Your browser is old and dusty. Try Google Chrome!

Details for ssr2898

ORF ssr2898
Accession NP_441240.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY523m(partial copy): 1483390 - 1484062]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -192 -211 5.30933 0.163
NP_440795.1_7 Forward -199 -192 14.6904 0.0123
NP_440795.1_7 Reverse -192 -199 14.6904 0.0123
NP_440795.1_7 Forward -268 -261 10.6589 0.143
NP_441418.1_6 Forward -200 -181 -28.2215 0.203
NP_441418.1_6 Forward -338 -319 -28.7132 0.208
NP_441418.1_6 Reverse -191 -210 -29.0082 0.215
NP_442291.1_5 Reverse -190 -206 0.746852 0.158
NP_441453.1_4 Reverse -191 -199 16.539 0.00633
NP_441453.1_4 Forward -200 -192 16.539 0.00633
NP_441960.1_3 Reverse -191 -210 17.234 0.155
NP_442151.1_6 Reverse -191 -205 15.0442 0.0276
NP_442151.1_6 Forward -200 -186 8.06273 0.183
NP_441818.1_1 Reverse -192 -203 9.59626 0.232
NP_440226.1_1 Forward -200 -181 13.2741 0.0374
NP_440226.1_1 Reverse -191 -210 9.83255 0.0687
NP_441098.1_3 Reverse -57 -76 2.78143 0.25
NP_440996.1_3 Reverse -178 -196 14.9655 0.166
NP_440637.1_7 Forward -239 -220 9.93088 0.259
NP_443002.1_5 Reverse -240 -258 11.5231 0.247
NP_442173.1_1 Forward -199 -191 15.4574 0.00633
NP_442173.1_1 Reverse -192 -200 15.4574 0.00633
NP_442752.1_4 Forward -200 -193 13.8055 0.0199
NP_442752.1_4 Reverse -191 -198 13.8055 0.0199
NP_443027.1_4 Forward -202 -192 16.2046 0.0437
NP_441812.1_3 Reverse -190 -204 20.8458 0.00667
NP_442975.1_10 Forward -204 -190 21.3367 0.00107
NP_442975.1_10 Reverse -187 -201 1.47397 0.297
NP_440784.1_7 Forward -199 -192 15.9687 0.0123
NP_440784.1_7 Reverse -192 -199 15.9687 0.0123
NP_441250.1_3 Forward -160 -141 3.44104 0.263
NP_440061.1_9 Forward -202 -188 7.96378 0.185
NP_441476.1_5 Reverse -180 -199 -4.13045 0.246
NP_440878.1_9 Reverse -181 -200 -2.85214 0.281
NP_442062.1_8 Forward -200 -190 17.3846 0.00193
NP_442062.1_8 Reverse -191 -201 10.3048 0.0493
NP_441900.1_2 Forward -300 -282 -4.30813 0.288
NP_440304.1_4 Forward -202 -192 19.9412 0.00364
NP_440304.1_4 Reverse -189 -199 1.84832 0.299
NP_442242.1_4 Forward -199 -192 14.3954 0.0124
NP_442242.1_4 Reverse -192 -199 14.3954 0.0124
NP_440044.1_8 Forward -199 -180 12.2908 0.0427
NP_440044.1_8 Reverse -192 -211 4.12936 0.12
NP_441781.1_7 Forward -200 -181 7.47261 0.17
NP_440393.1_7 Forward -49 -30 17.5024 0.0677
NP_441492.1_5 Reverse -56 -75 4.31709 0.25
NP_440011.1_2 Reverse -344 -363 17.3057 0.14
NP_441619.1_8 Reverse -185 -199 10.2254 0.187
NP_441208.1_9 Reverse -188 -202 7.27608 0.223
NP_442110.1_7 Reverse -191 -205 10.9143 0.0644
NP_442110.1_7 Reverse -179 -193 5.60446 0.168
NP_441082.1_4 Forward -337 -318 18.1907 0.134
NP_440856.1_7 Reverse -329 -348 -8.85033 0.28
NP_441083.1_5 Forward -200 -190 20.3345 0.00053
NP_441083.1_5 Reverse -191 -201 11.2881 0.0159
NP_441434.1_7 Forward -198 -184 4.81781 0.225
NP_441738.1_2 Forward -198 -191 15.28 0.0102
NP_441738.1_2 Reverse -193 -200 15.28 0.0102
NP_441558.1_5 Forward -202 -183 11.5042 0.0801
NP_441558.1_5 Reverse -189 -208 3.93269 0.294
NP_440209.1_1 Reverse -191 -199 18.1123 0.00295
NP_440209.1_1 Forward -200 -192 18.1123 0.00295
NP_441444.1_1 Reverse -149 -168 4.81767 0.286
NP_442889.1_8 Forward -203 -189 19.0751 0.0084
NP_440447.1_6 Reverse -198 -216 3.95239 0.184
NP_440056.1_9 Forward -364 -345 12.7991 0.295
NP_442398.1_4 Reverse -324 -343 8.55343 0.232
NP_441713.1_1 Reverse -185 -204 -8.65367 0.155
NP_440178.1_7 Reverse -190 -209 -5.01543 0.0596
NP_442570.1_3 Reverse -183 -202 -5.21209 0.241
NP_440538.1_7 Reverse -336 -355 19.0142 0.278
NP_442111.1_4 Forward -201 -187 6.58777 0.12
NP_442111.1_4 Reverse -190 -204 1.96621 0.292
NP_440048.1_8 Reverse -121 -140 12.0942 0.279
NP_440906.1_5 Forward -199 -192 15.8704 0.0124
NP_440906.1_5 Reverse -192 -199 15.8704 0.0124
NP_440747.1_10 Reverse -188 -200 14.887 0.00223
NP_440747.1_10 Forward -203 -191 -1.92764 0.0192
NP_441486.1_1 Forward -203 -189 14.5526 0.00628
NP_441486.1_1 Reverse -188 -202 4.22782 0.0475
NP_441194.1_3 Reverse -369 -387 15.3588 0.218
NP_442145.1_4 Reverse -57 -76 9.11906 0.175
NP_442145.1_4 Reverse -58 -77 5.1084 0.261
NP_442145.1_4 Forward -77 -58 4.72643 0.274
NP_442145.1_4 Forward -78 -59 2.33913 0.299
