Your browser is old and dusty. Try Google Chrome!

Details for ssr2972

ORF ssr2972
Accession NP_440102.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -11 -25 14.0609 0.0392
NP_441061.1_2 Forward -18 -4 2.06454 0.179
NP_441061.1_2 Reverse -190 -204 1.96621 0.179
NP_440557.1_1 Forward -197 -178 9.73422 0.125
NP_440557.1_1 Reverse -11 -30 5.89931 0.154
NP_440795.1_7 Forward -197 -190 14.6904 0.0123
NP_440795.1_7 Reverse -190 -197 14.6904 0.0123
NP_440795.1_7 Forward -18 -11 14.6904 0.0123
NP_440795.1_7 Reverse -11 -18 14.6904 0.0123
NP_441418.1_6 Reverse -10 -29 -0.0988766 0.00981
NP_441418.1_6 Reverse -189 -208 -2.85214 0.0208
NP_441418.1_6 Forward -198 -179 -20.7484 0.125
NP_441418.1_6 Forward -210 -191 -29.3032 0.221
NP_442291.1_5 Reverse -188 -204 7.04003 0.0657
NP_440897.1_6 Forward -374 -355 5.80018 0.111
NP_441453.1_1 Forward -26 -8 12.5064 0.0973
NP_441453.1_4 Reverse -189 -197 16.539 0.00633
NP_441453.1_4 Reverse -10 -18 16.539 0.00633
NP_441453.1_4 Forward -198 -190 16.539 0.00633
NP_441453.1_4 Forward -19 -11 16.539 0.00633
NP_442151.1_6 Forward -198 -184 17.6008 0.00997
NP_442151.1_6 Forward -19 -5 10.816 0.114
NP_442151.1_6 Reverse -189 -203 8.45605 0.172
NP_442151.1_6 Reverse -10 -24 5.01447 0.298
NP_441818.1_1 Forward -197 -186 17.1677 0.00948
NP_441818.1_1 Reverse -190 -201 15.6928 0.0257
NP_441818.1_1 Forward -18 -7 9.20294 0.25
NP_440226.1_1 Reverse -189 -208 19.5673 0.0109
NP_440226.1_1 Reverse -10 -29 12.2908 0.0456
NP_440226.1_1 Forward -198 -179 2.45773 0.263
NP_441465.1_8 Forward -385 -367 8.57394 0.235
NP_442173.1_1 Forward -197 -189 15.4574 0.00633
NP_442173.1_1 Forward -18 -10 15.4574 0.00633
NP_442173.1_1 Reverse -190 -198 15.4574 0.00633
NP_442173.1_1 Reverse -11 -19 15.4574 0.00633
NP_442752.1_4 Forward -198 -191 13.8055 0.0199
NP_442752.1_4 Reverse -189 -196 13.8055 0.0199
NP_442752.1_4 Forward -19 -12 13.8055 0.0199
NP_442752.1_4 Reverse -10 -17 13.8055 0.0199
NP_442752.1_4 Forward -374 -367 12.1338 0.0546
NP_443027.1_4 Reverse -8 -18 16.2046 0.0437
NP_443027.1_4 Forward -21 -11 14.828 0.0437
NP_443027.1_4 Forward -200 -190 13.1564 0.0521
NP_443027.1_4 Reverse -187 -197 7.35486 0.24
NP_441812.1_3 Forward -20 -6 16.2242 0.0755
NP_442975.1_10 Reverse -185 -199 13.5686 0.0459
NP_442975.1_10 Forward -23 -9 12.782 0.0459
NP_442975.1_10 Reverse -6 -20 3.63724 0.252
NP_442975.1_10 Forward -202 -188 2.94893 0.266
NP_440784.1_7 Forward -197 -190 15.9687 0.0123
NP_440784.1_7 Reverse -190 -197 15.9687 0.0123
NP_440784.1_7 Forward -18 -11 15.9687 0.0123
NP_440784.1_7 Reverse -11 -18 15.9687 0.0123
NP_442909.1_7 Reverse -190 -204 18.9768 0.0437
NP_442909.1_7 Forward -18 -4 6.19383 0.255
NP_440061.1_9 Reverse -187 -201 12.782 0.0922
NP_441054.1_4 Reverse -179 -197 1.19912 0.173
NP_439979.1_2 Reverse -10 -29 13.1758 0.142
NP_442062.1_8 Reverse -10 -20 19.4496 0.000558
NP_442062.1_8 Forward -198 -188 17.6796 0.00193
NP_442062.1_8 Reverse -189 -199 17.3846 0.00193
NP_442062.1_8 Forward -19 -9 10.3048 0.0493
NP_441900.1_2 Reverse -24 -42 -2.9315 0.279
NP_440304.1_4 Reverse -8 -18 19.9412 0.00364
NP_440304.1_4 Reverse -187 -197 18.9579 0.00406
NP_440304.1_4 Forward -21 -11 10.8948 0.051
NP_440304.1_4 Forward -200 -190 9.91146 0.051
NP_442242.1_4 Forward -197 -190 14.3954 0.0124
NP_442242.1_4 Reverse -190 -197 14.3954 0.0124
NP_442242.1_4 Forward -18 -11 14.3954 0.0124
NP_442242.1_4 Reverse -11 -18 14.3954 0.0124
NP_440044.1_8 Reverse -190 -209 8.55425 0.0739
NP_441781.1_7 Forward -198 -179 3.14605 0.194
NP_441619.1_8 Reverse -73 -87 6.29216 0.299
NP_441208.1_9 Forward -201 -187 6.3911 0.246
NP_441208.1_9 Reverse -7 -21 5.60446 0.267
NP_441594.1_6 Forward -43 -24 4.62101 0.216
NP_440370.1_10 Forward -207 -188 7.66927 0.251
NP_440132.1_1 Forward -21 -3 7.78729 0.288
NP_442110.1_7 Forward -198 -184 11.6026 0.0595
NP_442110.1_7 Forward -19 -5 10.4227 0.0684
NP_442110.1_7 Forward -349 -335 -0.197071 0.276
NP_440273.1_3 Forward -315 -296 5.40766 0.253
NP_441083.1_5 Reverse -189 -199 20.3345 0.00053
NP_441083.1_5 Forward -198 -188 19.3512 0.000718
NP_441083.1_5 Reverse -10 -20 11.3864 0.0159
NP_441083.1_5 Forward -19 -9 11.2881 0.0159
NP_441083.1_5 Reverse -365 -375 6.96153 0.0717
NP_442827.1_8 Forward -27 -8 17.8948 0.0295
NP_442827.1_8 Forward -206 -187 9.83173 0.0665
NP_442827.1_8 Reverse -2 -21 2.35861 0.162
NP_441434.1_1 Reverse -320 -334 8.60589 0.254
NP_441434.1_7 Reverse -12 -26 4.12949 0.225
NP_441738.1_2 Forward -196 -189 15.28 0.0102
NP_441738.1_2 Reverse -191 -198 15.28 0.0102
NP_441738.1_2 Forward -17 -10 15.28 0.0102
NP_441738.1_2 Reverse -12 -19 15.28 0.0102
NP_441558.1_5 Reverse -187 -206 14.5524 0.0485
NP_441558.1_5 Reverse -8 -27 13.6675 0.0561
NP_441558.1_5 Forward -200 -181 10.3242 0.1
NP_441558.1_5 Forward -282 -263 5.60432 0.245
NP_440209.1_1 Reverse -189 -197 18.1123 0.00295
NP_440209.1_1 Reverse -10 -18 18.1123 0.00295
NP_440209.1_1 Forward -198 -190 18.1123 0.00295
NP_440209.1_1 Forward -19 -11 18.1123 0.00295
NP_442889.1_8 Reverse -186 -200 11.2087 0.0735
NP_442889.1_8 Forward -22 -8 10.2254 0.0882
NP_442889.1_8 Reverse -362 -376 4.22722 0.27
NP_440447.1_6 Forward -27 -9 0.117479 0.295
NP_441713.1_1 Forward -25 -6 -5.9004 0.114
NP_441713.1_1 Reverse -4 -23 -15.7335 0.27
NP_441770.1_4 Reverse -20 -39 -5.21209 0.204
NP_440178.1_7 Reverse -188 -207 -2.26216 0.0355
NP_440178.1_7 Forward -20 -1 -21.83 0.241
NP_442570.1_3 Reverse -24 -43 -9.24366 0.296
NP_441716.1_1 Reverse -189 -203 18.0925 0.0205
NP_441716.1_1 Forward -198 -184 3.63784 0.259
NP_441716.1_2 Forward -111 -92 2.59002 0.236
NP_442111.1_4 Forward -199 -185 11.3077 0.0514
NP_442111.1_4 Reverse -9 -23 6.58777 0.12
NP_441163.1_9 Forward -28 -9 13.6675 0.236
NP_441495.1_1 Forward -206 -187 7.07928 0.292
NP_440906.1_5 Forward -197 -190 15.8704 0.0124
NP_440906.1_5 Reverse -190 -197 15.8704 0.0124
NP_440906.1_5 Forward -18 -11 15.8704 0.0124
NP_440906.1_5 Reverse -11 -18 15.8704 0.0124
NP_440747.1_10 Forward -201 -189 7.51213 0.00286
NP_440747.1_10 Reverse -186 -198 -1.92764 0.0192
NP_440747.1_10 Reverse -7 -19 -1.92764 0.0192
NP_440747.1_10 Forward -22 -10 -2.1243 0.0225
NP_441130.1_10 Reverse -187 -201 17.3058 0.0167
NP_441130.1_10 Forward -21 -7 10.4227 0.113
NP_441130.1_10 Forward -200 -186 8.16106 0.14
NP_441486.1_1 Forward -201 -187 12.8809 0.00979
NP_441486.1_1 Reverse -7 -21 10.6193 0.0194
NP_441486.1_1 Reverse -186 -200 5.21113 0.0384
