.1_10 Reverse -382 -396 6.98109 0.173
NP_441486.1_1 Reverse -28 -42 1.08123 0.119
NP_442330.1_4 Forward -88 -69 12.3111 0.289
NP_442634.1_4 Forward -395 -381 15.6342 0.0115
NP_442634.1_4 Reverse -382 -396 6.58777 0.0489
NP_441265.1_3 Reverse -378 -392 14.1593 0.059
NP_440403.1_4 Reverse -148 -167 -5.9004 0.223
NP_441014.1_5 Forward -171 -153 9.55725 0.275
NP_442848.1_1 Reverse -378 -392 -1.67204 0.263
NP_443018.1_3 Forward -392 -385 14.8871 0.0123
NP_443018.1_3 Reverse -385 -392 14.8871 0.0123
NP_441634.1_8 Forward -395 -381 -2.85201 0.295
NP_440376.1_1 Forward -393 -384 19.4693 0.000692
NP_440376.1_1 Reverse -384 -393 19.4693 0.000692
NP_440376.1_1 Reverse -302 -311 0.196389 0.283
NP_440376.1_1 Reverse -157 -166 0.0980582 0.285
NP_440376.1_1 Forward -166 -157 -0.000272808 0.285
NP_442687.1_7 Forward -394 -384 9.02648 0.0994
NP_442687.1_7 Reverse -383 -393 8.92815 0.0994
NP_442687.1_7 Reverse -156 -166 6.37155 0.171
NP_442191.1_4 Forward -392 -378 10.5083 0.298
NP_442485.1_3 Forward -152 -133 -0.0988766 0.251
NP_442530.1_2 Forward -237 -227 15.123 0.203
NP_440042.1_2 Forward -291 -272 -3.04881 0.274
NP_441422.1_7 Forward -395 -378 -0.157821 0.16
NP_440533.1_9 Forward -393 -374 3.73603 0.239
NP_442296.1_5 Forward -353 -334 1.47442 0.281
NP_442658.1_1 Forward -395 -385 14.2375 0.0237
NP_442658.1_1 Reverse -382 -392 9.616 0.147
NP_440141.1_4 Reverse -148 -167 -4.32711 0.296
NP_442782.1_2 Reverse -384 -398 11.7993 0.173
NP_442205.1_6 Forward -40 -22 11.6222 0.21
NP_442205.1_9 Forward -399 -383 -1.61309 0.264
NP_441414.1_9 Forward -393 -374 -2.65548 0.12
NP_442937.1_5 Reverse -379 -398 8.16093 0.231
NP_441958.1_5 Forward -394 -384 21.2195 0.000805
NP_441958.1_5 Reverse -383 -393 12.2714 0.00183
NP_441958.1_5 Forward -167 -157 1.06167 0.116
NP_442836.1_5 Reverse -59 -78 1.17943 0.287
NP_440203.1_5 Forward -390 -380 13.5492 0.114
NP_440984.1_7 Forward -398 -384 6.29277 0.219
NP_441097.1_2 Forward -234 -217 13.1169 0.148
NP_439990.1_5 Reverse -379 -392 22.5371 0.000754
NP_439990.1_5 Reverse -152 -165 7.19745 0.207
NP_442376.1_2 Reverse -379 -398 -4.81876 0.257
NP_442376.1_2 Forward -398 -379 -11.8986 0.286
NP_442911.1_2 Reverse -374 -393 9.83255 0.0164
NP_442064.1_4 Reverse -55 -74 7.57013 0.242
NP_440993.1_2 Forward -398 -382 2.8118 0.262
NP_440993.1_3 Reverse -374 -393 11.995 0.0864
NP_440602.1_2 Reverse -379 -398 3.53937 0.263
NP_441099.1_5 Reverse -374 -393 14.9458 0.0163
NP_441099.1_5 Forward -176 -157 -11.9969 0.294
NP_442002.1_9 Reverse -279 -286 11.1505 0.185
NP_442438.1_10 Reverse -379 -393 10.0294 0.0581
NP_442438.1_10 Reverse -152 -166 -0.000409212 0.244
NP_442231.1_1 Forward -305 -286 8.75091 0.236
NP_441000.1_6 Reverse -383 -397 -3.83532 0.225
NP_442771.1_1 Reverse -155 -173 -5.09406 0.166
NP_442771.1_1 Forward -168 -150 -10.6006 0.272
NP_441674.1_2 Forward -81 -62 4.71934 0.299
NP_440147.1_4 Forward -395 -382 19.6855 0.00258
NP_440147.1_4 Reverse -382 -395 9.16406 0.0428
NP_441295.1_4 Reverse -379 -398 -4.81876 0.29
NP_441550.1_8 Reverse -382 -392 16.7941 0.00906
NP_441550.1_8 Forward -395 -385 15.8108 0.0132
NP_441916.1_7 Reverse -384 -394 18.9579 0.00144
NP_441916.1_7 Forward -393 -383 10.3048 0.0261
NP_440206.1_4 Reverse -374 -393 -2.06626 0.293
NP_441041.1_4 Forward -393 -374 8.65258 0.0331
NP_441041.1_7 Forward -396 -384 13.3454 0.0485
NP_441041.1_7 Reverse -381 -393 9.1668 0.12
NP_440569.1_10 Reverse -64 -83 2.62561 0.288
NP_442004.1_6 Forward -393 -379 6.09611 0.181
NP_440703.1_9 Reverse -32 -45 9.5568 0.216
NP_440703.1_9 Forward -74 -61 6.60689 0.284
NP_441725.1_4 Forward -398 -384 12.2903 0.0693
NP_441725.1_5 Forward -392 -382 9.02648 0.0553
NP_441725.1_5 Reverse -385 -395 1.94665 0.115
NP_441725.1_5 Reverse -158 -168 1.35667 0.137
NP_439966.1_7 Reverse -382 -392 14.8275 0.0177
NP_439966.1_7 Forward -395 -385 14.3359 0.0203
