Your browser is old and dusty. Try Google Chrome!

Details for ssr2806

ORF ssr2806
Accession NP_441686.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -365 -379 -2.16369 0.285
NP_441418.1_6 Reverse -3 -22 -21.3384 0.147
NP_441605.1_6 Forward -173 -154 11.6025 0.161
NP_441453.1_4 Forward -48 -40 7.19758 0.0757
NP_441453.1_4 Reverse -39 -47 6.80426 0.121
NP_441453.1_7 Forward -312 -305 14.1988 0.175
NP_441453.1_7 Forward -79 -72 11.9372 0.298
NP_442151.1_6 Reverse -339 -353 11.701 0.0933
NP_442151.1_6 Forward -319 -305 8.06273 0.183
NP_442182.1_4 Forward -203 -184 17.404 0.0613
NP_441818.1_9 Forward -277 -258 -5.80207 0.257
NP_441818.1_9 Forward -295 -276 -9.53865 0.291
NP_440226.1_1 Forward -48 -29 6.4893 0.128
NP_441465.1_8 Forward -147 -129 4.73903 0.299
NP_441630.1_3 Reverse -31 -50 6.88262 0.126
NP_440120.1_8 Forward -263 -245 19.7837 0.0682
NP_442287.1_3 Reverse -31 -48 15.8694 0.188
NP_442173.1_1 Reverse -40 -48 7.68924 0.142
NP_442173.1_1 Forward -47 -39 5.72262 0.203
NP_442173.1_3 Forward -78 -68 16.598 0.196
NP_442752.1_4 Reverse -39 -46 13.8055 0.0199
NP_442752.1_4 Reverse -3 -10 5.44732 0.202
NP_443027.1_4 Reverse -1 -11 12.9597 0.0595
NP_443027.1_4 Reverse -37 -47 9.41981 0.163
NP_443027.1_4 Forward -50 -40 7.84651 0.228
NP_441812.1_3 Reverse -38 -52 11.701 0.21
NP_442975.1_10 Forward -52 -38 11.012 0.0516
NP_440784.1_7 Reverse -40 -47 6.23397 0.241
NP_440784.1_7 Forward -47 -40 6.13563 0.241
NP_440061.1_9 Forward -50 -36 7.76712 0.194
NP_442062.1_8 Reverse -39 -49 7.55152 0.0946
NP_442062.1_8 Reverse -3 -13 5.97822 0.143
NP_442242.1_4 Forward -47 -40 10.8555 0.127
NP_440044.1_8 Reverse -40 -59 -2.65548 0.265
NP_439918.1_2 Forward -379 -360 1.37609 0.217
NP_442196.1_10 Forward -103 -84 13.3725 0.201
NP_440300.1_1 Reverse -237 -256 6.88182 0.281
NP_441738.1_2 Forward -46 -39 15.28 0.0102
NP_441738.1_2 Forward -10 -3 9.77352 0.143
NP_440209.1_1 Reverse -39 -47 8.57422 0.0425
NP_440209.1_1 Forward -48 -40 5.32929 0.139
NP_442570.1_3 Forward -376 -357 -3.63879 0.224
NP_440906.1_5 Reverse -40 -47 6.23397 0.234
NP_440906.1_5 Forward -47 -40 6.13563 0.241
NP_440747.1_10 Reverse -36 -48 -12.1541 0.227
NP_441486.1_1 Forward -15 -1 -2.26202 0.175
NP_441194.1_1 Reverse -257 -276 13.0342 0.238
NP_442634.1_4 Reverse -37 -51 7.47274 0.0479
NP_443018.1_3 Reverse -40 -47 12.6255 0.0471
NP_443018.1_3 Forward -392 -385 8.39725 0.147
NP_443018.1_3 Forward -47 -40 5.25066 0.214
NP_440376.1_1 Reverse -39 -48 -0.000272808 0.285
NP_440376.1_1 Forward -48 -39 -0.0986038 0.285
NP_440642.1_10 Forward -315 -301 1.86729 0.287
NP_441013.1_2 Forward -398 -380 -4.30741 0.298
NP_441422.1_7 Reverse -174 -191 -4.87771 0.247
NP_442782.1_2 Forward -379 -365 0.589577 0.288
NP_442205.1_9 Reverse -33 -49 -1.51476 0.264
NP_441958.1_5 Reverse -38 -48 10.5014 0.0119
NP_441958.1_5 Forward -49 -39 1.65166 0.0872
NP_442025.1_7 Reverse -39 -57 15.0979 0.275
NP_443001.1_7 Reverse -65 -84 3.53937 0.279
NP_442690.1_1 Reverse -151 -170 -6.78538 0.169
NP_442690.1_1 Forward -65 -46 -17.1101 0.297
NP_442911.1_2 Forward -22 -3 -5.40875 0.158
NP_440153.1_5 Forward -47 -33 1.67122 0.245
NP_443055.1_3 Reverse -30 -49 17.234 0.06
NP_440496.1_10 Forward -59 -45 18.6818 0.258