NP_441486.1_1 Forward -22 -8 2.85119 0.074
NP_442634.1_4 Forward -21 -7 -1.96703 0.149
NP_442634.1_4 Reverse -8 -22 -2.16369 0.149
NP_442634.1_4 Forward -200 -186 -3.73699 0.164
NP_442634.1_4 Reverse -187 -201 -4.81863 0.22
NP_441265.1_3 Reverse -183 -197 1.76955 0.2
NP_441639.1_3 Forward -20 -1 3.04771 0.264
NP_440470.1_5 Forward -144 -125 6.73176 0.279
NP_440403.1_4 Forward -207 -188 8.75091 0.093
NP_440403.1_4 Forward -383 -364 -6.29373 0.23
NP_441014.1_10 Reverse -9 -28 6.98015 0.159
NP_441014.1_10 Reverse -364 -383 -1.8696 0.267
NP_442848.1_1 Forward -204 -190 16.7159 0.0143
NP_442848.1_1 Reverse -4 -18 -2.36035 0.263
NP_442848.1_1 Reverse -183 -197 -2.45868 0.263
NP_443018.1_3 Forward -197 -190 14.8871 0.0123
NP_443018.1_3 Reverse -190 -197 14.8871 0.0123
NP_443018.1_3 Forward -18 -11 14.8871 0.0123
NP_443018.1_3 Reverse -11 -18 14.8871 0.0123
NP_441316.1_7 Forward -21 -6 5.97809 0.109
NP_441316.1_7 Reverse -187 -202 -2.38005 0.251
NP_441634.1_8 Reverse -187 -201 3.24451 0.154
NP_441634.1_8 Forward -200 -186 -4.62196 0.295
NP_440376.1_1 Forward -198 -189 19.4693 0.000692
NP_440376.1_1 Reverse -189 -198 19.4693 0.000692
NP_440376.1_1 Forward -19 -10 19.4693 0.000692
NP_440376.1_1 Reverse -10 -19 19.4693 0.000692
NP_440376.1_1 Forward -374 -365 9.93116 0.0331
NP_440376.1_1 Reverse -26 -35 1.76968 0.242
NP_442687.1_7 Reverse -188 -198 18.5646 0.0028
NP_442687.1_7 Forward -20 -10 15.8113 0.0125
NP_442687.1_7 Reverse -9 -19 9.02648 0.0994
NP_442687.1_7 Forward -199 -189 8.92815 0.0994
NP_442946.1_7 Forward -383 -368 12.2259 0.284
NP_442958.1_3 Forward -209 -190 -2.95047 0.299
NP_441422.1_7 Reverse -187 -204 -4.18939 0.238
NP_441422.1_7 Forward -21 -4 -5.1727 0.247
NP_440691.1_10 Reverse -29 -48 8.45592 0.269
NP_440533.1_9 Forward -198 -179 6.88262 0.189
NP_440360.1_1 Forward -181 -163 14.178 0.295
NP_442658.1_1 Forward -21 -11 15.9091 0.00966
NP_442658.1_1 Reverse -187 -197 14.8275 0.0188
NP_442658.1_1 Reverse -8 -18 13.0576 0.04
NP_442658.1_1 Forward -200 -190 9.616 0.147
NP_442205.1_9 Reverse -4 -20 7.72835 0.105
NP_442205.1_9 Forward -204 -188 -1.90808 0.264
NP_442205.1_9 Forward -25 -9 -2.49807 0.271
NP_441414.1_9 Reverse -10 -29 -2.16383 0.111
NP_441487.1_9 Reverse -188 -207 13.8641 0.0454
NP_442937.1_5 Forward -203 -184 13.6675 0.0879
NP_441958.1_5 Reverse -9 -19 21.2195 0.000805
NP_441958.1_5 Reverse -188 -198 20.5312 0.000966
NP_441958.1_5 Forward -199 -189 12.2714 0.00183
NP_441958.1_5 Forward -20 -10 12.2714 0.00183
NP_442836.1_5 Forward -204 -185 5.50599 0.185
NP_440203.1_5 Forward -16 -6 11.6809 0.182
NP_439905.1_1 Forward -18 -5 10.934 0.204
NP_439905.1_1 Reverse -11 -24 10.049 0.216
NP_440984.1_7 Forward -203 -189 9.14437 0.131
NP_442911.1_2 Forward -29 -10 5.70265 0.0321
NP_442911.1_2 Reverse -179 -198 1.76941 0.0563
NP_442911.1_2 Forward -208 -189 -11.0136 0.296
NP_441580.1_6 Forward -30 -11 1.67108 0.117
NP_441580.1_6 Reverse -178 -197 -7.76869 0.246
NP_440153.1_5 Reverse -190 -204 17.6008 0.0482
NP_443055.1_3 Reverse -335 -354 11.4091 0.259
NP_440993.1_2 Reverse -184 -200 9.49831 0.119
NP_440993.1_3 Reverse -179 -198 -2.06626 0.294
NP_440602.1_8 Forward -198 -184 9.5377 0.298
NP_441348.1_3 Forward -203 -184 7.66927 0.256
NP_441099.1_5 Forward -29 -10 -3.93378 0.14
NP_441099.1_5 Reverse -179 -198 -9.14533 0.214
NP_442002.1_9 Reverse -188 -195 14.1004 0.074
NP_442002.1_9 Forward -36 -29 12.2322 0.185
NP_442002.1_9 Forward -20 -13 10.7572 0.185
NP_440809.1_9 Reverse -1 -19 -7.84733 0.225
NP_441294.1_7 Reverse -185 -199 15.4899 0.0239
NP_441294.1_7 Forward -202 -188 12.2263 0.107
NP_441646.1_1 Forward -205 -186 -0.787193 0.272
NP_442438.1_10 Reverse -184 -198 7.17775 0.0987
NP_442438.1_10 Forward -24 -10 4.42448 0.147
NP_442438.1_10 Reverse -5 -19 3.34284 0.163
NP_442438.1_10 Forward -203 -189 2.85119 0.168
NP_441000.1_6 Reverse -188 -202 3.8345 0.104
NP_441000.1_6 Forward -20 -6 -5.70361 0.29
NP_442771.1_1 Reverse -8 -26 0.805796 0.0892
NP_442771.1_1 Forward -200 -182 -4.99573 0.166
NP_441674.1_4 Reverse -22 -41 2.75272 0.228
NP_440147.1_4 Reverse -187 -200 13.3923 0.0326
NP_440147.1_4 Forward -21 -8 2.77255 0.202
NP_440147.1_4 Forward -200 -187 2.37923 0.208
NP_440147.1_4 Reverse -8 -21 2.37923 0.208
NP_441295.1_5 Reverse -178 -197 19.8623 0.0675
NP_441550.1_8 Forward -200 -190 16.7941 0.00906
NP_441550.1_8 Reverse -187 -197 15.4175 0.0132
NP_441550.1_8 Reverse -8 -18 13.0576 0.0273
NP_441550.1_8 Forward -21 -11 6.0761 0.214
NP_441916.1_7 Forward -19 -9 18.9579 0.00144
NP_441916.1_7 Reverse -10 -20 18.4663 0.00144
NP_441916.1_7 Forward -198 -188 16.893 0.00407
NP_441916.1_7 Reverse -189 -199 10.3048 0.0261
NP_441916.1_10 Reverse -181 -200 2.55606 0.244
NP_441041.1_4 Reverse -10 -29 2.85105 0.0693
NP_441041.1_4 Forward -198 -179 -8.26035 0.199
NP_441041.1_7 Reverse -186 -198 13.2483 0.049
NP_442396.1_5 Forward -23 -10 16.3422 0.0475
NP_442004.1_6 Forward -19 -5 17.9942 0.0534
NP_442004.1_6 Forward -198 -184 2.16287 0.273
NP_442004.1_6 Reverse -10 -24 2.16287 0.273
NP_441725.1_5 Forward -197 -187 21.0229 0.00533
NP_441725.1_5 Reverse -11 -21 11.2881 0.0247
NP_441725.1_5 Forward -18 -8 11.1898 0.0247
NP_441725.1_5 Reverse -190 -200 9.02648 0.0553
NP_439966.1_7 Forward -21 -11 18.4657 0.00473
NP_439966.1_7 Reverse -8 -18 14.8275 0.0177
NP_439966.1_7 Forward -200 -190 14.8275 0.0177
NP_439966.1_7 Reverse -187 -197 9.12434 0.119
NP_439966.1_7 Reverse -363 -373 7.15773 0.154
NP_439966.1_9 Forward -21 -12 0.983037 0.253
NP_439966.1_9 Forward -200 -191 0.884706 0.253
NP_442941.1_3 Forward -18 -8 19.9412 0.00262
NP_442941.1_3 Reverse -11 -21 11.4848 0.0116
NP_442941.1_3 Forward -197 -187 11.3864 0.0116
NP_442941.1_3 Reverse -190 -200 10.9931 0.0116
NP_440289.1_2 Reverse -186 -199 22.6354 0.00258
NP_440289.1_2 Forward -201 -188 5.03416 0.0636
NP_440289.1_2 Forward -22 -9 5.03416 0.0636
NP_440289.1_2 Reverse -7 -20 -2.73398 0.262
NP_440260.1_8 Reverse -24 -42 0.510803 0.199
NP_442281.1_1 Reverse -184 -198 20.2551 0.00194
NP_442281.1_1 Forward -24 -10 9.14375 0.0736
NP_442281.1_1 Forward -203 -189 7.3738 0.102
NP_442281.1_1 Reverse -5 -19 6.39049 0.127
NP_442575.1_8 Reverse -372 -391 -2.45882 0.242
NP_442256.1_2 Forward -200 -182 -8.92897 0.241
NP_440437.1_1 Reverse -183 -202 19.6656 0.0125
NP_441556.1_4 Forward -28 -9 11.2584 0.248
NP_440498.1_1 Forward -28 -10 8.96727 0.0786