NP_442850.1_10 Reverse -159 -178 17.146 0.293
NP_442634.1_4 Reverse -189 -203 -2.06536 0.149
NP_440842.1_4 Forward -76 -57 8.26883 0.115
NP_442848.1_1 Reverse -185 -199 -3.44199 0.267
NP_443018.1_3 Forward -199 -192 14.8871 0.0123
NP_443018.1_3 Reverse -192 -199 14.8871 0.0123
NP_441634.1_8 Reverse -189 -203 -4.7203 0.295
NP_440376.1_1 Forward -200 -191 19.4693 0.000692
NP_440376.1_1 Reverse -191 -200 19.4693 0.000692
NP_441588.1_4 Forward -198 -188 15.9097 0.0369
NP_441588.1_4 Reverse -193 -203 6.66654 0.185
NP_442687.1_7 Forward -201 -191 9.02648 0.0994
NP_442687.1_7 Reverse -190 -200 8.92815 0.0994
NP_441077.1_6 Reverse -53 -69 4.34438 0.255
NP_440642.1_10 Forward -113 -99 2.65393 0.277
NP_441950.1_7 Forward -254 -235 -1.47551 0.194
NP_441763.1_10 Forward -211 -192 12.585 0.129
NP_442658.1_1 Forward -202 -192 13.0576 0.04
NP_442658.1_1 Reverse -189 -199 6.76441 0.214
NP_442205.1_9 Forward -206 -190 -3.08806 0.278
NP_442205.1_9 Reverse -374 -390 -3.28472 0.282
NP_441414.1_9 Forward -200 -181 -9.34199 0.259
NP_441414.1_9 Reverse -191 -210 -10.817 0.296
NP_442300.1_3 Forward -228 -209 7.57094 0.185
NP_442937.1_5 Forward -154 -135 10.2259 0.168
NP_441958.1_5 Forward -201 -191 21.2195 0.000805
NP_441958.1_5 Reverse -190 -200 12.2714 0.00183
NP_442025.1_7 Reverse -191 -209 18.994 0.134
NP_440984.1_7 Forward -205 -191 7.9644 0.16
NP_442690.1_1 Forward -75 -56 -16.1268 0.283
NP_441580.1_6 Reverse -180 -199 -3.83545 0.235
NP_441580.1_6 Forward -211 -192 -9.24366 0.29
NP_440153.1_5 Reverse -192 -206 2.65453 0.219
NP_440153.1_8 Reverse -317 -330 -3.52063 0.295
NP_442119.1_9 Forward -179 -160 12.2908 0.245
NP_442064.1_1 Reverse -186 -205 -2.75381 0.146
NP_442064.1_4 Reverse -136 -155 5.2102 0.274
NP_442236.1_7 Reverse -184 -203 15.3391 0.186
NP_440993.1_2 Forward -205 -189 7.92501 0.157
NP_440602.1_8 Reverse -191 -205 15.2409 0.126
NP_442210.1_9 Reverse -175 -193 14.4738 0.209
NP_440138.1_6 Forward -205 -186 9.7334 0.171
NP_440138.1_6 Reverse -241 -260 5.50519 0.23
NP_441099.1_5 Reverse -181 -200 -11.2103 0.273
NP_440809.1_9 Forward -209 -191 -7.84733 0.225
NP_441938.1_1 Forward -340 -321 11.6025 0.167
NP_441294.1_7 Forward -204 -190 14.914 0.033
NP_441646.1_1 Reverse -184 -203 1.96607 0.224
NP_441646.1_1 Reverse -178 -197 1.0811 0.237
NP_442438.1_10 Reverse -186 -200 4.03116 0.152
NP_442438.1_10 Reverse -219 -233 1.47456 0.194
NP_442438.1_10 Forward -205 -191 0.589577 0.221
NP_441000.1_6 Reverse -190 -204 -4.81863 0.252
NP_442771.1_1 Forward -235 -217 -8.63398 0.2
NP_440484.1_3 Reverse -285 -299 8.35772 0.3
NP_440147.1_4 Reverse -189 -202 10.7374 0.0355
NP_440147.1_4 Forward -202 -189 3.75586 0.181
NP_441550.1_8 Reverse -189 -199 14.6309 0.0132
NP_441550.1_8 Forward -202 -192 13.0576 0.0273
NP_441916.1_7 Reverse -191 -201 18.9579 0.00144
NP_441916.1_7 Forward -200 -190 10.3048 0.0261
NP_441916.1_7 Reverse -260 -270 4.79825 0.159
NP_441916.1_10 Forward -208 -189 18.7807 0.0888
NP_440345.1_5 Reverse -51 -65 13.8565 0.276
NP_441041.1_4 Reverse -191 -210 -0.688862 0.0969
NP_441041.1_4 Forward -200 -181 -13.5702 0.291
NP_441041.1_4 Reverse -173 -192 -13.8652 0.297
NP_441041.1_7 Forward -203 -191 9.65268 0.108
NP_442396.1_5 Reverse -187 -200 20.1771 0.00762
NP_442004.1_6 Forward -200 -186 8.55439 0.14
NP_441725.1_5 Reverse -192 -202 11.1898 0.0247
NP_441725.1_5 Forward -199 -189 2.04498 0.115
NP_439966.1_7 Forward -202 -192 14.8275 0.0177
NP_439966.1_7 Reverse -189 -199 7.25606 0.15
NP_442941.1_3 Reverse -192 -202 19.9412 0.00262
NP_442941.1_3 Forward -199 -189 11.0914 0.0116
NP_440289.1_2 Forward -203 -190 13.3923 0.0132
NP_440983.1_5 Forward -200 -181 -1.7705 0.231
NP_440983.1_5 Forward -197 -178 -4.03212 0.251
NP_441554.1_4 Reverse -297 -311 14.4056 0.244
NP_440260.1_8 Reverse -182 -200 6.60732 0.154
NP_440802.1_3 Reverse -179 -198 11.7992 0.276
NP_442281.1_1 Forward -205 -191 17.2068 0.00633
NP_441079.1_7 Forward -74 -55 -0.39464 0.199
NP_442847.1_3 Forward -269 -250 4.03023 0.281
NP_442256.1_2 Reverse -189 -207 -8.04399 0.217
NP_440647.1_9 Forward -339 -321 8.57394 0.219
NP_440647.1_9 Reverse -189 -207 2.96908 0.283
NP_440647.1_9 Reverse -358 -376 2.77242 0.287