NP_442438.1_10 Forward -17 -3 14.3559 0.0311
NP_442431.1_10 Forward -191 -173 4.34571 0.206
NP_441473.1_6 Reverse -291 -301 17.4963 0.29
NP_441550.1_8 Reverse -37 -47 6.56775 0.201
NP_441916.1_7 Forward -48 -38 16.4013 0.00539
NP_441916.1_7 Reverse -39 -49 7.15819 0.0745
NP_440345.1_3 Forward -170 -156 15.0039 0.215
NP_441041.1_4 Forward -354 -335 -2.55715 0.114
NP_440703.1_9 Reverse -304 -317 10.9334 0.192
NP_439966.1_7 Reverse -37 -47 4.60114 0.265
NP_439966.1_7 Forward -50 -40 4.30615 0.279
NP_442941.1_3 Forward -47 -37 9.41981 0.0319
NP_442941.1_3 Reverse -40 -50 7.64985 0.0628
NP_441076.1_1 Forward -178 -159 12.9997 0.208
NP_440260.1_8 Forward -376 -358 -4.11075 0.264
NP_440260.1_8 Reverse -123 -141 -5.48739 0.275
NP_442281.1_1 Forward -398 -384 5.80051 0.146
NP_441334.1_7 Forward -50 -31 -3.93378 0.114
NP_440437.1_1 Forward -54 -35 -1.67217 0.205
NP_442012.1_1 Forward -349 -330 0.294447 0.241
NP_441644.1_6 Forward -48 -38 7.74772 0.117
NP_441795.1_5 Forward -252 -233 6.09597 0.255
NP_442029.1_1 Forward -288 -269 -20.1584 0.297
NP_442933.1_10 Forward -48 -39 15.1427 0.00958
NP_442933.1_10 Reverse -39 -48 7.96454 0.0937
NP_441751.2_8 Forward -47 -33 -5.31028 0.202
NP_442554.1_8 Forward -47 -37 7.45319 0.092
NP_442554.1_8 Reverse -385 -395 3.71661 0.215
NP_442167.1_3 Reverse -14 -32 13.7847 0.297
NP_441586.1_6 Reverse -337 -356 3.93269 0.277
NP_441762.1_7 Forward -13 -1 -5.76255 0.238
NP_442292.1_1 Forward -47 -38 7.66954 0.0634
NP_443009.1_5 Reverse -38 -49 4.97473 0.222
NP_442408.2_1 Forward -48 -29 -5.40875 0.27
NP_442408.2_7 Forward -83 -64 19.8623 0.0726
NP_441715.1_4 Forward -47 -37 6.96153 0.121
NP_441715.1_4 Forward -11 -1 6.46988 0.143
NP_441468.1_1 Reverse -40 -47 6.13563 0.209
NP_441468.1_1 Forward -47 -40 6.0373 0.223
NP_441015.1_10 Forward -288 -269 -5.9004 0.235
NP_441673.1_1 Forward -48 -39 1.27803 0.155
NP_441673.1_1 Reverse -39 -48 1.27803 0.155
NP_442253.1_5 Reverse -355 -372 -3.99273 0.292
NP_441826.1_2 Forward -399 -385 -4.81863 0.3
NP_442868.1_6 Reverse -37 -47 0.668351 0.213
NP_442227.1_2 Reverse -377 -396 -3.24547 0.29
NP_442361.1_3 Reverse -203 -216 9.75405 0.272
NP_442542.1_9 Reverse -32 -46 12.782 0.109
NP_442050.1_5 Forward -50 -40 13.1559 0.0421
NP_441518.1_3 Reverse -29 -48 -13.1769 0.264
NP_441878.1_6 Reverse -76 -86 -0.0199663 0.163
NP_441036.1_8 Reverse -38 -48 10.6981 0.158
NP_441036.1_8 Forward -13 -3 6.17489 0.242
NP_441036.1_8 Forward -49 -39 6.07655 0.242
NP_441557.1_5 Reverse -39 -48 8.94785 0.0289
NP_441557.1_5 Forward -48 -39 0.688044 0.128
NP_441557.1_5 Reverse -3 -12 -0.885252 0.26
NP_439980.1_1 Forward -347 -328 14.5672 0.288
NP_442347.1_2 Forward -11 -2 7.37455 0.126
NP_442347.1_2 Reverse -169 -178 6.98123 0.138
NP_442347.1_2 Forward -47 -38 3.14632 0.286
NP_442645.1_2 Forward -253 -234 -19.2734 0.286
NP_442888.1_8 Reverse -72 -91 11.7992 0.209
NP_442047.1_2 Forward -78 -64 14.7492 0.19
NP_440136.1_2 Reverse -40 -47 6.23397 0.171
NP_440136.1_2 Forward -47 -40 6.13563 0.193
NP_442590.1_10 Forward -360 -341 4.81767 0.27
NP_442998.1_10 Forward -46 -39 15.5754 0.0102
NP_440899.1_2 Reverse -28 -47 10.815 0.147
NP_441799.1_1 Reverse -35 -49 6.68548 0.165