NP_440498.1_1 Reverse -180 -198 5.03403 0.111
NP_440498.1_1 Reverse -1 -19 0.805796 0.212
NP_440498.1_1 Forward -207 -189 -2.0458 0.235
NP_442982.1_5 Reverse -179 -198 7.17762 0.135
NP_443030.1_4 Reverse -182 -201 -3.24547 0.251
NP_441644.1_6 Forward -19 -9 19.0557 0.000803
NP_441644.1_6 Reverse -189 -199 17.3841 0.00127
NP_441644.1_6 Forward -198 -188 15.7125 0.0048
NP_441644.1_6 Reverse -10 -20 10.1076 0.0628
NP_441644.1_6 Reverse -365 -375 5.68278 0.18
NP_440867.1_10 Forward -192 -173 9.63589 0.25
NP_442215.1_1 Reverse -6 -25 1.96607 0.296
NP_442215.1_2 Forward -200 -184 23.8546 0.00195
NP_442215.1_2 Reverse -362 -378 -5.93965 0.262
NP_440253.1_2 Reverse -189 -207 4.83737 0.1
NP_440929.1_8 Forward -198 -189 19.2726 0.000701
NP_440929.1_8 Reverse -189 -198 19.2726 0.000701
NP_440929.1_8 Forward -19 -10 19.2726 0.000701
NP_440929.1_8 Reverse -10 -19 19.2726 0.000701
NP_442933.1_10 Forward -198 -189 17.601 0.00325
NP_442933.1_10 Reverse -189 -198 17.601 0.00325
NP_442933.1_10 Forward -19 -10 17.601 0.00325
NP_442933.1_10 Reverse -10 -19 17.601 0.00325
NP_441751.2_8 Forward -18 -4 4.22782 0.0521
NP_441751.2_8 Reverse -190 -204 -3.147 0.134
NP_441751.2_8 Forward -197 -183 -3.83532 0.156
NP_441751.2_8 Reverse -11 -25 -3.83532 0.156
NP_442926.1_5 Forward -24 -5 12.1147 0.19
NP_442554.1_8 Reverse -190 -200 18.0729 0.00543
NP_442554.1_8 Forward -18 -8 16.9913 0.0065
NP_442554.1_8 Forward -197 -187 14.828 0.0108
NP_442554.1_8 Reverse -11 -21 13.8447 0.0145
NP_442554.1_8 Forward -373 -363 4.40493 0.188
NP_441762.1_7 Reverse -188 -200 11.2487 0.0142
NP_441762.1_7 Reverse -9 -21 2.98891 0.0676
NP_441762.1_7 Forward -20 -8 2.20226 0.0676
NP_441762.1_7 Forward -199 -187 -6.94252 0.284
NP_442142.1_4 Reverse -186 -199 13.8833 0.0324
NP_442142.1_4 Forward -22 -9 8.47516 0.113
NP_442142.1_4 Reverse -7 -20 8.2785 0.118
NP_442292.1_1 Reverse -190 -199 18.486 0.00229
NP_442292.1_1 Forward -18 -9 17.5026 0.00435
NP_442292.1_1 Reverse -11 -20 9.63616 0.0183
NP_442292.1_1 Forward -197 -188 9.53783 0.0183
NP_442292.1_5 Forward -202 -183 9.63589 0.138
NP_442476.1_6 Reverse -190 -204 9.73436 0.0801
NP_442476.1_6 Forward -18 -4 6.09611 0.13
NP_442476.1_6 Reverse -11 -25 4.42448 0.143
NP_442381.1_8 Forward -30 -11 -6.39206 0.16
NP_442381.1_8 Reverse -186 -205 -14.9469 0.29
NP_441523.1_6 Forward -39 -20 4.12936 0.261
NP_443009.1_5 Reverse -9 -20 19.626 0.00102
NP_443009.1_5 Forward -199 -188 15.7911 0.0107
NP_443009.1_5 Reverse -188 -199 11.1696 0.066
NP_443009.1_5 Forward -20 -9 7.82632 0.118
NP_442408.2_1 Forward -198 -179 -3.14714 0.241
NP_441715.1_4 Reverse -11 -21 16.303 0.0117
NP_441715.1_4 Forward -18 -8 14.238 0.0295
NP_441715.1_4 Reverse -190 -200 7.84651 0.107
NP_441715.1_4 Forward -197 -187 7.25653 0.108
NP_441198.1_5 Reverse -191 -204 13.49 0.206
NP_441198.1_8 Reverse -8 -18 13.2713 0.108
NP_441198.1_8 Reverse -187 -197 13.076 0.108
NP_440379.1_5 Forward -46 -27 -11.5053 0.297
NP_441468.1_1 Forward -197 -190 15.8704 0.0124
NP_441468.1_1 Reverse -190 -197 15.8704 0.0124
NP_441468.1_1 Forward -18 -11 15.8704 0.0124
NP_441468.1_1 Reverse -11 -18 15.8704 0.0124
NP_441020.2_6 Reverse -8 -25 20.0984 0.00619
NP_441020.2_6 Forward -200 -183 8.20031 0.205
NP_441015.1_10 Forward -203 -184 -3.04881 0.184
NP_441015.1_10 Reverse -5 -24 -6.29373 0.245
NP_441673.1_1 Forward -198 -189 20.8459 0.000698
NP_441673.1_1 Reverse -189 -198 20.8459 0.000698
NP_441673.1_1 Forward -19 -10 20.8459 0.000698
NP_441673.1_1 Reverse -10 -19 20.8459 0.000698
NP_441876.1_9 Reverse -303 -313 12.0743 0.267
NP_441826.1_2 Reverse -183 -197 14.6509 0.0196
NP_441826.1_2 Forward -204 -190 9.43936 0.0597
NP_441826.1_2 Reverse -365 -379 0.786239 0.172
NP_441393.1_2 Reverse -192 -211 11.7032 0.272
NP_442490.1_9 Forward -31 -12 -1.7705 0.196
NP_442868.1_6 Forward -200 -190 17.4829 0.012
NP_442868.1_6 Reverse -187 -197 9.22315 0.0527
NP_442868.1_6 Reverse -8 -18 1.06167 0.205
NP_442868.1_6 Forward -21 -11 0.963343 0.205
NP_441612.1_2 Reverse -189 -199 8.54929 0.21
NP_441612.1_2 Forward -37 -27 7.19391 0.26
NP_442427.1_8 Reverse -180 -199 9.43923 0.182
NP_442808.1_1 Forward -20 -10 18.4657 0.00201
NP_442808.1_1 Reverse -188 -198 8.73102 0.0481
NP_442808.1_1 Reverse -9 -19 8.73102 0.0481
NP_442808.1_1 Forward -199 -189 8.63269 0.0481
NP_442808.1_1 Reverse -364 -374 4.20782 0.203
NP_440145.1_3 Forward -208 -189 1.27776 0.129
NP_442542.1_2 Forward -200 -187 12.999 0.114
NP_442050.1_5 Reverse -8 -18 18.0724 0.00365
NP_442050.1_5 Reverse -187 -197 15.8108 0.0091
NP_442050.1_5 Forward -200 -190 15.6142 0.01
NP_442050.1_5 Forward -21 -11 9.12434 0.193
NP_442342.1_9 Forward -200 -184 5.6634 0.233
NP_440558.1_2 Reverse -180 -199 -7.08038 0.287
NP_441048.1_1 Forward -210 -191 20.059 0.122
NP_441518.1_3 Forward -29 -10 -8.26035 0.183
NP_441878.1_6 Reverse -188 -198 20.2362 0.0046
NP_441878.1_6 Reverse -9 -19 10.5014 0.0176
NP_441878.1_6 Forward -199 -189 10.4031 0.0176
NP_441878.1_6 Forward -20 -10 10.4031 0.0176
NP_441036.1_8 Forward -20 -10 17.7779 0.000554
NP_441036.1_8 Reverse -9 -19 15.713 0.00724
NP_441036.1_8 Reverse -188 -198 8.4365 0.174
NP_441036.1_8 Forward -199 -189 8.33817 0.174
NP_441557.1_5 Forward -198 -189 19.9609 0.000699
NP_441557.1_5 Reverse -189 -198 19.9609 0.000699
NP_441557.1_5 Forward -19 -10 19.9609 0.000699
NP_441557.1_5 Reverse -10 -19 19.9609 0.000699
NP_441445.1_1 Forward -207 -188 6.98095 0.138
NP_441445.1_1 Reverse -1 -20 4.62101 0.191
NP_442066.2_9 Forward -23 -10 11.524 0.154
NP_441308.1_8 Reverse -8 -18 13.353 0.218
NP_441308.1_8 Forward -21 -11 10.1081 0.22
NP_440101.1_3 Reverse -5 -24 3.73603 0.224
NP_440101.1_5 Reverse -182 -201 19.8623 0.0282
NP_442183.1_1 Reverse -10 -24 20.9441 0.00378
NP_442183.1_1 Forward -19 -5 17.5025 0.0107
NP_442183.1_1 Reverse -189 -203 13.9626 0.0376
NP_442183.1_1 Forward -198 -184 10.9143 0.078
NP_442397.1_9 Forward -198 -179 5.40766 0.246
NP_441459.1_8 Forward -26 -13 11.6223 0.286
NP_441574.1_1 Reverse -10 -29 -7.67036 0.293
NP_441574.1_1 Forward -31 -12 -7.76869 0.293
NP_441549.1_9 Forward -202 -184 2.96908 0.0925
NP_441549.1_9 Forward -23 -5 1.49411 0.101
NP_441549.1_9 Reverse -6 -24 -4.70074 0.198
NP_442347.1_2 Reverse -190 -199 12.4878 0.056
NP_442347.1_2 Reverse -11 -20 11.1111 0.056
NP_442347.1_2 Reverse -366 -375 3.7363 0.284
NP_442347.1_2 Forward -197 -188 3.34298 0.284
NP_442347.1_2 Forward -18 -9 3.34298 0.284