NP_440498.1_1 Forward -209 -191 19.587 0.0181
NP_442982.1_5 Forward -210 -191 14.2574 0.0761
NP_443030.1_1 Reverse -56 -73 14.5918 0.132
NP_441644.1_6 Reverse -191 -201 19.0557 0.000803
NP_441644.1_6 Forward -200 -190 17.3841 0.00127
NP_442215.1_2 Reverse -189 -205 7.72835 0.0674
NP_442177.1_5 Reverse -182 -196 7.66941 0.293
NP_442029.1_6 Reverse -186 -205 6.09597 0.244
NP_440253.1_2 Reverse -191 -209 -2.53746 0.268
NP_440253.1_4 Reverse -144 -163 12.1925 0.274
NP_440929.1_8 Forward -200 -191 19.2726 0.000701
NP_440929.1_8 Reverse -191 -200 19.2726 0.000701
NP_442933.1_10 Forward -200 -191 17.601 0.00325
NP_442933.1_10 Reverse -191 -200 17.601 0.00325
NP_441751.2_8 Forward -199 -185 -2.16369 0.132
NP_441751.2_8 Reverse -192 -206 -3.147 0.134
NP_442926.1_5 Reverse -186 -205 13.9592 0.15
NP_442554.1_8 Reverse -192 -202 16.9913 0.0065
NP_442554.1_8 Forward -199 -189 15.3197 0.00882
NP_441762.1_7 Forward -201 -189 0.530633 0.0747
NP_441762.1_7 Reverse -190 -202 -6.94252 0.284
NP_442142.1_4 Forward -203 -190 13.5883 0.0348
NP_442142.1_4 Reverse -317 -330 7.59019 0.135
NP_442142.1_4 Reverse -188 -201 3.55864 0.251
NP_442292.1_1 Forward -199 -190 18.486 0.00229
NP_442292.1_1 Reverse -192 -201 17.5026 0.00435
NP_442476.1_6 Forward -199 -185 9.73436 0.0801
NP_441711.1_4 Forward -209 -190 17.6007 0.0417
NP_443009.1_5 Reverse -190 -201 14.5128 0.02
NP_443009.1_5 Forward -201 -190 10.1862 0.0792
NP_442408.2_1 Reverse -191 -210 -1.18052 0.234
NP_441715.1_4 Reverse -192 -202 14.238 0.0295
NP_441715.1_4 Forward -199 -189 7.94484 0.107
NP_440015.1_9 Forward -182 -164 -1.06249 0.268
NP_440183.1_1 Forward -268 -249 6.09597 0.278
NP_440183.1_9 Reverse -322 -341 -21.0434 0.296
NP_441198.1_8 Forward -202 -192 13.2713 0.108
NP_440464.1_10 Forward -199 -189 13.0082 0.169
NP_441758.1_10 Reverse -56 -75 2.75194 0.189
NP_441468.1_1 Forward -199 -192 15.8704 0.0124
NP_441468.1_1 Reverse -192 -199 15.8704 0.0124
NP_441020.2_6 Reverse -189 -206 9.38028 0.173
NP_441673.1_1 Forward -200 -191 20.8459 0.000698
NP_441673.1_1 Reverse -191 -200 20.8459 0.000698
NP_441826.1_2 Forward -206 -192 -2.45868 0.271
NP_441330.1_1 Forward -205 -186 -1.96717 0.0791
NP_442868.1_6 Reverse -189 -199 9.81313 0.038
NP_442868.1_6 Forward -202 -192 1.06167 0.205
NP_442719.1_2 Reverse -311 -329 -9.91296 0.268
NP_441612.1_2 Reverse -299 -309 8.83972 0.21
NP_441612.1_2 Forward -200 -190 8.54929 0.21
NP_442361.1_3 Forward -206 -193 9.85238 0.272
NP_442361.1_3 Forward -248 -235 8.9674 0.285
NP_442427.1_8 Forward -209 -190 5.80098 0.252
NP_442808.1_1 Forward -201 -191 8.73102 0.0481
NP_442808.1_1 Reverse -190 -200 8.63269 0.0481
NP_441101.1_10 Forward -188 -169 1.37609 0.173
NP_442820.1_10 Reverse -163 -181 9.26226 0.27
NP_442542.1_9 Forward -207 -193 15.4369 0.0838
NP_442050.1_5 Forward -202 -192 18.0724 0.00365
NP_442050.1_5 Reverse -189 -199 7.64939 0.243
NP_440601.1_8 Reverse -181 -200 14.103 0.284
NP_441114.1_3 Reverse -241 -250 6.29291 0.285
NP_441518.1_3 Forward -210 -191 -14.1602 0.269
NP_441878.1_6 Forward -201 -191 10.5014 0.0176
NP_441878.1_6 Reverse -190 -200 10.4031 0.0176
NP_441036.1_3 Reverse -288 -307 -5.80207 0.296
NP_441036.1_8 Forward -201 -191 15.713 0.00724
NP_441036.1_8 Reverse -190 -200 8.33817 0.174
NP_442503.1_9 Reverse -328 -347 8.94757 0.22
NP_441557.1_5 Forward -200 -191 19.9609 0.000699
NP_441557.1_5 Reverse -191 -200 19.9609 0.000699
NP_441445.1_1 Reverse -182 -201 1.57275 0.252
NP_441590.1_1 Reverse -223 -242 11.2092 0.256
NP_441308.1_8 Forward -202 -192 13.353 0.218
NP_441458.1_8 Forward -74 -55 4.9832 0.265
NP_442830.1_5 Forward -228 -214 -1.57428 0.299
NP_442469.1_8 Reverse -168 -182 17.7975 0.167
NP_442183.1_1 Reverse -191 -205 9.34103 0.0986
NP_441574.1_1 Forward -389 -370 2.75272 0.155
NP_441574.1_1 Reverse -179 -198 -2.36049 0.226
NP_441574.1_1 Reverse -371 -390 -4.32711 0.252
NP_441238.1_5 Forward -112 -93 19.7631 0.0733
NP_441238.1_7 Forward -129 -110 14.5621 0.24
NP_442170.1_5 Reverse -191 -210 3.24438 0.172
NP_442347.1_2 Forward -199 -190 12.4878 0.056
NP_442347.1_2 Reverse -192 -201 3.34298 0.284
NP_442645.1_2 Reverse -183 -202 -12.3902 0.144
NP_441037.1_4 Reverse -189 -199 7.9999 0.237