NP_439966.1_9 Reverse -382 -391 0.884706 0.253
NP_442941.1_3 Reverse -385 -395 19.2529 0.00262
NP_442941.1_3 Forward -392 -382 10.9931 0.0116
NP_442941.1_3 Forward -165 -155 7.64985 0.0628
NP_442941.1_5 Reverse -68 -82 17.3897 0.181
NP_440289.1_2 Forward -396 -383 3.16588 0.0811
NP_440289.1_2 Reverse -381 -394 -4.7006 0.294
NP_440983.1_5 Forward -166 -147 -7.08038 0.284
NP_440260.1_8 Reverse -375 -393 -5.19239 0.273
NP_442281.1_1 Forward -398 -384 15.6336 0.0113
NP_442281.1_1 Forward -316 -302 8.45543 0.0808
NP_442281.1_1 Reverse -379 -393 6.88214 0.113
NP_441334.1_7 Forward -395 -376 -9.24366 0.12
NP_441556.1_10 Reverse -379 -393 11.4872 0.225
NP_441644.1_6 Reverse -384 -394 19.0557 0.000803
NP_441644.1_6 Forward -393 -383 17.3841 0.00127
NP_441644.1_6 Forward -166 -156 5.28945 0.199
NP_442215.1_2 Reverse -142 -158 -2.98973 0.207
NP_442215.1_2 Forward -36 -20 -5.448 0.25
NP_440253.1_2 Forward -393 -375 3.06741 0.123
NP_440929.1_8 Forward -393 -384 19.2726 0.000701
NP_440929.1_8 Reverse -384 -393 19.2726 0.000701
NP_442933.1_2 Forward -256 -238 5.92249 0.283
NP_442933.1_10 Forward -393 -384 17.601 0.00325
NP_442933.1_10 Reverse -384 -393 17.601 0.00325
NP_442933.1_10 Reverse -157 -166 10.3245 0.0525
NP_441751.2_8 Reverse -385 -399 5.1128 0.0448
NP_441751.2_8 Forward -392 -378 5.01447 0.0448
NP_441751.2_8 Forward -165 -151 -1.47537 0.129
NP_442554.1_8 Forward -392 -382 18.0729 0.00543
NP_442554.1_8 Reverse -385 -395 17.2863 0.00543
NP_442554.1_8 Reverse -303 -313 2.24165 0.276
NP_441762.1_7 Forward -394 -382 2.79224 0.0676
NP_441762.1_7 Reverse -383 -395 -6.84419 0.284
NP_442142.1_4 Reverse -381 -394 14.08 0.0317
NP_442142.1_4 Forward -396 -383 12.9 0.0406
NP_442142.1_4 Forward -169 -156 2.18201 0.299
NP_442292.1_1 Forward -392 -383 18.486 0.00229
NP_442292.1_1 Reverse -385 -394 17.5026 0.00435
NP_442476.1_6 Reverse -385 -399 2.35953 0.186
NP_440895.1_6 Forward -399 -386 9.16406 0.228
NP_442381.1_8 Reverse -381 -400 -13.4719 0.273
NP_441523.1_6 Reverse -380 -399 6.19431 0.219
NP_443009.1_5 Reverse -383 -394 14.5128 0.02
NP_443009.1_5 Forward -394 -383 10.1862 0.0792
NP_441715.1_4 Reverse -385 -395 16.7946 0.0106
NP_441715.1_4 Forward -392 -382 7.84651 0.107
NP_441715.1_4 Forward -165 -155 5.09324 0.233
NP_441468.1_1 Forward -392 -385 15.8704 0.0124
NP_441468.1_1 Reverse -385 -392 15.8704 0.0124
NP_441020.2_6 Reverse -382 -399 6.43035 0.262
NP_441015.1_10 Forward -398 -379 0.392778 0.165
NP_441673.1_1 Forward -393 -384 20.8459 0.000698
NP_441673.1_1 Reverse -384 -393 20.8459 0.000698
NP_441673.1_1 Forward -166 -157 1.37636 0.114
NP_441673.1_1 Reverse -157 -166 1.1797 0.163
NP_441426.1_8 Forward -284 -266 13.9821 0.204
NP_441826.1_2 Reverse -151 -165 10.226 0.0498
NP_441826.1_2 Reverse -378 -392 6.19444 0.0946
NP_441330.1_1 Forward -398 -379 -4.6221 0.0986
NP_441637.1_9 Reverse -241 -259 -1.75081 0.292
NP_441764.1_4 Forward -256 -239 13.0374 0.172
NP_442868.1_6 Reverse -382 -392 17.4829 0.012
NP_442868.1_6 Forward -395 -385 10.4031 0.038
NP_442719.1_2 Reverse -65 -83 0.510066 0.162
NP_441612.1_2 Forward -54 -44 11.7441 0.21
NP_441612.1_2 Forward -393 -383 8.54929 0.21
NP_441612.1_2 Forward -166 -156 8.06522 0.236
NP_442808.1_1 Forward -394 -384 8.73102 0.0481
NP_442808.1_1 Reverse -383 -393 8.63269 0.0481
NP_441101.1_10 Reverse -331 -350 -5.21209 0.281
NP_442820.1_4 Reverse -379 -396 12.8219 0.265
NP_442050.1_5 Forward -395 -385 15.9091 0.0091
NP_442050.1_5 Reverse -382 -392 15.6142 0.01
NP_440038.1_4 Reverse -30 -49 1.0811 0.275
NP_440334.1_1 Reverse -188 -207 16.281 0.262
NP_441114.1_3 Reverse -33 -42 7.66954 0.231
NP_440558.1_2 Forward -320 -301 -5.21209 0.254
NP_441518.1_3 Reverse -374 -393 -13.8652 0.264
NP_441878.1_6 Forward -394 -384 10.5014 0.0176
NP_441878.1_6 Reverse -383 -393 10.4031 0.0176
NP_441878.1_6 Forward -167 -157 0.766681 0.134