NP_441037.1_4 Reverse -187 -197 9.65667 0.21
NP_441037.1_4 Forward -200 -190 9.55921 0.21
NP_441037.1_4 Reverse -8 -18 7.31769 0.237
NP_441037.1_4 Forward -21 -11 7.02532 0.237
NP_441633.1_3 Forward -200 -187 3.36254 0.0699
NP_441633.1_3 Reverse -187 -200 -3.4223 0.177
NP_441633.1_3 Forward -21 -8 -3.91395 0.177
NP_441633.1_3 Reverse -296 -309 -5.48725 0.236
NP_441633.1_3 Reverse -8 -21 -5.88057 0.236
NP_440136.1_2 Forward -197 -190 15.9687 0.0123
NP_440136.1_2 Reverse -190 -197 15.9687 0.0123
NP_440136.1_2 Forward -18 -11 15.9687 0.0123
NP_440136.1_2 Reverse -11 -18 15.9687 0.0123
NP_442590.1_10 Forward -204 -185 8.16093 0.213
NP_442998.1_10 Forward -196 -189 15.5754 0.0102
NP_442998.1_10 Reverse -191 -198 15.5754 0.0102
NP_442998.1_10 Forward -17 -10 15.5754 0.0102
NP_442998.1_10 Reverse -12 -19 15.5754 0.0102
NP_440299.1_1 Forward -23 -10 10.8351 0.0529
NP_440299.1_1 Reverse -185 -198 10.8351 0.0529
NP_440299.1_1 Forward -202 -189 9.85179 0.0646
NP_441799.1_1 Reverse -6 -20 19.7634 0.00609
NP_441799.1_1 Forward -23 -9 11.9953 0.0487
NP_441799.1_1 Forward -202 -188 7.47213 0.141
NP_441799.1_1 Reverse -185 -199 4.42388 0.25
NP_442802.1_6 Reverse -9 -28 -1.96717 0.204
NP_441007.1_10 Reverse -5 -18 12.9006 0.0499
NP_441007.1_10 Forward -203 -190 8.9674 0.108
NP_441007.1_10 Forward -24 -11 3.65753 0.182
NP_441007.1_10 Reverse -184 -197 1.00259 0.209
NP_440256.1_1 Reverse -7 -26 8.16093 0.0239
NP_440256.1_1 Forward -22 -3 -2.16383 0.113
NP_440256.1_1 Forward -201 -182 -8.06369 0.251
NP_440256.1_1 Reverse -362 -381 -8.35868 0.259
NP_440256.1_1 Forward -377 -358 -8.94866 0.27
NP_440256.1_1 Reverse -368 -387 -9.73531 0.287
NP_440087.1_1 Forward -207 -188 -8.35868 0.278
NP_441559.1_8 Reverse -360 -374 -6.49025 0.279
NP_440915.1_6 Forward -378 -364 10.1277 0.0346
NP_440915.1_6 Reverse -185 -199 6.3911 0.0826
NP_440915.1_6 Forward -23 -9 4.81781 0.0953
NP_440915.1_6 Forward -202 -188 3.8345 0.1
NP_440717.1_1 Forward -197 -178 5.99764 0.265
NP_441261.1_6 Reverse -312 -331 17.8131 0.195
NP_442785.1_7 Reverse -187 -201 8.45605 0.297
NP_441704.1_8 Forward -30 -11 12.0933 0.122
NP_442069.1_1 Forward -215 -196 16.6165 0.266
NP_442866.1_1 Forward -203 -184 3.53937 0.151
NP_441464.1_8 Reverse -189 -203 9.5377 0.189
NP_441464.1_10 Forward -114 -100 7.86607 0.287
NP_440026.1_4 Reverse -7 -26 11.3075 0.239
NP_440695.1_5 Reverse -10 -29 5.89931 0.17
NP_440695.1_6 Reverse -123 -137 9.53873 0.283
NP_441939.1_3 Reverse -11 -30 11.7008 0.111
NP_441939.1_3 Forward -197 -178 6.98095 0.217
NP_441494.1_6 Reverse -5 -18 8.57408 0.23
NP_442993.1_1 Reverse -10 -26 -1.41643 0.0906
NP_442993.1_1 Forward -19 -3 -3.38305 0.13
NP_442993.1_1 Forward -198 -182 -6.92296 0.146
NP_442386.1_9 Forward -20 -11 15.7322 0.0144
NP_442386.1_9 Forward -199 -190 13.8639 0.0289
NP_442386.1_9 Forward -344 -335 8.45576 0.197
NP_442386.1_9 Reverse -188 -197 6.39082 0.219
NP_442386.1_9 Reverse -9 -18 6.39082 0.219
NP_441340.1_5 Forward -197 -190 15.6737 0.0124
NP_441340.1_5 Reverse -190 -197 15.6737 0.0124
NP_441340.1_5 Forward -18 -11 15.6737 0.0124
NP_441340.1_5 Reverse -11 -18 15.6737 0.0124
NP_440586.1_8 Forward -197 -190 13.2151 0.026
NP_440586.1_8 Forward -18 -11 13.2151 0.026
NP_440586.1_8 Reverse -190 -197 13.2151 0.026
NP_440586.1_8 Reverse -11 -18 13.2151 0.026
NP_442251.1_6 Forward -197 -190 15.2804 0.0124
NP_442251.1_6 Reverse -190 -197 15.2804 0.0124
NP_442251.1_6 Forward -18 -11 15.2804 0.0124
NP_442251.1_6 Reverse -11 -18 15.2804 0.0124
NP_441262.1_3 Reverse -189 -196 14.7888 0.0223
NP_441262.1_3 Reverse -10 -17 14.7888 0.0223
NP_441262.1_3 Forward -198 -191 14.7888 0.0223
NP_441262.1_3 Forward -19 -12 14.7888 0.0223
NP_440027.1_3 Reverse -365 -383 2.57501 0.289
NP_443051.1_1 Reverse -9 -18 19.5676 0.00335
NP_443051.1_1 Reverse -188 -197 18.0926 0.00402
NP_443051.1_1 Forward -199 -190 10.4228 0.00754
NP_443051.1_1 Forward -20 -11 10.4228 0.00754
NP_440451.1_10 Reverse -366 -385 13.2733 0.188
NP_441232.1_10 Forward -30 -11 5.40766 0.173
NP_441232.1_10 Forward -209 -190 3.24438 0.233
NP_439937.1_8 Forward -21 -2 -0.983855 0.247
NP_439937.1_9 Reverse -188 -205 -14.4164 0.287
NP_439937.1_9 Forward -20 -3 -16.1864 0.287
NP_439937.1_9 Forward -199 -182 -16.678 0.287
NP_441657.1_5 Reverse -361 -380 -0.39387 0.238
NP_440439.1_1 Reverse -7 -20 18.5055 0.0105
NP_440439.1_1 Forward -201 -188 12.8023 0.0231
NP_440439.1_1 Forward -22 -9 7.98409 0.0577
NP_440372.1_2 Forward -197 -190 16.3621 0.0124
NP_440372.1_2 Reverse -190 -197 16.3621 0.0124
NP_440372.1_2 Forward -18 -11 16.3621 0.0124
NP_440372.1_2 Reverse -11 -18 16.3621 0.0124
NP_441803.1_2 Forward -203 -184 1.47442 0.23
NP_439977.1_5 Forward -25 -6 3.44104 0.159
NP_439977.1_5 Reverse -359 -378 1.47442 0.192
NP_440139.1_1 Reverse -4 -23 1.86696 0.245
NP_441572.1_7 Reverse -183 -202 7.57094 0.0769
NP_440267.1_2 Reverse -184 -198 6.48882 0.228
NP_442384.1_10 Forward -19 -6 15.1623 0.0113
NP_442384.1_10 Reverse -10 -23 14.1789 0.0163
NP_442384.1_10 Forward -198 -185 10.639 0.0428
NP_442384.1_10 Reverse -189 -202 3.95252 0.172
NP_441018.1_7 Forward -202 -183 6.4893 0.286
NP_442790.1_4 Forward -28 -9 -14.6519 0.278
NP_442262.1_10 Forward -197 -190 14.1988 0.0123
NP_442262.1_10 Reverse -190 -197 14.1988 0.0123
NP_442262.1_10 Forward -18 -11 14.1988 0.0123
NP_442262.1_10 Reverse -11 -18 14.1988 0.0123
NP_441689.1_5 Reverse -8 -18 17.8758 0.0158
NP_441689.1_5 Reverse -187 -197 8.63269 0.132
NP_441689.1_5 Forward -21 -11 8.53436 0.132
NP_441689.1_5 Forward -200 -190 5.87944 0.197
NP_440163.1_10 Forward -22 -12 14.238 0.102
NP_440163.1_10 Forward -377 -367 9.81313 0.222
NP_440344.1_10 Reverse -182 -199 11.7402 0.006
NP_440344.1_10 Forward -26 -9 -0.649475 0.0444
NP_440344.1_10 Reverse -3 -20 -0.747806 0.0454
NP_440282.1_10 Forward -29 -10 5.70265 0.125
NP_440531.1_6 Reverse -2 -21 -0.787193 0.221
NP_442123.1_3 Reverse -10 -29 16.9124 0.0891
NP_440562.1_3 Forward -197 -180 7.217 0.15
NP_441965.1_10 Forward -22 -6 16.4798 0.0445
NP_441965.1_10 Reverse -7 -23 7.82668 0.14
NP_440297.1_9 Forward -197 -187 19.0562 0.0359
NP_440297.1_9 Reverse -11 -21 9.32148 0.0917
NP_440297.1_9 Forward -18 -8 9.22315 0.0917
NP_440297.1_9 Reverse -190 -200 -0.216628 0.282
NP_441896.1_3 Forward -28 -9 7.66927 0.0933
NP_441896.1_3 Reverse -1 -20 -2.55715 0.284
NP_440937.1_5 Forward -387 -368 9.24257 0.275
NP_442067.1_4 Forward -30 -11 8.45592 0.194