NP_441037.1_4 Forward -202 -192 7.31769 0.237
NP_442508.1_3 Forward -250 -231 11.5042 0.242
NP_442508.1_9 Reverse -178 -192 20.7474 0.159
NP_440151.1_5 Reverse -173 -192 12.7825 0.121
NP_441633.1_3 Reverse -189 -202 1.00259 0.11
NP_440136.1_2 Forward -199 -192 15.9687 0.0123
NP_440136.1_2 Reverse -192 -199 15.9687 0.0123
NP_442590.1_10 Reverse -173 -192 10.9142 0.173
NP_442590.1_10 Reverse -206 -225 7.17762 0.23
NP_442998.1_10 Forward -198 -191 15.5754 0.0102
NP_442998.1_10 Reverse -193 -200 15.5754 0.0102
NP_440899.1_8 Forward -115 -96 -11.1119 0.296
NP_440299.1_1 Reverse -187 -200 18.9965 0.00298
NP_441799.1_1 Reverse -187 -201 15.8302 0.0163
NP_441799.1_1 Forward -204 -190 11.2087 0.0606
NP_441799.1_4 Forward -388 -369 -3.04881 0.203
NP_441007.1_10 Forward -205 -192 2.77255 0.183
NP_441007.1_10 Reverse -186 -199 1.10092 0.209
NP_440256.1_1 Forward -203 -184 6.29264 0.0308
NP_440256.1_1 Reverse -188 -207 5.11266 0.0386
NP_441559.1_8 Forward -303 -289 -6.29359 0.276
NP_441559.1_8 Reverse -334 -348 -6.88358 0.281
NP_440915.1_6 Reverse -187 -201 9.73436 0.039
NP_440997.1_8 Reverse -195 -214 16.5191 0.194
NP_441296.1_7 Forward -269 -250 13.6675 0.267
NP_442785.1_7 Forward -202 -188 10.4227 0.228
NP_442866.1_6 Reverse -189 -208 7.27595 0.258
NP_441464.1_8 Forward -200 -186 4.52282 0.269
NP_440695.1_5 Reverse -179 -198 -0.787193 0.284
NP_441939.1_3 Reverse -192 -211 10.4225 0.126
NP_441494.1_6 Reverse -164 -177 14.4739 0.168
NP_442993.1_1 Reverse -191 -207 9.69497 0.0178
NP_442386.1_9 Reverse -190 -199 13.8639 0.0289
NP_442386.1_9 Forward -201 -192 6.39082 0.219
NP_441750.1_4 Reverse -187 -206 6.68596 0.162
NP_441340.1_5 Forward -199 -192 15.6737 0.0124
NP_441340.1_5 Reverse -192 -199 15.6737 0.0124
NP_442484.1_2 Reverse -180 -199 14.0608 0.0493
NP_442240.1_1 Reverse -161 -180 4.42355 0.273
NP_442714.1_7 Forward -199 -180 -1.7705 0.292
NP_440586.1_1 Reverse -175 -194 -1.57384 0.237
NP_440586.1_1 Forward -252 -233 -4.32711 0.278
NP_440586.1_8 Forward -199 -192 13.2151 0.026
NP_440586.1_8 Reverse -192 -199 13.2151 0.026
NP_442251.1_6 Forward -199 -192 15.2804 0.0124
NP_442251.1_6 Reverse -192 -199 15.2804 0.0124
NP_440684.1_9 Reverse -185 -199 6.58777 0.298
NP_441262.1_3 Reverse -191 -198 14.7888 0.0223
NP_441262.1_3 Forward -200 -193 14.7888 0.0223
NP_440027.1_3 Forward -200 -182 3.8533 0.263
NP_443051.1_1 Forward -201 -192 19.5676 0.00335
NP_443051.1_1 Reverse -190 -199 10.4228 0.00754
NP_443051.1_5 Reverse -3 -22 9.43923 0.235
NP_440451.1_10 Forward -199 -180 7.37347 0.292
NP_441232.1_10 Reverse -180 -199 20.2556 0.0177
NP_439937.1_9 Forward -348 -331 -11.2699 0.248
NP_441595.1_5 Forward -392 -374 13.1955 0.17
NP_440926.1_9 Reverse -168 -187 10.4225 0.275
NP_440626.1_1 Forward -199 -180 10.1267 0.247
NP_440439.1_1 Forward -203 -190 1.88757 0.139
NP_440439.1_1 Reverse -163 -176 -1.06236 0.249
NP_440372.1_2 Forward -199 -192 16.3621 0.0124
NP_440372.1_2 Reverse -192 -199 16.3621 0.0124
NP_441803.1_2 Reverse -161 -180 -1.27885 0.297
NP_439977.1_5 Reverse -185 -204 0.58944 0.207
NP_440139.1_1 Forward -206 -187 3.53858 0.202
NP_441572.1_1 Reverse -189 -208 -1.57384 0.212
NP_441572.1_7 Forward -206 -187 -4.52377 0.238
NP_441572.1_7 Reverse -162 -181 -4.6221 0.24
NP_440267.1_2 Forward -205 -191 17.7968 0.0349
NP_442384.1_10 Forward -200 -187 16.7355 0.00732
NP_441877.1_9 Forward -77 -60 3.77542 0.284
NP_441018.1_7 Reverse -175 -194 9.83255 0.218
NP_441018.1_7 Reverse -181 -200 8.55425 0.242
NP_442790.1_4 Reverse -182 -201 -7.4737 0.153
NP_442262.1_10 Forward -199 -192 14.1988 0.0123
NP_442262.1_10 Reverse -192 -199 14.1988 0.0123
NP_441689.1_5 Forward -202 -192 17.8758 0.0158
NP_441689.1_5 Reverse -189 -199 5.78111 0.197
NP_440344.1_10 Forward -207 -190 -7.13932 0.115
NP_440344.1_10 Reverse -184 -201 -9.89259 0.16
NP_440531.1_6 Forward -208 -189 -3.54046 0.268
NP_441965.1_10 Forward -178 -162 10.6783 0.107
NP_440297.1_9 Reverse -192 -202 9.22315 0.0917
NP_440297.1_9 Forward -199 -189 -0.118297 0.282
NP_440350.1_5 Forward -308 -289 -6.98204 0.299
NP_442280.1_10 Reverse -181 -199 11.0063 0.213
NP_441896.1_5 Reverse -185 -192 15.3787 0.268
NP_441894.1_1 Forward -170 -151 29.2038 0.0000379