NP_441878.1_6 Forward -41 -31 -6.8048 0.196
NP_441036.1_8 Forward -394 -384 15.713 0.00724
NP_441036.1_8 Reverse -383 -393 8.33817 0.174
NP_442650.1_2 Forward -393 -379 6.88276 0.13
NP_441557.1_5 Forward -393 -384 19.9609 0.000699
NP_441557.1_5 Reverse -384 -393 19.9609 0.000699
NP_441557.1_5 Forward -166 -157 0.491382 0.144
NP_441557.1_5 Reverse -157 -166 0.29472 0.174
NP_441445.1_1 Reverse -148 -167 1.86774 0.247
NP_441445.1_1 Reverse -375 -394 -0.688862 0.3
NP_441590.1_4 Reverse -280 -299 2.9486 0.29
NP_442419.1_2 Reverse -379 -398 1.27776 0.238
NP_442183.1_1 Forward -393 -379 6.48943 0.171
NP_442183.1_1 Reverse -384 -398 5.40779 0.218
NP_441549.1_9 Reverse -380 -398 -5.78238 0.198
NP_441549.1_9 Reverse -331 -349 -9.91228 0.265
NP_442347.1_2 Forward -392 -383 12.4878 0.056
NP_442347.1_2 Reverse -385 -394 3.34298 0.284
NP_441037.1_4 Reverse -382 -392 9.55921 0.21
NP_441037.1_4 Forward -395 -385 7.22024 0.237
NP_441633.1_3 Forward -395 -382 6.01747 0.0481
NP_441633.1_3 Reverse -382 -395 -6.07724 0.236
NP_440136.1_1 Forward -297 -281 17.4624 0.174
NP_440136.1_2 Forward -392 -385 15.9687 0.0123
NP_440136.1_2 Reverse -385 -392 15.9687 0.0123
NP_440136.1_6 Forward -98 -80 22.3394 0.0562
NP_440136.1_7 Forward -131 -117 20.4518 0.243
NP_442998.1_5 Reverse -322 -332 11.6814 0.179
NP_442998.1_5 Reverse -278 -288 8.23984 0.267
NP_442998.1_10 Forward -391 -384 15.5754 0.0102
NP_442998.1_10 Reverse -386 -393 15.5754 0.0102
NP_442998.1_10 Forward -164 -157 5.84064 0.235
NP_440299.1_1 Reverse -380 -393 21.8481 0.000628
NP_440299.1_1 Reverse -153 -166 8.67183 0.0872
NP_440299.1_1 Forward -170 -157 7.09854 0.121
NP_441799.1_1 Forward -397 -383 14.3553 0.0242
NP_441799.1_1 Reverse -380 -394 6.58715 0.167
NP_442802.1_6 Forward -394 -375 9.24257 0.0905
NP_441007.1_10 Forward -398 -385 3.36254 0.182
NP_441007.1_10 Reverse -379 -392 1.88757 0.203
NP_440256.1_1 Reverse -381 -400 4.62101 0.0429
NP_440256.1_1 Forward -396 -377 -4.42544 0.155
NP_440256.1_1 Reverse -134 -153 -9.53865 0.281
NP_441559.1_8 Reverse -379 -393 2.75286 0.143
NP_441559.1_8 Forward -398 -384 1.57289 0.155
NP_440915.1_6 Reverse -380 -394 22.4191 0.00257
NP_440915.1_6 Forward -397 -383 1.08123 0.147
NP_440915.1_6 Reverse -298 -312 -3.24533 0.292
NP_441704.1_8 Reverse -373 -392 22.0247 0.024
NP_442452.1_8 Reverse -378 -392 15.9285 0.273
NP_440702.1_2 Reverse -155 -174 -3.54046 0.257
NP_440026.1_7 Forward -398 -383 14.4346 0.251
NP_441199.1_6 Forward -397 -378 4.916 0.158
NP_439985.1_10 Forward -209 -196 13.294 0.299
NP_442993.1_1 Reverse -384 -400 -11.1512 0.235
NP_440677.1_1 Reverse -375 -394 12.4875 0.136
NP_442386.1_9 Reverse -383 -392 13.8639 0.0289
NP_442386.1_9 Forward -394 -385 6.39082 0.219
NP_441340.1_5 Forward -392 -385 15.6737 0.0124
NP_441340.1_5 Reverse -385 -392 15.6737 0.0124
NP_442484.1_2 Reverse -373 -392 -1.96717 0.3
NP_440168.1_4 Reverse -374 -393 2.45773 0.202
NP_441160.1_1 Reverse -346 -365 -11.8986 0.295
NP_440586.1_8 Forward -392 -385 13.2151 0.026
NP_440586.1_8 Reverse -385 -392 13.2151 0.026
NP_442251.1_6 Forward -392 -385 15.2804 0.0124
NP_442251.1_6 Reverse -385 -392 15.2804 0.0124
NP_442251.1_6 Forward -165 -158 10.4622 0.12
NP_440684.1_9 Reverse -151 -165 13.3726 0.168
NP_441262.1_3 Reverse -384 -391 14.7888 0.0223
NP_441262.1_3 Forward -393 -386 14.7888 0.0223
NP_440027.1_3 Forward -112 -94 3.26332 0.275
NP_440027.1_8 Reverse -381 -400 3.73524 0.297
NP_443051.1_1 Forward -394 -385 19.5676 0.00335
NP_443051.1_1 Reverse -383 -392 10.4228 0.00754
NP_439937.1_9 Forward -394 -377 -15.8914 0.287
NP_442294.1_3 Forward -337 -323 11.7987 0.297
NP_441595.1_8 Reverse -97 -116 21.8289 0.0353
NP_440439.1_1 Forward -396 -383 10.934 0.0339
NP_440439.1_1 Reverse -381 -394 8.27909 0.0547
NP_439943.1_7 Reverse -379 -398 8.84924 0.181
NP_440372.1_2 Forward -392 -385 16.3621 0.0124