NP_440999.1_9 Reverse -185 -199 4.42448 0.116
NP_440999.1_9 Forward -202 -188 0.0979218 0.193
NP_440999.1_9 Forward -23 -9 -0.295402 0.203
NP_440888.1_2 Reverse -365 -379 16.6169 0.00609
NP_440888.1_2 Reverse -189 -203 16.2235 0.00758
NP_440888.1_2 Reverse -10 -24 14.8469 0.0144
NP_440888.1_2 Forward -19 -5 13.1753 0.0324
NP_440888.1_2 Forward -198 -184 11.9953 0.0539
NP_440179.1_6 Reverse -190 -209 8.16093 0.206
NP_440052.1_5 Forward -30 -11 1.37609 0.165
NP_442033.1_10 Reverse -187 -206 -6.39206 0.186
NP_441123.1_6 Forward -206 -188 13.8838 0.132
NP_441949.1_2 Forward -208 -189 1.57275 0.281
NP_441543.1_2 Reverse -11 -20 18.486 0.00236
NP_441543.1_2 Reverse -190 -199 16.9127 0.00359
NP_441543.1_2 Forward -18 -9 15.9293 0.00518
NP_441543.1_2 Forward -197 -188 9.34117 0.0818
NP_442845.1_2 Reverse -4 -18 16.8142 0.0608
NP_442845.1_2 Forward -380 -366 6.3911 0.21
NP_442845.1_2 Reverse -183 -197 4.71948 0.254
NP_442845.1_2 Forward -198 -184 4.52282 0.258
NP_442845.1_2 Forward -204 -190 3.44117 0.29
NP_441551.1_5 Forward -202 -186 14.8074 0.1
NP_441551.1_5 Forward -23 -7 9.89093 0.201
NP_441319.1_8 Forward -25 -7 18.5054 0.0597
NP_441918.1_7 Reverse -188 -207 -2.16383 0.297
NP_441469.1_8 Forward -20 -11 16.126 0.00797
NP_441469.1_8 Reverse -188 -197 13.3727 0.073
NP_441469.1_8 Reverse -9 -18 6.5879 0.227
NP_441469.1_8 Forward -199 -190 6.48957 0.227
NP_443064.1_6 Forward -198 -188 13.8273 0.0796
NP_443064.1_6 Reverse -189 -199 12.5669 0.0796
NP_443064.1_6 Forward -19 -9 10.8217 0.13
NP_442578.1_7 Forward -197 -190 14.5921 0.026
NP_442578.1_7 Forward -18 -11 14.5921 0.026
NP_442578.1_7 Reverse -190 -197 14.5921 0.026
NP_442578.1_7 Reverse -11 -18 14.5921 0.026
NP_440998.1_10 Forward -63 -44 8.94757 0.178
NP_442286.1_1 Reverse -189 -208 14.8474 0.13
NP_442286.1_1 Reverse -334 -353 13.7658 0.138
NP_441462.1_2 Forward -19 -9 20.2362 0.000805
NP_441462.1_2 Forward -198 -188 20.1379 0.000967
NP_441462.1_2 Reverse -189 -199 11.5831 0.00406
NP_441462.1_2 Reverse -10 -20 11.5831 0.00406
NP_441462.1_2 Forward -374 -364 -1.00328 0.274
NP_441621.1_7 Reverse -187 -201 -4.81863 0.246
NP_441621.1_7 Forward -21 -7 -5.60527 0.256
NP_443062.1_6 Reverse -2 -21 0.786102 0.288
NP_442204.1_1 Reverse -6 -17 7.63016 0.123
NP_442204.1_1 Reverse -185 -196 0.451995 0.281
NP_442204.1_5 Reverse -179 -198 4.916 0.16
NP_441560.1_8 Forward -74 -55 11.5127 0.294
NP_441560.1_10 Reverse -181 -200 6.78429 0.287
NP_440516.1_8 Forward -198 -189 16.9127 0.00442
NP_440516.1_8 Reverse -189 -198 16.9127 0.00442
NP_440516.1_8 Forward -19 -10 16.9127 0.00442
NP_440516.1_8 Reverse -10 -19 16.9127 0.00442
NP_442428.1_4 Forward -199 -180 9.24257 0.158
NP_442428.1_5 Forward -197 -190 15.8704 0.0124
NP_442428.1_5 Reverse -190 -197 15.8704 0.0124
NP_442428.1_5 Forward -18 -11 15.8704 0.0124
NP_442428.1_5 Reverse -11 -18 15.8704 0.0124
NP_440673.1_3 Forward -196 -189 12.4288 0.0426
NP_440673.1_3 Forward -17 -10 12.4288 0.0426
NP_440673.1_3 Reverse -191 -198 12.4288 0.0426
NP_440673.1_3 Reverse -12 -19 12.4288 0.0426
NP_441052.1_2 Reverse -189 -199 19.9412 0.00106
NP_441052.1_2 Reverse -10 -20 10.5014 0.0285
NP_441052.1_2 Forward -198 -188 10.4031 0.0285
NP_441052.1_2 Forward -19 -9 10.4031 0.0285
NP_441052.1_2 Reverse -365 -375 5.19158 0.128
NP_441052.1_2 Reverse -271 -281 0.668351 0.256
NP_442219.1_8 Forward -208 -189 13.192 0.153
NP_442219.1_9 Reverse -190 -199 17.7976 0.00718
NP_442219.1_9 Reverse -11 -20 8.35786 0.0681
NP_442219.1_9 Forward -197 -188 8.25953 0.0681
NP_442219.1_9 Forward -18 -9 8.25953 0.0681
NP_440436.1_4 Reverse -11 -20 18.1905 0.00233
NP_440436.1_4 Reverse -190 -199 17.2072 0.00233
NP_440436.1_4 Forward -197 -188 15.9289 0.00508
NP_440436.1_4 Forward -18 -9 9.24241 0.0871
NP_441884.1_9 Reverse -186 -205 -5.70374 0.0594
NP_441884.1_9 Reverse -22 -41 -20.65 0.199
NP_441884.1_9 Forward -22 -3 -23.6983 0.284
NP_440314.1_9 Reverse -190 -209 -6.78538 0.231
NP_442907.1_2 Reverse -190 -208 13.0972 0.169
NP_441719.1_4 Forward -197 -190 16.3621 0.0124
NP_441719.1_4 Reverse -190 -197 16.3621 0.0124
NP_441719.1_4 Forward -18 -11 16.3621 0.0124
NP_441719.1_4 Reverse -11 -18 16.3621 0.0124
NP_441733.1_10 Forward -201 -188 8.86907 0.132
NP_442873.1_3 Forward -29 -10 16.8132 0.0822
NP_442873.1_9 Forward -208 -189 3.44025 0.289
NP_441115.1_4 Forward -199 -181 9.75313 0.202
NP_442854.1_6 Reverse -189 -208 4.81767 0.249
NP_440094.1_9 Forward -199 -180 2.3594 0.173
NP_443054.1_2 Reverse -187 -201 4.62115 0.24
NP_443054.1_2 Reverse -8 -22 3.04785 0.24
NP_443054.1_2 Forward -200 -186 1.08123 0.251
NP_441851.1_10 Reverse -188 -198 17.4829 0.0027
NP_441851.1_10 Forward -20 -10 16.008 0.00552
NP_441851.1_10 Forward -199 -189 15.8113 0.00552
NP_441851.1_10 Reverse -9 -19 8.53483 0.114
NP_442622.1_5 Forward -21 -2 -3.3438 0.171
NP_441668.1_4 Forward -121 -102 1.57275 0.212
NP_442515.1_1 Reverse -188 -202 18.9775 0.0192
NP_442515.1_1 Reverse -9 -23 4.71948 0.107
NP_442515.1_1 Forward -199 -185 4.62115 0.107
NP_442515.1_1 Forward -20 -6 2.2612 0.14
NP_440463.1_8 Forward -29 -10 7.69352 0.264
NP_441349.1_10 Forward -208 -189 -0.4922 0.0947
NP_441349.1_10 Reverse -179 -198 -9.73531 0.297
NP_441409.1_6 Reverse -183 -202 0.687771 0.0648
NP_441409.1_6 Reverse -4 -23 -7.08038 0.142
NP_440389.1_5 Reverse -161 -180 11.8368 0.277
NP_440432.1_9 Reverse -190 -205 -0.905081 0.167
NP_440432.1_9 Forward -197 -182 -2.8717 0.176
NP_440474.1_8 Reverse -11 -25 15.4369 0.0566
NP_440474.1_8 Forward -18 -4 10.6187 0.13
NP_440396.1_10 Reverse -190 -206 11.4642 0.186
NP_441124.1_5 Forward -168 -158 13.7721 0.215
NP_442450.1_5 Reverse -187 -197 19.1546 0.0103
NP_442450.1_5 Reverse -8 -18 9.41981 0.115
NP_442450.1_5 Forward -21 -11 9.32148 0.115
NP_440588.1_2 Reverse -1 -20 6.68596 0.0535
NP_440588.1_2 Reverse -180 -199 -2.75381 0.172
NP_442243.1_1 Forward -204 -186 0.411736 0.231
NP_441570.1_1 Reverse -189 -207 -0.177514 0.0437
NP_441570.1_1 Reverse -365 -383 -2.14413 0.0626
NP_441570.1_1 Forward -19 -1 -5.78238 0.0761
NP_441570.1_1 Reverse -10 -28 -5.88071 0.0761
NP_441570.1_1 Forward -198 -180 -8.33898 0.109
NP_441078.1_4 Forward -198 -189 19.6659 0.0007
NP_441078.1_4 Reverse -189 -198 19.6659 0.0007
NP_441078.1_4 Forward -19 -10 19.6659 0.0007
NP_441078.1_4 Reverse -10 -19 19.6659 0.0007
NP_441078.1_4 Reverse -365 -374 -2.06522 0.295
NP_441078.1_4 Forward -374 -365 -2.06522 0.295
NP_442729.1_8 Forward -23 -10 18.8988 0.0312