NP_441894.1_2 Forward -400 -382 27.3552 0.000124
NP_440999.1_2 Forward -193 -174 13.0775 0.177
NP_440888.1_2 Reverse -191 -205 16.2235 0.00758
NP_440888.1_2 Forward -200 -186 10.8154 0.0842
NP_440888.1_2 Forward -236 -222 5.70218 0.267
NP_442454.1_2 Reverse -58 -77 11.1244 0.259
NP_441771.1_4 Forward -78 -59 -4.91709 0.295
NP_440052.1_5 Reverse -180 -199 7.96426 0.095
NP_441949.1_5 Reverse -57 -76 19.2602 0.0465
NP_440575.1_1 Forward -314 -295 -1.96793 0.29
NP_441543.1_2 Forward -199 -190 16.9127 0.00359
NP_441543.1_2 Reverse -192 -201 15.9293 0.00518
NP_442845.1_2 Reverse -185 -199 16.2242 0.0636
NP_442845.1_2 Forward -206 -192 3.73617 0.279
NP_442710.1_7 Reverse -2 -21 -7.7994 0.299
NP_441469.1_8 Forward -228 -219 11.0128 0.189
NP_441469.1_8 Reverse -226 -235 6.68623 0.227
NP_441469.1_8 Forward -201 -192 6.5879 0.227
NP_441469.1_8 Reverse -190 -199 6.48957 0.227
NP_443064.1_6 Forward -200 -190 12.5669 0.0796
NP_443064.1_6 Reverse -191 -201 10.8217 0.13
NP_442578.1_7 Forward -199 -192 14.5921 0.026
NP_442578.1_7 Reverse -192 -199 14.5921 0.026
NP_440710.1_1 Forward -208 -190 -2.14413 0.189
NP_441462.1_2 Reverse -191 -201 20.2362 0.000805
NP_441462.1_2 Forward -200 -190 11.5831 0.00406
NP_443062.1_1 Reverse -191 -209 9.71601 0.129
NP_441410.1_3 Forward -209 -190 5.80098 0.23
NP_442204.1_1 Forward -204 -193 0.157002 0.283
NP_440544.1_5 Forward -306 -299 14.5681 0.264
NP_442780.1_1 Reverse -61 -80 10.0292 0.195
NP_440516.1_8 Forward -200 -191 16.9127 0.00442
NP_440516.1_8 Reverse -191 -200 16.9127 0.00442
NP_442428.1_4 Reverse -190 -209 7.37428 0.186
NP_442428.1_5 Forward -199 -192 15.8704 0.0124
NP_442428.1_5 Reverse -192 -199 15.8704 0.0124
NP_441267.1_1 Reverse -185 -204 0.196116 0.281
NP_442120.1_10 Reverse -146 -165 -10.522 0.259
NP_440673.1_2 Reverse -181 -200 15.3647 0.0888
NP_440673.1_3 Forward -198 -191 12.4288 0.0426
NP_440673.1_3 Reverse -193 -200 12.4288 0.0426
NP_440673.1_7 Reverse -158 -177 11.7992 0.108
NP_441052.1_2 Forward -200 -190 19.9412 0.00106
NP_441052.1_2 Reverse -191 -201 10.4031 0.0285
NP_440992.1_2 Reverse -213 -232 10.9142 0.265
NP_442219.1_8 Reverse -223 -242 10.0998 0.213
NP_442219.1_9 Forward -199 -190 17.7976 0.00718
NP_442219.1_9 Reverse -192 -201 8.25953 0.0681
NP_440436.1_4 Forward -199 -190 17.2072 0.00233
NP_440436.1_4 Reverse -192 -201 9.24241 0.0871
NP_440314.1_9 Forward -199 -180 -5.70374 0.225
NP_440648.1_1 Reverse -191 -210 3.53937 0.248
NP_442907.1_9 Forward -205 -186 0.392778 0.207
NP_441719.1_2 Reverse -188 -202 16.4239 0.191
NP_441719.1_4 Forward -199 -192 16.3621 0.0124
NP_441719.1_4 Reverse -192 -199 16.3621 0.0124
NP_441004.1_1 Forward -242 -223 -14.1602 0.265
NP_441004.1_1 Forward -254 -235 -17.2085 0.29
NP_441004.1_1 Reverse -284 -303 -18.1918 0.298
NP_442813.1_4 Forward -293 -274 2.85105 0.197
NP_442366.1_3 Reverse -190 -208 -1.16082 0.207
NP_442366.1_5 Reverse -188 -198 15.4175 0.0374
NP_443054.1_2 Forward -209 -195 5.21113 0.237
NP_443054.1_2 Forward -202 -188 1.57289 0.245
NP_442430.1_10 Forward -210 -191 11.3067 0.245
NP_441851.1_10 Reverse -190 -200 15.8113 0.00552
NP_441851.1_10 Forward -201 -191 8.53483 0.114
NP_441501.1_9 Reverse -312 -331 19.4681 0.122
NP_441273.1_9 Reverse -56 -75 12.926 0.279
NP_442515.1_1 Reverse -190 -204 2.65453 0.131
NP_442515.1_1 Forward -201 -187 -4.32697 0.298
NP_441683.1_7 Reverse -290 -309 -4.22878 0.244
NP_441540.1_4 Reverse -51 -70 19.5258 0.0796
NP_440463.1_8 Reverse -319 -338 7.01583 0.267
NP_441046.1_2 Reverse -363 -382 4.52268 0.228
NP_441349.1_10 Reverse -181 -200 0.982764 0.0852
NP_441349.1_10 Forward -210 -191 -4.13045 0.161
NP_441409.1_6 Forward -130 -111 -1.47551 0.0765
NP_441409.1_6 Reverse -185 -204 -7.86702 0.158
NP_440432.1_9 Reverse -192 -207 7.55138 0.0427
NP_440474.1_8 Reverse -192 -206 13.1753 0.0735
NP_442450.1_5 Forward -202 -192 9.41981 0.115
NP_442450.1_5 Reverse -189 -199 7.55152 0.13
NP_442168.1_5 Forward -199 -180 5.30933 0.202
NP_441031.1_1 Reverse -55 -74 4.12335 0.292
NP_441031.1_8 Reverse -318 -337 -4.42544 0.261
NP_440195.1_5 Forward -206 -187 3.24438 0.273
NP_442006.1_2 Reverse -281 -298 -8.90928 0.197
NP_442006.1_2 Forward -338 -321 -16.1858 0.243