NP_440372.1_2 Reverse -385 -392 16.3621 0.0124
NP_441803.1_2 Forward -398 -379 5.01433 0.171
NP_439977.1_5 Forward -399 -380 12.3892 0.0597
NP_439977.1_5 Reverse -378 -397 -1.86883 0.263
NP_440139.1_1 Forward -399 -380 2.26028 0.235
NP_441155.1_10 Reverse -137 -156 21.6314 0.117
NP_440267.1_2 Forward -398 -384 12.5853 0.125
NP_442384.1_10 Forward -393 -380 11.3273 0.0367
NP_442384.1_10 Forward -166 -153 10.7374 0.0423
NP_442384.1_10 Reverse -384 -397 9.95071 0.047
NP_442384.1_10 Reverse -157 -170 7.39411 0.0822
NP_442384.1_10 Forward -344 -331 1.39592 0.26
NP_442262.1_10 Forward -392 -385 14.1988 0.0123
NP_442262.1_10 Reverse -385 -392 14.1988 0.0123
NP_441689.1_5 Forward -395 -385 8.3377 0.132
NP_441689.1_5 Reverse -382 -392 5.87944 0.197
NP_440344.1_10 Reverse -377 -394 -2.02611 0.06
NP_440344.1_10 Forward -400 -383 -6.05768 0.111
NP_440282.1_10 Reverse -153 -172 -7.86702 0.254
NP_440531.1_6 Reverse -129 -148 -4.22878 0.278
NP_440562.1_3 Forward -392 -375 5.05372 0.175
NP_441965.1_10 Reverse -381 -397 2.41848 0.288
NP_440297.1_9 Forward -392 -382 -0.216628 0.282
NP_440297.1_9 Reverse -385 -395 -0.216628 0.282
NP_440297.1_9 Reverse -158 -168 -0.609952 0.292
NP_441896.1_3 Reverse -375 -394 0.687771 0.224
NP_441896.1_3 Reverse -93 -112 -2.75381 0.289
NP_442378.1_6 Forward -71 -52 22.0247 0.106
NP_440894.1_10 Forward -171 -152 10.5209 0.155
NP_440894.1_10 Reverse -364 -383 3.14605 0.278
NP_442553.1_4 Reverse -290 -309 10.9142 0.209
NP_440999.1_9 Reverse -380 -394 10.3243 0.0541
NP_440999.1_9 Forward -397 -383 0.687908 0.177
NP_440888.1_2 Forward -393 -379 17.8952 0.00302
NP_440888.1_2 Reverse -384 -398 11.5037 0.0657
NP_440888.1_2 Forward -311 -297 7.27547 0.202
NP_439969.1_3 Reverse -379 -398 -1.08219 0.271
NP_442033.1_10 Forward -395 -376 -7.96535 0.188
NP_441543.1_2 Forward -392 -383 16.9127 0.00359
NP_441543.1_2 Reverse -385 -394 15.9293 0.00518
NP_441543.1_2 Forward -250 -241 4.91628 0.213
NP_441543.1_2 Forward -165 -156 4.12963 0.279
NP_442845.1_2 Reverse -296 -310 6.58777 0.207
NP_442845.1_2 Forward -399 -385 4.81781 0.251
NP_442845.1_2 Reverse -378 -392 4.12949 0.267
NP_441551.1_5 Reverse -380 -396 9.89093 0.201
NP_441319.1_8 Reverse -378 -396 7.29564 0.261
NP_441918.1_7 Forward -167 -148 -2.26216 0.297
NP_441469.1_8 Forward -394 -385 6.5879 0.227
NP_441469.1_8 Reverse -383 -392 6.48957 0.227
NP_442315.1_2 Forward -230 -218 9.47875 0.291
NP_443064.1_6 Forward -166 -156 15.3787 0.0796
NP_443064.1_6 Forward -393 -383 12.5669 0.0796
NP_443064.1_6 Reverse -384 -394 10.8217 0.13
NP_442578.1_7 Forward -392 -385 14.5921 0.026
NP_442578.1_7 Reverse -385 -392 14.5921 0.026
NP_442578.1_7 Forward -250 -243 9.38056 0.138
NP_441462.1_2 Reverse -384 -394 20.2362 0.000805
NP_441462.1_2 Forward -393 -383 11.5831 0.00406
NP_441462.1_2 Reverse -157 -167 0.865012 0.117
NP_441621.1_7 Reverse -382 -396 4.62115 0.0934
NP_441621.1_7 Forward -395 -381 -2.85201 0.188
NP_443062.1_1 Forward -311 -293 5.32818 0.231
NP_443062.1_1 Forward -393 -375 4.06059 0.276
NP_443062.1_6 Reverse -149 -168 9.0459 0.133
NP_443062.1_6 Reverse -376 -395 0.687771 0.291
NP_442204.1_1 Forward -397 -386 11.3667 0.0565
NP_442204.1_1 Reverse -153 -164 7.82682 0.112
NP_442204.1_1 Reverse -380 -391 2.41861 0.266
NP_440516.1_8 Forward -393 -384 16.9127 0.00442
NP_440516.1_8 Reverse -384 -393 16.9127 0.00442
NP_440516.1_8 Reverse -157 -166 5.80125 0.112
NP_442428.1_4 Forward -394 -375 6.88262 0.194
NP_442428.1_5 Forward -392 -385 15.8704 0.0124
NP_442428.1_5 Reverse -385 -392 15.8704 0.0124
NP_441267.1_1 Reverse -25 -44 4.81767 0.227
NP_442859.1_2 Reverse -379 -398 2.26107 0.28
NP_440618.1_1 Reverse -318 -337 -4.52377 0.213
NP_440673.1_3 Forward -391 -384 12.4288 0.0426
NP_440673.1_3 Reverse -386 -393 12.4288 0.0426
NP_440865.1_9 Forward -399 -380 9.24257 0.0586