NP_442729.1_8 Reverse -185 -198 8.77074 0.125
NP_442729.1_8 Forward -226 -213 7.39411 0.153
NP_441528.1_2 Reverse -24 -43 20.0581 0.0381
NP_440707.1_6 Reverse -2 -21 11.7983 0.241
NP_441094.1_6 Reverse -182 -199 9.67453 0.257
NP_440526.1_3 Forward -197 -186 10.8746 0.0646
NP_440526.1_3 Reverse -190 -201 10.6779 0.0646
NP_440526.1_3 Reverse -366 -377 0.156538 0.297
NP_441432.1_8 Reverse -9 -18 16.8143 0.00595
NP_441432.1_8 Forward -199 -190 16.8143 0.00595
NP_441432.1_8 Reverse -188 -197 8.35786 0.0755
NP_441432.1_8 Forward -20 -11 8.25953 0.0755
NP_442320.1_8 Reverse -183 -197 13.8643 0.0144
NP_442320.1_8 Forward -25 -11 6.58777 0.027
NP_442320.1_8 Forward -204 -190 4.52282 0.0482
NP_442320.1_8 Reverse -4 -18 -1.47537 0.082
NP_442344.1_7 Reverse -11 -30 -7.4737 0.183
NP_441732.1_2 Reverse -185 -201 12.8416 0.00384
NP_441732.1_2 Reverse -6 -22 -7.80794 0.0935
NP_441732.1_2 Forward -23 -7 -16.5594 0.174
NP_440760.1_1 Reverse -10 -29 -10.522 0.084
NP_440760.1_1 Forward -198 -179 -18.6834 0.216
NP_440199.1_10 Reverse -7 -17 12.9597 0.114
NP_440199.1_10 Reverse -186 -196 7.74818 0.231
NP_441945.1_10 Reverse -9 -28 8.06259 0.278
NP_441057.1_4 Reverse -122 -140 -0.0791831 0.26
NP_440913.1_1 Reverse -363 -381 9.65558 0.176
NP_440281.1_9 Forward -302 -283 18.0924 0.218
NP_440713.1_4 Forward -384 -365 4.32602 0.231
NP_442489.1_2 Forward -30 -11 3.53937 0.236
NP_442489.1_7 Forward -198 -189 20.1576 0.000695
NP_442489.1_7 Reverse -189 -198 20.1576 0.000695
NP_442489.1_7 Forward -19 -10 20.1576 0.000695
NP_442489.1_7 Reverse -10 -19 20.1576 0.000695
NP_442489.1_7 Forward -374 -365 -1.57357 0.213
NP_440386.1_1 Forward -204 -185 -8.752 0.28
NP_442079.1_6 Reverse -2 -21 20.5506 0.0492
NP_442079.1_7 Reverse -11 -30 3.44104 0.212
NP_440559.1_1 Reverse -190 -199 17.4043 0.00658
NP_440559.1_1 Forward -197 -188 17.306 0.00658
NP_440559.1_1 Reverse -11 -20 8.75118 0.0586
NP_440559.1_1 Forward -18 -9 8.65285 0.0586
NP_441659.2_8 Forward -19 -9 20.9245 0.000805
NP_441659.2_8 Forward -198 -188 19.3512 0.000966
NP_441659.2_8 Reverse -189 -199 18.1713 0.00133
NP_441659.2_8 Reverse -10 -20 11.9764 0.0147
NP_441659.2_8 Reverse -365 -375 3.12662 0.172
NP_440860.1_8 Forward -185 -166 12.8808 0.296
NP_441022.1_1 Forward -165 -156 15.9587 0.163
NP_442913.1_10 Reverse -180 -199 3.73603 0.1
NP_442913.1_10 Forward -207 -188 -1.18052 0.167
NP_440708.1_6 Reverse -18 -37 -7.37537 0.248
NP_442346.1_5 Reverse -188 -198 17.9746 0.00128
NP_442346.1_5 Forward -199 -189 16.6963 0.00248
NP_442346.1_5 Reverse -9 -19 16.303 0.00248
NP_442346.1_5 Forward -20 -10 9.02648 0.118
NP_440545.1_3 Forward -202 -185 14.1985 0.0157
NP_440545.1_3 Reverse -6 -23 -3.30441 0.203
NP_440545.1_3 Reverse -185 -202 -7.13932 0.298
NP_441856.1_3 Forward -22 -3 -0.688862 0.225
NP_441786.1_10 Reverse -1 -20 6.78429 0.276
NP_440459.1_2 Forward -382 -365 11.6419 0.169
NP_440459.1_2 Reverse -180 -197 11.0519 0.183
NP_440459.1_2 Forward -200 -183 8.29864 0.266
NP_441653.1_2 Forward -209 -190 11.4536 0.111
NP_440010.1_4 Reverse -6 -25 -2.95123 0.293
NP_440010.1_10 Forward -210 -191 5.01433 0.238
NP_441943.1_8 Forward -45 -26 -4.32711 0.205
NP_442551.1_4 Forward -200 -185 -3.75668 0.295
NP_442603.1_7 Forward -198 -184 11.9953 0.107
NP_442603.1_7 Reverse -189 -203 9.14375 0.155
NP_440449.1_6 Reverse -181 -199 4.85163 0.288
NP_439970.1_3 Reverse -23 -42 6.19431 0.244
NP_441833.1_4 Forward -197 -190 15.9687 0.0124
NP_441833.1_4 Reverse -190 -197 15.9687 0.0124
NP_441833.1_4 Forward -18 -11 15.9687 0.0124
NP_441833.1_4 Reverse -11 -18 15.9687 0.0124
NP_442162.1_9 Forward -197 -190 16.2637 0.0124
NP_442162.1_9 Reverse -190 -197 16.2637 0.0124
NP_442162.1_9 Forward -18 -11 16.2637 0.0124
NP_442162.1_9 Reverse -11 -18 16.2637 0.0124
NP_440671.1_4 Reverse -183 -197 15.7325 0.039
NP_440671.1_4 Reverse -365 -379 6.6861 0.239
NP_440671.1_4 Forward -380 -366 5.21113 0.289
NP_440224.1_1 Reverse -178 -197 0.786102 0.132
NP_441915.1_1 Reverse -299 -318 18.6815 0.179
NP_442199.1_5 Forward -27 -8 -2.65548 0.191
NP_442140.1_3 Reverse -190 -200 13.5497 0.0542
NP_442140.1_3 Reverse -11 -21 8.33817 0.119
NP_442140.1_3 Forward -197 -187 5.68323 0.198
NP_441813.1_5 Forward -21 -11 17.188 0.00979
NP_441813.1_5 Reverse -187 -197 16.1063 0.01
NP_441813.1_5 Reverse -8 -18 15.9097 0.01
NP_441813.1_5 Forward -200 -190 8.73149 0.0367
NP_440594.1_6 Reverse -138 -157 14.0599 0.169
NP_442089.1_6 Forward -197 -178 7.7676 0.185
NP_440590.1_4 Reverse -190 -203 4.44418 0.0601
NP_440590.1_4 Forward -197 -184 4.05085 0.0642
NP_440590.1_4 Reverse -11 -24 1.78924 0.111
NP_440590.1_4 Forward -18 -5 -5.38892 0.277
NP_440567.1_1 Forward -18 -4 16.8142 0.0165
NP_440567.1_1 Forward -197 -183 14.5526 0.0187
NP_440567.1_1 Reverse -11 -25 13.9626 0.0194
NP_440567.1_1 Reverse -190 -204 1.86788 0.191
NP_440567.1_1 Reverse -142 -156 0.88457 0.228
NP_442497.1_10 Forward -197 -188 19.8626 0.00532
NP_442497.1_10 Forward -18 -9 17.601 0.00813
NP_442497.1_10 Reverse -190 -199 10.4228 0.0087
NP_442497.1_10 Reverse -11 -20 10.4228 0.0087
NP_440821.1_4 Reverse -187 -197 19.8429 0.00399
NP_440821.1_4 Forward -21 -11 19.0562 0.00399
NP_440821.1_4 Forward -200 -190 17.9746 0.00497
NP_440821.1_4 Reverse -8 -18 11.0914 0.0146
NP_441239.1_9 Reverse -8 -20 14.6903 0.0258
NP_441239.1_9 Forward -21 -9 13.3137 0.037
NP_441239.1_9 Reverse -187 -199 11.7404 0.0551
NP_441239.1_9 Forward -200 -188 10.6587 0.0742
NP_440706.1_1 Reverse -6 -25 -2.75381 0.258
NP_441727.1_3 Reverse -3 -22 4.52268 0.262
NP_441892.1_1 Forward -84 -67 -2.22277 0.219
NP_441892.1_1 Reverse -1 -18 -3.50107 0.242
NP_441892.1_1 Reverse -180 -197 -5.95935 0.294
NP_440665.1_1 Reverse -13 -32 -13.1769 0.257
NP_440665.1_1 Forward -31 -12 -16.6185 0.292
NP_440665.1_2 Forward -44 -25 -5.70374 0.247
NP_440612.1_2 Forward -340 -327 22.6348 0.0327
NP_441017.1_6 Reverse -185 -199 16.4202 0.0651
NP_441017.1_8 Forward -201 -186 8.43636 0.244
NP_440949.1_7 Reverse -175 -194 8.94676 0.264
NP_440354.1_7 Forward -25 -7 10.1472 0.224
NP_440354.1_7 Reverse -4 -22 8.67227 0.232
NP_442138.1_10 Reverse -189 -208 -8.16202 0.299
NP_440546.1_4 Forward -19 -9 13.5365 0.0459
NP_440546.1_4 Forward -198 -188 12.8578 0.0572
NP_440546.1_4 Reverse -10 -20 11.8882 0.0679
NP_440546.1_4 Forward -374 -364 10.6277 0.109
NP_440546.1_4 Reverse -189 -199 10.046 0.109
NP_441230.1_5 Forward -24 -5 1.57275 0.239