NP_441570.1_1 Reverse -191 -209 7.68896 0.016
NP_441570.1_1 Forward -200 -182 -7.35568 0.0887
NP_441078.1_4 Forward -200 -191 19.6659 0.0007
NP_441078.1_4 Reverse -191 -200 19.6659 0.0007
NP_441094.1_6 Forward -207 -190 7.41293 0.278
NP_440526.1_3 Reverse -192 -203 1.82816 0.267
NP_440526.1_3 Forward -199 -188 1.04151 0.267
NP_441432.1_8 Reverse -190 -199 16.8143 0.00595
NP_441432.1_8 Forward -201 -192 16.8143 0.00595
NP_441432.1_9 Forward -69 -56 10.3436 0.252
NP_442320.1_8 Reverse -185 -199 6.98109 0.0223
NP_442320.1_8 Forward -206 -192 4.03116 0.0559
NP_442344.1_7 Reverse -192 -211 0.687771 0.0918
NP_441732.1_2 Forward -204 -188 -6.92296 0.0558
NP_441732.1_2 Reverse -307 -323 -16.9527 0.223
NP_440760.1_1 Forward -200 -181 -6.49039 0.0597
NP_442797.1_6 Forward -267 -248 14.0425 0.191
NP_442797.1_6 Reverse -193 -212 13.1698 0.217
NP_440199.1_10 Forward -203 -193 14.238 0.0861
NP_440713.1_4 Reverse -181 -200 8.55425 0.17
NP_442489.1_7 Forward -200 -191 20.1576 0.000695
NP_442489.1_7 Reverse -191 -200 20.1576 0.000695
NP_441706.1_1 Forward -32 -13 -1.7705 0.237
NP_440559.1_1 Forward -199 -190 17.4043 0.00658
NP_440559.1_1 Reverse -192 -201 8.65285 0.0586
NP_441659.2_8 Reverse -191 -201 20.9245 0.000805
NP_441659.2_8 Forward -200 -190 18.1713 0.00133
NP_441022.1_1 Forward -21 -12 11.1625 0.284
NP_442913.1_10 Forward -209 -190 11.6025 0.0421
NP_442913.1_10 Reverse -160 -179 0.58944 0.153
NP_441040.1_2 Reverse -189 -208 -15.8318 0.288
NP_442849.1_1 Reverse -287 -301 22.8124 0.04
NP_440335.1_9 Reverse -262 -280 9.95058 0.286
NP_440779.1_5 Reverse -191 -208 -14.6125 0.254
NP_441185.1_7 Forward -211 -192 13.2741 0.279
NP_442346.1_5 Reverse -190 -200 16.6963 0.00248
NP_442346.1_5 Forward -201 -191 16.303 0.00248
NP_440545.1_3 Reverse -187 -204 -4.77938 0.232
NP_441856.1_3 Reverse -357 -376 0.687771 0.213
NP_440010.1_10 Reverse -194 -213 1.86774 0.292
NP_442828.1_7 Reverse -286 -305 -4.13045 0.276
NP_440449.1_7 Reverse -174 -193 18.7807 0.115
NP_441833.1_3 Reverse -291 -305 18.4858 0.133
NP_441833.1_4 Forward -199 -192 15.9687 0.0124
NP_441833.1_4 Reverse -192 -199 15.9687 0.0124
NP_441329.1_6 Reverse -291 -310 0.238307 0.26
NP_442060.1_5 Reverse -178 -197 12.1925 0.29
NP_441112.1_6 Forward -210 -191 -0.295539 0.293
NP_442162.1_9 Forward -199 -192 16.2637 0.0124
NP_442162.1_9 Reverse -192 -199 16.2637 0.0124
NP_442796.1_10 Reverse -281 -300 6.58763 0.283
NP_440671.1_4 Forward -206 -192 5.50613 0.281
NP_440671.1_6 Forward -228 -209 10.52 0.297
NP_440224.1_1 Forward -211 -192 7.96426 0.0855
NP_442199.1_5 Forward -208 -189 5.99764 0.0876
NP_442140.1_3 Forward -199 -189 12.2714 0.0632
NP_441609.1_1 Forward -62 -43 -2.0655 0.278
NP_440875.1_9 Reverse -193 -203 7.59334 0.255
NP_441813.1_3 Reverse -287 -306 16.9521 0.238
NP_441813.1_5 Forward -202 -192 15.9097 0.01
NP_441813.1_5 Reverse -189 -199 8.63316 0.0367
NP_440590.1_4 Forward -199 -186 7.78743 0.0494
NP_440590.1_4 Reverse -192 -205 -5.78224 0.289
NP_440567.1_1 Forward -199 -185 17.5025 0.0153
NP_440567.1_1 Reverse -192 -206 6.29277 0.085
NP_442497.1_10 Reverse -192 -201 17.601 0.00813
NP_442497.1_10 Forward -199 -190 10.4228 0.0087
NP_440821.1_4 Forward -202 -192 11.0914 0.0146
NP_440821.1_4 Reverse -189 -199 9.41981 0.0286
NP_441239.1_1 Reverse -93 -112 30.0887 0.000201
NP_441239.1_1 Reverse -111 -130 19.6656 0.0183
NP_441239.1_7 Reverse -110 -129 18.1907 0.0791
NP_441239.1_9 Forward -202 -190 12.1337 0.0494
NP_441239.1_9 Reverse -336 -348 5.44718 0.221
NP_441239.1_9 Reverse -189 -201 3.38223 0.285
NP_441727.1_3 Reverse -184 -203 2.75272 0.299
NP_442627.1_4 Reverse -96 -114 19.5778 0.067
NP_440624.1_5 Forward -72 -54 6.70333 0.298
NP_441892.1_1 Forward -209 -192 -3.10775 0.233
NP_440665.1_1 Reverse -317 -336 -15.0452 0.264
NP_442270.1_9 Reverse -180 -199 -6.88371 0.209
NP_442643.1_1 Reverse -185 -204 -10.522 0.231
NP_441017.1_6 Forward -204 -190 12.192 0.224
NP_441874.1_1 Forward -90 -76 8.55439 0.298
NP_442216.1_4 Reverse -72 -80 8.08217 0.255
NP_442138.1_9 Forward -195 -176 16.5182 0.157
NP_442138.1_10 Reverse -191 -210 -0.295539 0.15
NP_442052.1_7 Reverse -214 -228 12.0943 0.277
NP_440546.1_4 Reverse -191 -201 13.5365 0.0459
NP_440546.1_4 Forward -200 -190 10.046 0.109