NP_441052.1_2 Forward -393 -383 19.9412 0.00106
NP_441052.1_2 Reverse -384 -394 10.4031 0.0285
NP_441052.1_2 Forward -166 -156 7.15819 0.0797
NP_441052.1_2 Forward -344 -334 1.65166 0.233
NP_442219.1_8 Reverse -374 -393 6.71761 0.291
NP_442219.1_9 Forward -392 -383 17.7976 0.00718
NP_442219.1_9 Reverse -385 -394 8.25953 0.0681
NP_440436.1_4 Forward -392 -383 17.2072 0.00233
NP_440436.1_4 Reverse -385 -394 9.24241 0.0871
NP_440436.1_4 Reverse -138 -147 8.06244 0.118
NP_440436.1_4 Forward -165 -156 4.42421 0.265
NP_441884.1_9 Forward -396 -377 -12.1936 0.138
NP_442412.1_3 Forward -164 -145 12.7825 0.248
NP_440648.1_1 Forward -393 -374 6.09597 0.21
NP_441719.1_4 Forward -392 -385 16.3621 0.0124
NP_441719.1_4 Reverse -385 -392 16.3621 0.0124
NP_441719.1_6 Reverse -29 -48 8.35677 0.269
NP_441733.1_10 Reverse -381 -394 7.78743 0.15
NP_441004.1_1 Forward -393 -374 -12.3902 0.247
NP_441004.1_1 Reverse -139 -158 -16.1268 0.283
NP_442873.1_3 Reverse -374 -393 5.89851 0.248
NP_441115.1_4 Forward -394 -376 9.26148 0.221
NP_442206.1_7 Forward -42 -23 10.8159 0.295
NP_442206.1_10 Forward -393 -378 4.01147 0.179
NP_440328.1_4 Reverse -378 -397 3.34271 0.181
NP_440728.1_9 Forward -295 -277 15.1716 0.294
NP_443054.1_2 Forward -395 -381 0.88457 0.252
NP_442430.1_10 Reverse -374 -393 9.04509 0.3
NP_441851.1_2 Reverse -254 -273 7.57094 0.181
NP_441851.1_10 Reverse -383 -393 15.8113 0.00552
NP_441851.1_10 Forward -394 -384 8.53483 0.114
NP_442622.1_1 Forward -394 -375 -11.9969 0.257
NP_442515.1_1 Reverse -383 -397 3.04785 0.125
NP_442515.1_1 Forward -75 -61 -2.36035 0.273
NP_442515.1_1 Forward -394 -380 -4.22864 0.298
NP_440165.1_5 Forward -394 -375 -7.96535 0.286
NP_440940.1_7 Reverse -374 -392 9.45814 0.164
NP_441409.1_6 Reverse -378 -397 10.2259 0.024
NP_441409.1_6 Forward -399 -380 -7.27704 0.146
NP_441409.1_6 Forward -172 -153 -9.44032 0.184
NP_441107.1_10 Forward -388 -374 20.1574 0.231
NP_440432.1_9 Reverse -385 -400 -4.05167 0.196
NP_440431.1_3 Forward -394 -375 -11.5053 0.286
NP_442006.1_2 Forward -387 -370 -16.5791 0.256
NP_441570.1_1 Forward -393 -375 0.805796 0.0361
NP_441570.1_1 Forward -166 -148 -10.1089 0.16
NP_440078.1_10 Forward -393 -374 5.60432 0.224
NP_441078.1_4 Forward -393 -384 19.6659 0.0007
NP_441078.1_4 Reverse -384 -393 19.6659 0.0007
NP_441078.1_4 Forward -166 -157 0.393051 0.205
NP_441078.1_4 Reverse -157 -166 -0.000272808 0.205
NP_442729.1_8 Reverse -380 -393 8.67241 0.125
NP_442729.1_8 Forward -170 -157 8.37742 0.125
NP_441663.1_8 Forward -399 -380 -2.16383 0.259
NP_442348.1_2 Reverse -126 -135 12.2911 0.218
NP_442443.1_1 Forward -296 -277 -4.13045 0.268
NP_440526.1_3 Forward -392 -381 17.7577 0.0398
NP_441432.1_8 Reverse -383 -392 16.8143 0.00595
NP_441432.1_8 Forward -394 -385 16.8143 0.00595
NP_441432.1_9 Reverse -68 -81 9.18011 0.28
NP_442320.1_8 Forward -399 -385 -0.983719 0.0817
NP_442320.1_8 Reverse -378 -392 -2.36035 0.0871
NP_441732.1_2 Forward -397 -381 3.00846 0.0141
NP_441732.1_2 Reverse -380 -396 -15.9694 0.164
NP_440760.1_1 Forward -393 -374 -15.3402 0.146
NP_440760.1_1 Reverse -157 -176 -20.8467 0.225
NP_440578.1_8 Forward -166 -147 11.4058 0.262
NP_441057.1_3 Forward -341 -322 -10.7186 0.214
NP_440913.1_1 Forward -395 -377 10.1472 0.175
NP_440713.1_4 Reverse -374 -393 21.3373 0.0133
NP_442489.1_2 Reverse -20 -39 8.25926 0.171
NP_442489.1_7 Forward -393 -384 20.1576 0.000695
NP_442489.1_7 Reverse -384 -393 20.1576 0.000695
NP_442489.1_7 Forward -166 -157 0.884706 0.145
NP_442489.1_7 Reverse -157 -166 0.491382 0.178
NP_442079.1_7 Forward -392 -373 13.2741 0.0806
NP_440559.1_1 Forward -392 -383 17.4043 0.00658
NP_440559.1_1 Reverse -385 -394 8.65285 0.0586
NP_440559.1_1 Forward -165 -156 4.42462 0.277
NP_441659.2_8 Reverse -384 -394 20.9245 0.000805
NP_441659.2_8 Forward -393 -383 18.1713 0.00133
NP_441659.2_8 Reverse -157 -167 6.17489 0.084