NP_440675.1_3 Reverse -189 -208 5.40766 0.285
NP_440462.1_6 Reverse -8 -18 16.893 0.00853
NP_440462.1_6 Forward -21 -11 15.418 0.0142
NP_440462.1_6 Forward -200 -190 10.3048 0.0396
NP_440462.1_6 Reverse -187 -197 7.84651 0.0699
NP_440868.1_4 Reverse -6 -18 17.7386 0.0124
NP_440868.1_4 Forward -202 -190 16.7552 0.0136
NP_440868.1_4 Forward -23 -11 10.6587 0.0364
NP_441474.1_1 Forward -29 -10 1.17865 0.247
NP_442402.1_4 Reverse -20 -39 -6.68779 0.263
NP_442402.1_4 Reverse -193 -212 -8.45774 0.282
NP_442258.1_5 Forward -39 -20 16.0274 0.0181
NP_441084.1_6 Reverse -8 -22 11.962 0.179
NP_441084.1_6 Reverse -269 -283 10.6046 0.234
NP_441084.1_6 Reverse -187 -201 10.0228 0.255
NP_442039.1_4 Forward -197 -190 15.1821 0.0124
NP_442039.1_4 Reverse -190 -197 15.1821 0.0124
NP_442039.1_4 Forward -18 -11 15.1821 0.0124
NP_442039.1_4 Reverse -11 -18 15.1821 0.0124
NP_442039.1_4 Reverse -214 -221 7.02061 0.269
NP_442837.1_3 Forward -197 -190 15.7721 0.0124
NP_442837.1_3 Reverse -190 -197 15.7721 0.0124
NP_442837.1_3 Forward -18 -11 15.7721 0.0124
NP_442837.1_3 Reverse -11 -18 15.7721 0.0124
NP_439994.1_3 Forward -20 -1 10.292 0.221
NP_442053.1_1 Forward -198 -189 18.3876 0.0007
NP_442053.1_1 Reverse -189 -198 18.3876 0.0007
NP_442053.1_1 Forward -19 -10 18.3876 0.0007
NP_442053.1_1 Reverse -10 -19 18.3876 0.0007
NP_440505.1_3 Forward -200 -190 16.598 0.00683
NP_440505.1_3 Reverse -8 -18 15.123 0.014
NP_440505.1_3 Forward -21 -11 13.8447 0.0247
NP_440505.1_3 Reverse -187 -197 7.55152 0.151
NP_440505.1_3 Forward -376 -366 4.89658 0.257
NP_441959.1_5 Reverse -23 -42 6.4893 0.26
NP_441203.1_1 Forward -197 -178 -9.53865 0.137
NP_442532.1_4 Reverse -113 -131 7.38318 0.3
NP_442532.1_7 Reverse -10 -24 6.09611 0.171
NP_442532.1_7 Forward -19 -5 4.42448 0.171
NP_442532.1_7 Reverse -189 -203 4.03116 0.178
NP_440914.1_1 Reverse -189 -199 17.5935 0.000537
NP_440914.1_1 Forward -19 -9 16.3248 0.00196
NP_440914.1_1 Reverse -10 -20 8.6151 0.186
NP_440914.1_1 Forward -198 -188 8.51751 0.186
NP_440914.1_1 Forward -81 -71 8.51751 0.186
NP_440914.1_1 Forward -374 -364 6.76087 0.267
NP_441011.1_8 Reverse -11 -20 16.9127 0.00602
NP_441011.1_8 Forward -18 -9 16.6177 0.00602
NP_441011.1_8 Forward -197 -188 14.356 0.0249
NP_441011.1_8 Reverse -190 -199 8.25953 0.144
NP_442533.1_1 Reverse -7 -26 -16.9135 0.277
NP_442533.1_6 Forward -198 -189 17.2076 0.00137
NP_442533.1_6 Reverse -189 -198 17.2076 0.00137
NP_442533.1_6 Forward -19 -10 17.2076 0.00137
NP_442533.1_6 Reverse -10 -19 17.2076 0.00137
NP_442533.1_6 Reverse -365 -374 13.8644 0.0178
NP_442541.1_10 Reverse -33 -47 1.08065 0.292
NP_442229.1_1 Forward -200 -186 7.66879 0.196
NP_441482.1_7 Reverse -183 -197 0.687908 0.0554
NP_441482.1_7 Reverse -4 -18 -1.5737 0.0755
NP_441482.1_7 Forward -25 -11 -1.67204 0.0787
NP_441482.1_7 Forward -204 -190 -10.4235 0.209
NP_439944.1_9 Reverse -190 -200 19.1546 0.00329
NP_439944.1_9 Forward -18 -8 17.6796 0.00347
NP_439944.1_9 Forward -197 -187 17.3846 0.00516
NP_439944.1_9 Reverse -11 -21 10.3048 0.0887
NP_440116.1_8 Forward -197 -178 5.30933 0.0654
NP_440116.1_8 Reverse -190 -209 -9.73531 0.287
NP_440115.1_6 Forward -201 -191 17.9746 0.0163
NP_440115.1_6 Reverse -7 -17 6.46988 0.181
NP_440115.1_6 Forward -38 -28 6.37155 0.186
NP_440007.1_9 Reverse -185 -199 12.8809 0.163
NP_440007.1_9 Forward -378 -364 0.88457 0.29
NP_439965.1_1 Reverse -1 -20 4.03102 0.0949
NP_441602.1_3 Forward -24 -5 -1.27885 0.226
NP_441602.1_3 Forward -203 -184 -2.36049 0.233
NP_441170.1_4 Forward -28 -10 8.27895 0.194
NP_441972.1_5 Forward -197 -178 -1.47551 0.177
NP_441972.1_5 Reverse -11 -30 -9.34199 0.283
NP_441106.1_1 Reverse -9 -18 18.486 0.0028
NP_441106.1_1 Forward -20 -11 18.191 0.0028
NP_441106.1_1 Reverse -188 -197 9.73449 0.0311
NP_441106.1_1 Forward -199 -190 9.63616 0.0311
NP_441420.1_1 Forward -199 -180 7.7676 0.118
NP_439903.1_6 Reverse -7 -26 8.55343 0.136
NP_439903.1_6 Forward -22 -3 7.57013 0.151
NP_001035870.1_3 Reverse -42 -61 -4.91709 0.278
NP_442306.1_10 Reverse -5 -24 -0.590531 0.0484
NP_441286.1_1 Forward -199 -187 23.9334 0.000767
NP_441286.1_1 Reverse -188 -200 12.232 0.00999
NP_441286.1_1 Reverse -9 -21 5.05386 0.0259
NP_441286.1_1 Forward -20 -8 4.8572 0.0272
NP_442674.1_2 Reverse -224 -243 12.6841 0.208
NP_442674.1_6 Reverse -294 -313 16.5182 0.258
NP_440670.1_8 Forward -198 -189 18.3876 0.000699
NP_440670.1_8 Reverse -189 -198 18.3876 0.000699
NP_440670.1_8 Forward -19 -10 18.3876 0.000699
NP_440670.1_8 Reverse -10 -19 18.3876 0.000699
NP_440103.1_1 Forward -129 -115 19.0478 0.259
NP_440886.1_7 Forward -20 -10 17.7774 0.0011
NP_440886.1_7 Reverse -188 -198 8.04271 0.0805
NP_440886.1_7 Reverse -9 -19 8.04271 0.0805
NP_440886.1_7 Forward -199 -189 7.94438 0.0805
NP_440886.1_7 Reverse -364 -374 3.8145 0.265
NP_442614.1_2 Forward -19 -5 7.27608 0.275
NP_442614.1_2 Forward -198 -184 6.98109 0.276
NP_442072.1_9 Forward -199 -181 -12.2722 0.0831
NP_442072.1_9 Reverse -188 -206 -12.2722 0.0831
NP_441753.1_10 Reverse -180 -199 12.6841 0.101
NP_442963.1_7 Forward -383 -364 12.6841 0.204
NP_442022.1_4 Forward -310 -291 13.9625 0.166
NP_440907.2_8 Reverse -190 -200 10.8943 0.0969
NP_440907.2_8 Forward -197 -187 9.81266 0.103
NP_440907.2_8 Forward -18 -8 9.51767 0.103
NP_440907.2_8 Reverse -11 -21 7.84605 0.117
NP_442264.1_2 Forward -202 -185 14.8868 0.127
NP_442264.1_5 Forward -19 -5 11.996 0.253
NP_441021.1_1 Reverse -190 -209 -1.47551 0.119
NP_441021.1_8 Reverse -184 -202 12.2122 0.11
NP_440326.1_5 Forward -200 -187 13.589 0.229
NP_440841.1_4 Forward -376 -357 -8.55534 0.25
NP_441463.1_3 Forward -29 -10 10.4225 0.0481
NP_441463.1_3 Forward -208 -189 8.94757 0.0481
NP_441463.1_6 Reverse -8 -22 10.9577 0.231
NP_441463.1_6 Reverse -187 -201 9.02504 0.25
NP_442842.1_4 Forward -197 -178 4.71934 0.249
NP_441626.1_2 Forward -197 -190 15.7721 0.0124
NP_441626.1_2 Reverse -190 -197 15.7721 0.0124
NP_441626.1_2 Forward -18 -11 15.7721 0.0124
NP_441626.1_2 Reverse -11 -18 15.7721 0.0124
NP_442211.1_3 Forward -386 -367 7.27748 0.283
NP_442365.1_7 Reverse -6 -25 4.52268 0.144
NP_442365.1_7 Reverse -185 -204 -1.37718 0.191
NP_442209.1_6 Reverse -165 -184 14.6508 0.185
NP_442615.1_1 Forward -207 -189 4.24738 0.048
NP_442615.1_1 Forward -28 -10 -0.570838 0.118
NP_442615.1_1 Reverse -180 -198 -5.09406 0.204
NP_441962.1_4 Reverse -184 -203 -10.6203 0.232
NP_441962.1_4 Reverse -5 -24 -14.0619 0.282