NP_440462.1_6 Forward -202 -192 16.893 0.00853
NP_440462.1_6 Reverse -189 -199 1.35667 0.294
NP_442611.1_1 Reverse -191 -210 -2.0655 0.284
NP_440868.1_4 Reverse -187 -199 6.1355 0.0878
NP_440868.1_4 Forward -204 -192 5.93884 0.0879
NP_441474.1_1 Forward -210 -191 -1.47628 0.262
NP_442402.1_4 Forward -305 -286 7.4718 0.121
NP_441084.1_6 Forward -202 -188 16.8098 0.0523
NP_442460.1_7 Reverse -179 -198 13.1758 0.0587
NP_440696.1_6 Forward -212 -193 9.24257 0.226
NP_441843.2_9 Reverse -193 -211 10.5893 0.23
NP_442923.1_6 Reverse -55 -69 12.5211 0.203
NP_442039.1_4 Forward -199 -192 15.1821 0.0124
NP_442039.1_4 Reverse -192 -199 15.1821 0.0124
NP_442039.1_7 Forward -255 -245 12.5664 0.227
NP_442679.1_1 Reverse -286 -305 1.37609 0.181
NP_441926.1_3 Reverse -191 -207 15.0048 0.0428
NP_440825.1_7 Forward -199 -189 12.9096 0.152
NP_442696.1_6 Reverse -23 -42 -13.1769 0.265
NP_442837.1_3 Forward -199 -192 15.7721 0.0124
NP_442837.1_3 Reverse -192 -199 15.7721 0.0124
NP_440160.1_9 Forward -234 -215 15.2408 0.204
NP_442053.1_1 Forward -200 -191 18.3876 0.0007
NP_442053.1_1 Reverse -191 -200 18.3876 0.0007
NP_440505.1_3 Forward -202 -192 15.123 0.014
NP_440505.1_3 Reverse -189 -199 9.22315 0.122
NP_441203.1_1 Reverse -192 -211 -12.4886 0.143
NP_442532.1_2 Reverse -55 -74 7.30471 0.201
NP_441408.2_7 Forward -202 -183 0.884433 0.215
NP_440914.1_1 Forward -200 -190 17.5935 0.000537
NP_440914.1_1 Reverse -191 -201 16.3248 0.00196
NP_441011.1_8 Reverse -192 -201 16.6177 0.00602
NP_441011.1_8 Forward -199 -190 8.25953 0.144
NP_442101.1_10 Forward -208 -189 -4.42544 0.137
NP_442533.1_6 Forward -200 -191 17.2076 0.00137
NP_442533.1_6 Reverse -191 -200 17.2076 0.00137
NP_440854.1_1 Reverse -92 -111 9.11906 0.152
NP_441482.1_7 Reverse -185 -199 -10.7185 0.213
NP_441482.1_7 Forward -206 -192 -10.9151 0.222
NP_439944.1_9 Reverse -192 -202 17.6796 0.00347
NP_439944.1_9 Forward -199 -189 10.5014 0.0887
NP_440816.1_2 Reverse -51 -70 11.1788 0.202
NP_441028.1_6 Forward -294 -284 10.9926 0.193
NP_440116.1_8 Reverse -192 -211 -3.44213 0.154
NP_441527.1_4 Reverse -291 -310 7.68668 0.0922
NP_441527.1_4 Reverse -294 -313 -7.78302 0.237
NP_441527.1_4 Forward -86 -67 -11.7937 0.284
NP_441527.1_4 Reverse -292 -311 -11.8892 0.284
NP_441527.1_4 Reverse -54 -73 -12.4621 0.288
NP_441527.1_8 Reverse -255 -274 6.39097 0.279
NP_440007.1_9 Forward -204 -190 2.85119 0.277
NP_439965.1_1 Reverse -182 -201 6.39097 0.076
NP_441680.1_4 Forward -180 -161 1.57275 0.246
NP_441170.1_4 Reverse -182 -200 4.9357 0.228
NP_441972.1_5 Forward -199 -180 13.5691 0.0347
NP_441106.1_1 Forward -201 -192 18.486 0.0028
NP_441106.1_1 Reverse -190 -199 9.63616 0.0311
NP_440429.1_2 Forward -199 -180 7.37428 0.289
NP_440429.1_4 Forward -207 -188 14.1591 0.25
NP_439903.1_6 Forward -203 -184 5.89851 0.176
NP_439903.1_6 Reverse -148 -167 -1.08295 0.292
NP_001035870.1_10 Reverse -282 -301 15.2672 0.19
NP_441286.1_1 Reverse -190 -202 14.3953 0.00424
NP_441286.1_1 Forward -201 -189 3.48056 0.0467
NP_441286.1_1 Forward -150 -138 -3.00928 0.145
NP_442674.1_2 Reverse -51 -70 20.354 0.0819
NP_440670.1_8 Forward -200 -191 18.3876 0.000699
NP_440670.1_8 Reverse -191 -200 18.3876 0.000699
NP_440886.1_7 Forward -201 -191 8.04271 0.0805
NP_440886.1_7 Reverse -190 -200 7.94438 0.0805
NP_442614.1_2 Reverse -224 -238 10.0294 0.235
NP_442072.1_9 Reverse -190 -208 -11.5839 0.0789
NP_441753.1_10 Forward -209 -190 16.5191 0.0654
NP_440907.2_8 Reverse -192 -202 9.51767 0.103
NP_440907.2_8 Forward -199 -189 7.64939 0.117
NP_441021.1_1 Forward -199 -180 -8.45701 0.195
NP_440326.1_5 Reverse -189 -202 15.2606 0.179
NP_440841.1_4 Forward -202 -183 9.43923 0.0652
NP_441463.1_3 Forward -210 -191 8.06259 0.0494
NP_441463.1_3 Reverse -181 -200 -3.24547 0.171
NP_441463.1_6 Forward -202 -188 6.99573 0.265
NP_442842.1_10 Forward -311 -292 1.92159 0.254
NP_441626.1_2 Forward -199 -192 15.7721 0.0124
NP_441626.1_2 Reverse -192 -199 15.7721 0.0124
NP_442794.1_1 Reverse -187 -199 9.38042 0.0795
NP_441401.1_1 Reverse -53 -72 11.7992 0.201
NP_442615.1_1 Reverse -182 -200 18.2104 0.00559
NP_442615.1_1 Forward -209 -191 5.03403 0.0413
NP_442467.1_4 Reverse -191 -210 9.83255 0.194