NP_441659.2_8 Forward -68 -58 -0.216628 0.292
NP_442913.1_10 Reverse -98 -117 -6.1954 0.296
NP_439956.1_7 Reverse -306 -325 1.17943 0.292
NP_442008.1_2 Reverse -381 -400 4.52268 0.237
NP_442346.1_2 Forward -398 -379 5.60432 0.281
NP_442346.1_5 Reverse -383 -393 16.6963 0.00248
NP_442346.1_5 Forward -394 -384 16.303 0.00248
NP_442346.1_5 Reverse -156 -166 10.8948 0.0813
NP_442346.1_5 Forward -167 -157 4.89658 0.269
NP_440545.1_3 Reverse -380 -397 14.6902 0.0144
NP_440545.1_3 Forward -397 -380 8.39697 0.0444
NP_440025.1_3 Reverse -276 -290 12.1598 0.269
NP_440486.1_6 Forward -154 -135 7.47261 0.268
NP_440486.1_6 Forward -394 -375 5.99764 0.284
NP_440486.1_6 Reverse -144 -163 5.40766 0.297
NP_440010.1_4 Forward -397 -378 8.16011 0.185
NP_440010.1_4 Reverse -374 -393 5.30853 0.203
NP_440010.1_10 Reverse -372 -391 9.14423 0.211
NP_440010.1_10 Reverse -145 -164 6.98095 0.226
NP_442603.1_7 Forward -393 -379 19.2718 0.0116
NP_442603.1_7 Reverse -157 -171 7.96378 0.191
NP_442603.1_7 Forward -166 -152 6.68548 0.232
NP_441502.1_3 Forward -395 -376 8.75091 0.215
NP_441833.1_4 Forward -392 -385 15.9687 0.0124
NP_441833.1_4 Reverse -385 -392 15.9687 0.0124
NP_441329.1_1 Forward -222 -203 18.0953 0.0857
NP_441895.1_7 Forward -290 -271 0.982764 0.0698
NP_442162.1_9 Forward -392 -385 16.2637 0.0124
NP_442162.1_9 Reverse -385 -392 16.2637 0.0124
NP_440671.1_4 Reverse -151 -165 8.65272 0.193
NP_440671.1_4 Forward -399 -385 7.07942 0.227
NP_442404.1_9 Forward -390 -376 8.25877 0.296
NP_440772.1_6 Forward -29 -10 6.39097 0.294
NP_442140.1_3 Forward -392 -382 13.5497 0.0542
NP_442140.1_3 Reverse -385 -395 4.69992 0.238
NP_440875.1_9 Reverse -386 -396 16.5483 0.0145
NP_440875.1_9 Forward -391 -381 9.3454 0.233
NP_441813.1_3 Reverse -310 -329 12.9769 0.296
NP_441813.1_5 Forward -395 -385 18.1713 0.00743
NP_441813.1_5 Reverse -382 -392 8.73149 0.0367
NP_440590.1_4 Forward -392 -379 14.7689 0.0106
NP_440590.1_4 Reverse -385 -398 -5.38892 0.277
NP_440567.1_1 Forward -392 -378 8.25939 0.0597
NP_440567.1_1 Reverse -385 -399 2.94952 0.157
NP_442497.1_10 Reverse -385 -394 17.601 0.00813
NP_442497.1_10 Forward -392 -383 10.4228 0.0087
NP_442497.1_10 Reverse -158 -167 0.196389 0.208
NP_440821.1_4 Reverse -382 -392 17.9746 0.00497
NP_440821.1_4 Forward -395 -385 2.24165 0.131
NP_440821.1_4 Forward -168 -158 0.373358 0.18
NP_440227.1_2 Forward -20 -4 10.9733 0.28
NP_441239.1_9 Forward -395 -383 13.0187 0.0389
NP_441239.1_9 Reverse -382 -394 7.11881 0.169
NP_441727.1_3 Forward -400 -381 15.5357 0.116
NP_441892.1_1 Reverse -375 -392 1.41547 0.152
NP_440665.1_1 Forward -393 -374 -9.63698 0.244
NP_440665.1_1 Forward -166 -147 -16.8151 0.293
NP_442044.1_1 Forward -398 -379 -3.93378 0.176
NP_440212.1_9 Reverse -186 -205 3.34839 0.219
NP_442138.1_10 Forward -166 -147 4.52268 0.106
NP_440546.1_4 Reverse -384 -394 13.5365 0.0459
NP_440546.1_4 Reverse -302 -312 10.7247 0.108
NP_440546.1_4 Forward -393 -383 10.046 0.109
NP_441230.1_5 Forward -398 -379 -0.688862 0.292
NP_440462.1_6 Forward -395 -385 18.7612 0.00454
NP_440462.1_6 Reverse -382 -392 10.3048 0.0396
NP_440868.1_4 Forward -397 -385 14.7886 0.0169
NP_440868.1_4 Reverse -380 -392 7.4138 0.0691
NP_442402.1_4 Forward -296 -277 2.26028 0.166
NP_442402.1_4 Reverse -69 -88 -9.44104 0.29
NP_442402.1_4 Forward -162 -143 -9.73604 0.292
NP_441848.1_4 Forward -60 -44 7.64616 0.288
NP_440696.1_3 Reverse -307 -325 1.69077 0.217
NP_442039.1_4 Forward -392 -385 15.1821 0.0124
NP_442039.1_4 Reverse -385 -392 15.1821 0.0124
NP_442039.1_7 Forward -78 -68 11.8781 0.257
NP_442380.1_10 Reverse -374 -392 7.88563 0.267
NP_440008.1_9 Reverse -151 -170 7.17762 0.283
NP_442696.1_6 Reverse -27 -46 -12.4886 0.252
NP_442837.1_3 Forward -392 -385 15.7721 0.0124
NP_442837.1_3 Reverse -385 -392 15.7721 0.0124
NP_440160.1_2 Reverse -279 -298 -7.86702 0.286