NP_440387.1_1 Reverse -189 -205 14.2182 0.00668
NP_440387.1_1 Reverse -10 -26 13.4315 0.00865
NP_440387.1_1 Forward -19 -3 5.46674 0.0322
NP_440387.1_1 Forward -88 -72 -5.74299 0.249
NP_441836.1_2 Forward -37 -18 5.211 0.127
NP_441836.1_2 Reverse -4 -23 -4.91709 0.268
NP_441993.1_1 Reverse -183 -202 1.84923 0.269
NP_442224.1_1 Forward -215 -196 -5.99873 0.296
NP_440467.1_3 Reverse -178 -197 10.7679 0.296
NP_440114.1_10 Forward -19 -5 18.7808 0.00482
NP_440114.1_10 Reverse -10 -24 13.5693 0.0531
NP_440114.1_10 Forward -198 -184 9.5377 0.169
NP_440114.1_10 Forward -374 -360 8.06273 0.217
NP_440114.1_10 Reverse -189 -203 7.57108 0.231
NP_440287.1_6 Reverse -187 -206 -0.0988766 0.298
NP_441720.1_2 Reverse -185 -204 3.44025 0.236
NP_440293.1_3 Reverse -26 -45 -2.26216 0.239
NP_440766.1_4 Reverse -185 -199 8.55439 0.0871
NP_440766.1_4 Reverse -6 -20 6.6861 0.0991
NP_440766.1_4 Forward -202 -188 5.1128 0.115
NP_440766.1_4 Forward -321 -307 2.35953 0.187
NP_440766.1_5 Forward -170 -158 10.807 0.268
NP_439988.1_7 Reverse -12 -26 12.782 0.292
NP_441237.1_9 Reverse -190 -200 14.9263 0.0242
NP_441979.1_9 Reverse -19 -38 10.5209 0.168
NP_442743.1_10 Forward -372 -358 21.3374 0.103
NP_439910.1_2 Reverse -181 -198 -12.6459 0.0924
NP_439910.1_2 Forward -27 -10 -21.3973 0.183
NP_440457.1_1 Reverse -185 -197 16.8536 0.0455
NP_440457.1_1 Forward -378 -366 4.16888 0.171
NP_440457.1_1 Reverse -6 -18 1.90727 0.223
NP_440457.1_1 Forward -202 -190 0.23564 0.25
NP_440457.1_1 Forward -23 -11 -0.0593532 0.25
NP_440798.1_6 Reverse -190 -203 3.26421 0.151
NP_442297.1_4 Forward -378 -359 17.7819 0.128
NP_441984.1_3 Forward -202 -184 12.8022 0.157
NP_441984.1_3 Reverse -361 -379 6.70565 0.267
NP_440473.1_9 Forward -209 -190 -4.81876 0.196
NP_442509.1_9 Forward -198 -188 17.3841 0.00128
NP_442509.1_9 Reverse -10 -20 16.2041 0.00739
NP_442509.1_9 Reverse -189 -199 8.14104 0.192
NP_442509.1_9 Forward -19 -9 8.04271 0.192
NP_442439.1_8 Reverse -270 -289 6.4893 0.299
NP_442514.1_5 Forward -49 -30 -3.83621 0.234
NP_442514.1_5 Reverse -25 -44 -4.22953 0.238
NP_442514.1_5 Forward -50 -31 -8.94939 0.292
NP_440554.1_4 Forward -18 -8 16.1063 0.0189
NP_440554.1_4 Reverse -11 -21 14.6313 0.02
NP_440554.1_4 Forward -197 -187 6.96153 0.107
NP_440554.1_4 Reverse -190 -200 6.37155 0.123
NP_441885.1_5 Reverse -189 -199 20.9245 0.000538
NP_441885.1_5 Reverse -10 -20 11.4848 0.00668
NP_441885.1_5 Forward -198 -188 11.3864 0.00668
NP_441885.1_5 Forward -19 -9 11.3864 0.00668
NP_441885.1_5 Reverse -365 -375 -0.41329 0.197
NP_442228.1_5 Forward -201 -182 17.4032 0.234
NP_441428.1_8 Forward -27 -8 22.1239 0.0201
NP_442341.1_7 Forward -199 -185 16.8142 0.0155
NP_442341.1_7 Reverse -188 -202 7.9644 0.0956
NP_442341.1_7 Reverse -9 -23 6.88276 0.116
NP_442341.1_7 Forward -20 -6 6.3911 0.127
NP_442341.1_9 Forward -21 -7 10.717 0.133
NP_442341.1_9 Reverse -363 -377 6.39049 0.228
NP_443000.1_7 Reverse -8 -18 17.4829 0.00719
NP_443000.1_7 Forward -200 -190 10.4031 0.0345
NP_443000.1_7 Reverse -187 -197 8.82982 0.0437
NP_443000.1_7 Forward -21 -11 8.73149 0.0437
NP_440507.2_3 Forward -207 -188 13.0766 0.145
NP_442513.1_5 Forward -206 -187 6.68515 0.282
NP_441842.1_10 Reverse -182 -196 13.8643 0.0667
NP_441842.1_10 Reverse -3 -17 13.8643 0.0667
NP_441842.1_10 Forward -26 -12 13.1759 0.0809
NP_441842.1_10 Forward -301 -287 9.93102 0.178
NP_440275.1_3 Forward -200 -190 17.6796 0.0102
NP_440275.1_3 Reverse -187 -197 10.0098 0.0454
NP_440275.1_3 Reverse -8 -18 9.12481 0.055
NP_440275.1_3 Forward -21 -11 8.4365 0.0602
NP_440091.1_1 Forward -202 -190 15.8703 0.0161
NP_440091.1_1 Forward -23 -11 1.41561 0.197
NP_440091.1_1 Reverse -185 -197 1.41561 0.197
NP_440679.1_10 Reverse -12 -31 -16.0285 0.25
NP_443010.1_10 Reverse -186 -203 2.77079 0.27
NP_443010.1_10 Forward -201 -184 1.70782 0.3
NP_442451.1_2 Reverse -2 -21 -10.1286 0.265
NP_440149.1_8 Reverse -10 -29 22.0256 0.00679
NP_441105.1_3 Reverse -178 -197 0.491109 0.124
NP_441105.1_3 Forward -203 -184 -9.14533 0.284
NP_440216.1_1 Forward -198 -184 8.25939 0.0061
NP_440216.1_1 Reverse -189 -203 -1.5737 0.034
NP_440216.1_1 Forward -19 -5 -1.5737 0.034
NP_440216.1_1 Reverse -10 -24 -2.55701 0.0521
NP_440172.1_1 Forward -19 -9 17.5813 0.00421
NP_440172.1_1 Forward -198 -188 16.303 0.00854
NP_440172.1_1 Reverse -189 -199 15.0247 0.00945
NP_440172.1_1 Reverse -10 -20 8.73149 0.0586
NP_440249.1_2 Reverse -153 -163 14.1392 0.29
NP_442015.1_10 Reverse -185 -198 11.229 0.0372
NP_442015.1_10 Forward -202 -189 2.87088 0.187
NP_442015.1_10 Reverse -6 -19 1.78924 0.204
NP_442015.1_10 Forward -23 -10 0.707601 0.221
NP_441226.1_7 Forward -197 -190 14.4934 0.0123
NP_441226.1_7 Reverse -190 -197 14.4934 0.0123
NP_441226.1_7 Forward -18 -11 14.4934 0.0123
NP_441226.1_7 Reverse -11 -18 14.4934 0.0123
NP_441226.1_7 Reverse -366 -373 8.29857 0.205
NP_441111.1_7 Forward -197 -189 18.7023 0.00294
NP_441111.1_7 Forward -18 -10 18.7023 0.00294
NP_441111.1_7 Reverse -190 -198 18.7023 0.00294
NP_441111.1_7 Reverse -11 -19 18.7023 0.00294
NP_442379.1_10 Forward -205 -188 -0.846137 0.223
NP_441766.1_2 Forward -198 -189 17.5026 0.00297
NP_441766.1_2 Reverse -189 -198 17.5026 0.00297
NP_441766.1_2 Forward -19 -10 17.5026 0.00297
NP_441766.1_2 Reverse -10 -19 17.5026 0.00297
NP_440416.1_9 Forward -26 -7 -12.8819 0.16
NP_440416.1_9 Reverse -364 -383 -21.535 0.295
NP_443052.1_8 Forward -208 -189 0.392778 0.0664
NP_443052.1_8 Reverse -179 -198 -8.26035 0.171
NP_440261.1_5 Forward -197 -184 -0.767364 0.0655
NP_440261.1_5 Forward -18 -5 -2.73398 0.0924
NP_440261.1_5 Reverse -190 -203 -2.73398 0.0924
NP_440261.1_5 Reverse -11 -24 -10.4038 0.201
NP_440988.1_10 Reverse -187 -201 10.2235 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATGACGCCCTCTTACTGCCACCAATGGGGATGGGCTGACAGAAAAAGTACATAGCTCGGAATGGCAAATTAACTATATCCAGTTGGAACGGGGTTAATTCCAGGCAGAGATTTTGAACTGTCCATGGTCTGATATGTAGCTAATCCGGGTACAACACAATCAGGTAATTAGATCTATGGGAATCTCACTGTCGAGAAAGGTGGCGATCGCCCTTGGACTGTTTGCGAGCTGTGTCAAAAATTTTGTGTTAGTGAACGAACCCTACGTTAAGACTTGCAAGAAACTTTTGGTATTGGCTCAAAAGCCTATTTGCAGACCGACAAACTCCATAGAGCTAGACGATAATTAAACTTAGCTGCCCCGGGGCAAACCACCGTTACGGCGATCGCCTTCACAGAT

CDS

GTGTCAGGATTCAATCAACAGTTAACGGATCAAATGTCGGCATTTTGCCAAGTTGCTTCCCCGGTGAACGAAAAAGGGACAAAATTCGCTCCCAATCAACCAGCCCATCGGGATTACACAGCGGCAGCCATGGTCCGTACTCTTAATTGCTTAGCCGAAGGAGCTAAGTAA

Protein

MSGFNQQLTDQMSAFCQVASPVNEKGTKFAPNQPAHRDYTAAAMVRTLNCLAEGAK