NP_441962.1_4 Forward -241 -222 -13.3736 0.272
NP_441742.1_7 Forward -181 -162 14.1591 0.245
NP_440387.1_1 Forward -200 -184 6.05672 0.0293
NP_440387.1_1 Reverse -191 -207 -0.43312 0.138
NP_440855.1_2 Forward -229 -210 15.6332 0.263
NP_441993.1_1 Reverse -185 -204 1.84923 0.269
NP_440114.1_10 Reverse -191 -205 19.3708 0.00349
NP_440114.1_10 Forward -200 -186 6.6861 0.26
NP_442437.1_8 Forward -247 -228 2.85105 0.296
NP_440293.1_3 Forward -355 -336 -6.39206 0.288
NP_440293.1_9 Reverse -198 -212 13.0837 0.216
NP_440293.1_10 Forward -286 -267 -1.18052 0.271
NP_441237.1_9 Forward -199 -189 14.828 0.0242
NP_442743.1_5 Forward -199 -180 10.9142 0.142
NP_439910.1_2 Forward -208 -191 -12.0559 0.0788
NP_442867.1_8 Reverse -322 -341 5.30933 0.276
NP_440457.1_1 Reverse -187 -199 0.825626 0.25
NP_440457.1_1 Forward -204 -192 0.137309 0.25
NP_440798.1_6 Reverse -192 -205 3.16588 0.152
NP_442680.1_5 Reverse -287 -306 5.73827 0.216
NP_442680.1_5 Reverse -95 -114 -1.19775 0.299
NP_442297.1_9 Forward -307 -288 14.7483 0.239
NP_442509.1_9 Forward -200 -190 8.14104 0.192
NP_442509.1_9 Reverse -191 -201 8.04271 0.192
NP_442582.1_3 Reverse -56 -70 15.1948 0.196
NP_441159.1_8 Forward -120 -101 0.293673 0.236
NP_440554.1_4 Reverse -192 -202 16.1063 0.0189
NP_441885.1_5 Forward -200 -190 20.9245 0.000538
NP_441885.1_5 Reverse -191 -201 11.3864 0.00668
NP_442341.1_9 Forward -202 -188 9.24208 0.155
NP_442341.1_9 Reverse -189 -203 6.39049 0.228
NP_441756.1_5 Reverse -35 -54 -2.26216 0.272
NP_441173.1_9 Forward -59 -51 14.0803 0.17
NP_440191.1_8 Forward -313 -295 16.2429 0.254
NP_443000.1_7 Forward -202 -192 17.4829 0.00719
NP_443000.1_7 Reverse -189 -199 10.3048 0.0345
NP_442513.1_5 Forward -208 -189 8.35677 0.274
NP_441842.1_10 Forward -207 -193 13.5693 0.0742
NP_441842.1_10 Reverse -184 -198 9.73436 0.182
NP_440275.1_3 Forward -202 -192 9.12481 0.055
NP_440275.1_3 Reverse -189 -199 8.04317 0.0602
NP_440091.1_1 Forward -204 -192 8.9871 0.0567
NP_440091.1_1 Reverse -187 -199 1.41561 0.197
NP_443060.1_5 Reverse -183 -202 14.9449 0.109
NP_440679.1_5 Reverse -326 -345 5.70265 0.292
NP_442638.1_2 Reverse -110 -129 23.5989 0.0136
NP_440175.1_7 Reverse -175 -193 12.7788 0.207
NP_440149.1_8 Forward -200 -181 -7.67036 0.29
NP_440216.1_1 Reverse -191 -205 15.8309 0.00314
NP_440216.1_1 Forward -200 -186 -1.47537 0.0328
NP_440172.1_1 Reverse -191 -201 17.5813 0.00421
NP_440172.1_1 Forward -200 -190 15.0247 0.00945
NP_442418.1_4 Reverse -306 -324 11.079 0.259
NP_442015.1_10 Reverse -187 -200 1.49425 0.204
NP_441226.1_7 Forward -199 -192 14.4934 0.0123
NP_441226.1_7 Reverse -192 -199 14.4934 0.0123
NP_441757.1_3 Reverse -190 -209 8.65258 0.107
NP_441111.1_7 Forward -199 -191 18.7023 0.00294
NP_441111.1_7 Reverse -192 -200 18.7023 0.00294
NP_442379.1_10 Forward -207 -190 -4.09106 0.281
NP_439971.2_8 Reverse -294 -308 11.996 0.296
NP_441766.1_2 Forward -200 -191 17.5026 0.00297
NP_441766.1_2 Reverse -191 -200 17.5026 0.00297
NP_442417.1_5 Reverse -248 -262 4.52282 0.292
NP_440416.1_1 Reverse -191 -210 -1.67217 0.116
NP_440416.1_9 Forward -292 -273 -13.6686 0.169
NP_440416.1_9 Forward -229 -210 -17.8968 0.248
NP_443052.1_8 Forward -210 -191 6.78429 0.0293
NP_443052.1_9 Reverse -238 -257 -0.295539 0.207
NP_443052.1_9 Forward -232 -213 -3.73712 0.251
NP_440591.1_9 Forward -251 -233 6.80398 0.215
NP_440261.1_5 Reverse -192 -205 -10.6988 0.203
NP_440261.1_7 Reverse -337 -356 -6.39206 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCACCAATGCGAGTGATGGATTCCACCACTAACTTGTCTCCGGCAACATTCTGGACCATGTCGGCCAATACGGTGAAGGTGGTTAAAACCTTCTTTTTCTCCTCTGTTTCCCCCTGGACTTCTGTGGTTACGGCTGTCACTTCTTCGCTGGGAGCATTGGATGTCGTGACTTCCGCCGTGCCACAACCGGTCAGCCAAAAGGCGATCGCCAAACCAGACGCCAGCAGTCCTCCCCGGGAAGCAAATGATGTTGCCATAGTGATAATGGTCTTTCATGATCATCTCATTTTTCATTATCTTCTCATAATTGCAGTGAAAACGGGGAGTTAAAATTTCTTAACTTTTACCAACTGGTAAGCTCGTGGGCTTTTTCTGACCACTAAAACTTTCTGCTTTTTAC

CDS

ATGCTCAGAACGGGGTGTGCCTGGCGACTTGTACCCCACGATTTTCCTAAATGGCGAACGGTCTATGGTTATTTCCAGCCATGGCACGAAGATGGTACCTGGAAAAAATTAAACCGTATCTTCCGTGAGAAAGTTCGGCTCAAAGCTGGAAGAAATACTCACCCTAGTGCCGGTTGTTTAGATTCACAGTCACTCAAAAGGGCTTGA

Protein

MLRTGCAWRLVPHDFPKWRTVYGYFQPWHEDGTWKKLNRIFREKVRLKAGRNTHPSAGCLDSQSLKRA