NP_442053.1_1 Forward -393 -384 18.3876 0.0007
NP_442053.1_1 Reverse -384 -393 18.3876 0.0007
NP_440505.1_3 Forward -395 -385 17.188 0.00332
NP_440505.1_3 Reverse -382 -392 16.598 0.00683
NP_440505.1_3 Reverse -155 -165 5.87989 0.206
NP_441252.1_6 Reverse -277 -284 14.3954 0.168
NP_440914.1_1 Forward -393 -383 17.5935 0.000537
NP_440914.1_1 Reverse -384 -394 16.3248 0.00196
NP_440914.1_1 Forward -166 -156 14.1778 0.0178
NP_440914.1_1 Reverse -32 -42 8.81029 0.186
NP_441011.1_8 Reverse -385 -394 16.6177 0.00602
NP_441011.1_8 Forward -392 -383 8.25953 0.144
NP_442101.1_10 Forward -308 -289 0.58944 0.0913
NP_442533.1_6 Forward -393 -384 17.2076 0.00137
NP_442533.1_6 Reverse -384 -393 17.2076 0.00137
NP_442533.1_6 Forward -311 -302 11.7994 0.0386
NP_442533.1_6 Forward -166 -157 5.11294 0.155
NP_442322.1_4 Forward -109 -92 -0.0601847 0.21
NP_441482.1_7 Forward -399 -385 6.58777 0.0271
NP_441482.1_7 Forward -317 -303 -5.21195 0.174
NP_441482.1_7 Reverse -378 -392 -8.45687 0.193
NP_441482.1_7 Forward -172 -158 -10.8168 0.216
NP_441482.1_7 Reverse -151 -165 -11.4068 0.262
NP_439944.1_9 Forward -392 -382 19.1546 0.00329
NP_439944.1_9 Reverse -385 -395 9.12481 0.1
NP_439944.1_9 Reverse -158 -168 5.5849 0.239
NP_441697.1_5 Reverse -186 -205 -7.78302 0.249
NP_441028.1_6 Reverse -373 -383 3.42118 0.296
NP_440116.1_8 Forward -392 -373 -5.60541 0.194
NP_441527.1_4 Forward -71 -52 -8.26048 0.242
NP_440115.1_6 Reverse -381 -391 18.9579 0.0139
NP_440115.1_6 Forward -396 -386 14.0414 0.0615
NP_440007.1_9 Reverse -380 -394 1.47456 0.285
NP_440007.1_9 Forward -397 -383 0.786239 0.29
NP_441347.1_5 Forward -399 -385 12.782 0.238
NP_441972.1_5 Forward -392 -373 1.76941 0.127
NP_441106.1_1 Forward -394 -385 18.486 0.0028
NP_441106.1_1 Reverse -383 -392 9.63616 0.0311
NP_440480.1_10 Reverse -282 -296 16.4202 0.224
NP_439903.1_6 Forward -396 -377 3.14526 0.213
NP_439903.1_6 Forward -169 -150 1.08032 0.255
NP_441286.1_1 Forward -394 -382 12.232 0.00999
NP_441286.1_1 Reverse -156 -168 11.5437 0.0125
NP_441286.1_1 Reverse -383 -395 5.93884 0.0258
NP_442674.1_2 Reverse -258 -277 9.83255 0.213
NP_442674.1_10 Forward -347 -328 12.2908 0.21
NP_440670.1_8 Forward -393 -384 18.3876 0.000699
NP_440670.1_8 Reverse -384 -393 18.3876 0.000699
NP_440670.1_8 Forward -166 -157 6.98123 0.0882
NP_440886.1_7 Forward -394 -384 8.04271 0.0805
NP_440886.1_7 Reverse -383 -393 7.94438 0.0805
NP_442614.1_2 Forward -393 -379 8.55439 0.255
NP_441399.1_6 Reverse -127 -146 10.2251 0.297
NP_442072.1_9 Forward -394 -376 -21.3187 0.207
NP_441808.1_8 Forward -393 -374 5.89931 0.294
NP_440907.2_8 Forward -392 -382 10.8943 0.0969
NP_440907.2_8 Reverse -385 -395 9.616 0.103
NP_441463.1_3 Reverse -374 -393 -1.08219 0.135
NP_441463.1_6 Forward -395 -381 10.088 0.242
NP_441626.1_2 Forward -392 -385 15.7721 0.0124
NP_441626.1_2 Reverse -385 -392 15.7721 0.0124
NP_442794.1_1 Reverse -380 -392 13.0187 0.0721
NP_442794.1_1 Reverse -153 -165 7.61046 0.136
NP_442615.1_1 Reverse -375 -393 -2.0458 0.138
NP_441962.1_4 Forward -398 -379 -13.5702 0.275
NP_440387.1_1 Forward -393 -377 5.27008 0.0333
NP_440387.1_1 Forward -166 -150 -5.15301 0.217
NP_440387.1_1 Reverse -25 -41 -6.52964 0.292
NP_441431.1_2 Forward -396 -382 12.487 0.116
NP_441836.1_2 Forward -399 -380 8.55425 0.101
NP_441993.1_1 Reverse -378 -397 7.01447 0.176
NP_441993.1_1 Forward -399 -380 1.55686 0.274
NP_440114.1_10 Reverse -384 -398 12.1926 0.0885
NP_440293.1_3 Reverse -272 -291 -4.91709 0.268
NP_440766.1_4 Reverse -380 -394 7.76774 0.0871
NP_440422.1_10 Reverse -62 -81 6.43495 0.245
NP_440422.1_10 Reverse -2 -21 4.78914 0.281
NP_441237.1_9 Forward -392 -382 14.9263 0.0242
NP_440457.1_1 Reverse -380 -392 6.62715 0.116
NP_440457.1_1 Forward -397 -385 0.727295 0.25
NP_440798.1_6 Reverse -385 -398 0.707601 0.251
NP_442680.1_5 Forward -248 -229 -0.709294 0.292
NP_442297.1_4 Forward -397 -378 14.1832 0.211
NP_441436.1_2 Forward -57 -38 -0.688862 0.277
NP_442509.1_9 Forward -393 -383 8.14104 0.192
NP_442509.1_9 Reverse -384 -394 8.04271 0.192
NP_442509.1_9 Reverse -157 -167 7.64939 0.21
NP_440554.1_4 Reverse -385 -395 17.9746 0.0131
NP_440554.1_4 Forward -392 -382 6.37155 0.123
NP_442862.1_3 Forward -299 -282 4.07041 0.296
NP_441885.1_5 Forward -393 -383 20.9245 0.000538
NP_441885.1_5 Reverse -384 -394 11.3864 0.00668
NP_441885.1_5 Forward -166 -156 1.74999 0.0991
NP_441885.1_5 Forward -40 -30 -0.904945 0.241
NP_441885.1_5 Forward -311 -301 -1.69159 0.277
NP_442341.1_3 Reverse -292 -311 7.57094 0.215
NP_442341.1_7 Forward -394 -380 9.93102 0.0692
NP_442341.1_7 Forward -167 -153 5.80112 0.145
NP_442341.1_9 Forward -395 -381 13.2736 0.0858
NP_441756.1_5 Reverse -380 -399 5.211 0.187
NP_441173.1_9 Reverse -68 -76 13.2937 0.17
NP_443000.1_7 Forward -395 -385 20.3345 0.00223
NP_443000.1_7 Reverse -382 -392 10.4031 0.0345
NP_443000.1_7 Reverse -155 -165 4.40493 0.199
NP_440275.1_3 Reverse -382 -392 17.6796 0.0102
NP_440275.1_3 Forward -395 -385 16.1063 0.0155
NP_440091.1_1 Reverse -380 -392 1.41561 0.197
NP_442354.1_2 Reverse -142 -161 1.67108 0.299
NP_440679.1_5 Forward -390 -371 7.66927 0.292
NP_440127.1_2 Forward -53 -34 18.8597 0.0948
NP_442638.1_3 Reverse -267 -286 11.8883 0.298
NP_440616.1_3 Reverse -373 -392 18.0962 0.257
NP_439951.1_3 Forward -367 -350 9.38028 0.275
NP_440149.1_8 Forward -393 -374 -1.37718 0.159
NP_442214.1_1 Forward -148 -129 9.53756 0.276
NP_441105.1_3 Forward -79 -60 -6.88371 0.243
NP_440216.1_1 Reverse -384 -398 15.1426 0.00419
NP_440216.1_1 Forward -393 -379 -10.3252 0.145
NP_440172.1_1 Reverse -384 -394 17.5813 0.00421
NP_440172.1_1 Forward -393 -383 15.0247 0.00945
NP_440172.1_1 Forward -166 -156 2.63497 0.274
NP_442788.1_5 Reverse -381 -400 15.4374 0.284
NP_442015.1_10 Reverse -153 -166 13.4906 0.0354
NP_442015.1_10 Reverse -380 -393 12.2123 0.0372
NP_442015.1_10 Forward -397 -384 3.75586 0.178
NP_442015.1_10 Reverse -52 -65 0.510939 0.224
NP_441226.1_7 Forward -392 -385 14.4934 0.0123
NP_441226.1_7 Reverse -385 -392 14.4934 0.0123
NP_441226.1_7 Forward -310 -303 8.29857 0.205
NP_441111.1_7 Forward -392 -384 18.7023 0.00294
NP_441111.1_7 Reverse -385 -393 18.7023 0.00294
NP_442379.1_10 Reverse -377 -394 -1.53445 0.223
NP_442379.1_10 Reverse -150 -167 -4.28772 0.291
NP_441177.1_6 Reverse -280 -299 14.9449 0.287
NP_441766.1_2 Forward -393 -384 17.5026 0.00297
NP_441766.1_2 Reverse -384 -393 17.5026 0.00297
NP_440416.1_9 Reverse -377 -396 -5.11376 0.0791
NP_440416.1_9 Forward -400 -381 -14.7502 0.18
NP_442116.1_6 Forward -19 -2 6.25912 0.283
NP_441940.1_4 Forward -395 -376 6.4893 0.294
NP_440261.1_5 Forward -392 -379 6.50913 0.0332
NP_440261.1_5 Reverse -385 -398 -2.83231 0.0932
NP_440261.1_5 Reverse -303 -316 -4.50394 0.151
NP_440261.1_10 Forward -60 -46 12.1926 0.266
NP_440988.1_10 Reverse -382 -396 5.67333 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGACCAGGCGATCGCCACGGAGGTGAATGACTTTGATGCCTTTTATCCAGCGGAGGATTATCACCAGGATTTTGTCCAACGGAATCCGGCCCATCCCTATGTGTTGGTCCATGATTTGCCCAAACTCCGAAAATTTCGTCAGCAGTATAGCGATAAATTAAAAGCCCAAAGTTAGGGGTTAGTAAACCTTGTTTAAATCAAGACTTACTTTTGTCTAGTTATAAGCAGTCTAGGACGATCACCATGGTCGTCCAGCAAGGGCTTAACAAGGCCCTAAATGACTGTCAATCCACTCTCAGCCCCTCCTTTAATAGGCAAGAAAATTGGCAAAAGCGACCTTCAGAAGGACAAAAATAGTGGGCTTTGGCTAACTACCAGAGAAATTACTGAACAAAATCA

CDS

ATGACCGATATTCAAAAACAGTTACAAGAAGAACTAGCCCCCATGGATTGGGGCACCATTATTCCCCACGCCAAACGGGATGCGGTGATTGTGGTGGATAGTAGTTTAGATTTGCTCTCCGTTGGTCTGGCGATCGCCAAGGATGAAGTTAACCAAGTCAACCATTGGATTAGCGAATTATTGATCCATAAGCCCACGGAGAAGGAATTGACCGATTGGAACGATGATCCAGAACGGGAATTTCAAACCCTGATTGTGCAACCCTATGTGTTAGTACAACCCGGTTGA

Protein

MTDIQKQLQEELAPMDWGTIIPHAKRDAVIVVDSSLDLLSVGLAIAKDEVNQVNHWISELLIHKPTEKELTDWNDDPEREFQTLIVQPYVLVQPG