NP_440256.1_1 Forward -51 -32 9.53756 0.0203
NP_440256.1_1 Reverse -36 -55 -9.73531 0.287
NP_441362.1_4 Forward -241 -223 17.5221 0.0462
NP_441559.1_8 Reverse -304 -318 -5.80194 0.27
NP_441270.1_5 Forward -269 -250 12.3111 0.237
NP_441866.1_4 Reverse -155 -168 12.3695 0.282
NP_440134.1_2 Forward -173 -154 5.50599 0.298
NP_442452.1_3 Forward -147 -128 7.07928 0.213
NP_442866.1_1 Reverse -379 -398 -1.7705 0.204
NP_441464.1_1 Reverse -31 -50 6.68596 0.285
NP_440695.1_6 Forward -173 -159 12.5444 0.26
NP_441199.1_6 Reverse -172 -191 3.53937 0.179
NP_441494.1_4 Forward -284 -266 13.1955 0.289
NP_442993.1_1 Reverse -39 -55 10.5799 0.0169
NP_442386.1_9 Reverse -196 -205 6.78414 0.219
NP_442386.1_9 Forward -13 -4 4.62087 0.294
NP_442386.1_9 Reverse -2 -11 4.52254 0.297
NP_441340.1_5 Reverse -340 -347 8.8889 0.084
NP_441340.1_5 Reverse -40 -47 6.23397 0.132
NP_441340.1_5 Forward -47 -40 5.84064 0.208
NP_442240.1_2 Forward -47 -28 -15.9302 0.23
NP_440586.1_8 Reverse -40 -47 14.69 0.026
NP_440586.1_8 Forward -392 -385 7.21693 0.27
NP_442251.1_6 Forward -47 -40 12.0355 0.0627
NP_441262.1_3 Reverse -39 -46 14.7888 0.0223
NP_443051.1_1 Reverse -38 -47 10.0295 0.0139
NP_443051.1_1 Forward -49 -40 0.393051 0.169
NP_439937.1_9 Reverse -2 -19 -13.7281 0.287
NP_440439.1_1 Reverse -36 -49 11.3273 0.0339
NP_440372.1_2 Reverse -40 -47 6.82395 0.0854
NP_440372.1_2 Forward -47 -40 6.52896 0.188
NP_440171.1_3 Forward -262 -243 2.16274 0.288
NP_440316.1_10 Reverse -390 -400 5.97822 0.275
NP_440267.1_2 Forward -53 -39 8.84875 0.162
NP_442384.1_10 Forward -48 -35 1.49425 0.257
NP_442262.1_10 Reverse -40 -47 12.9205 0.0422
NP_442262.1_10 Forward -392 -385 10.7572 0.124
NP_442262.1_10 Forward -93 -86 7.21728 0.281
NP_441689.1_5 Forward -50 -40 17.5808 0.0345
NP_441689.1_5 Reverse -195 -205 9.91099 0.132
NP_441689.1_5 Forward -14 -4 5.68278 0.215
NP_441689.1_5 Reverse -382 -392 5.38779 0.265
NP_440344.1_10 Forward -19 -2 -9.99092 0.163
NP_440344.1_10 Forward -213 -196 -12.4492 0.254
NP_440562.1_1 Reverse -254 -273 13.175 0.235
NP_440297.1_9 Forward -85 -75 -0.118297 0.282
NP_440888.1_2 Reverse -3 -17 9.53707 0.123
NP_440888.1_4 Forward -342 -328 16.6245 0.218
NP_440600.1_4 Reverse -31 -49 7.29564 0.0913
NP_441543.1_2 Reverse -40 -49 11.0128 0.0598
NP_441543.1_2 Forward -47 -38 6.09625 0.153
NP_442845.1_2 Forward -119 -105 5.1128 0.243
NP_442845.1_2 Forward -258 -244 4.81781 0.251
NP_442845.1_4 Reverse -37 -56 7.86593 0.189
NP_441178.1_6 Reverse -94 -113 1.96529 0.276
NP_441469.1_8 Forward -13 -4 5.99792 0.241
NP_442315.1_2 Forward -257 -245 9.47875 0.291
NP_442578.1_7 Reverse -40 -47 14.6904 0.026
NP_441462.1_2 Reverse -39 -49 9.91146 0.0136
NP_441462.1_2 Forward -48 -38 0.668351 0.135
NP_441929.1_6 Reverse -347 -366 4.916 0.294
NP_443062.1_1 Forward -348 -330 3.96308 0.279
NP_441410.1_3 Forward -138 -119 9.43923 0.192
NP_442204.1_1 Reverse -35 -46 9.59678 0.0736
NP_440516.1_8 Reverse -39 -48 0.983037 0.13
NP_441033.1_2 Forward -32 -13 -2.36049 0.155
NP_442428.1_5 Reverse -40 -47 6.13563 0.209
NP_442428.1_5 Forward -47 -40 6.0373 0.212
NP_440673.1_3 Forward -46 -39 12.4288 0.0426
NP_440436.1_4 Forward -11 -2 5.50585 0.195
NP_441336.1_3 Forward -329 -315 14.5526 0.298
NP_441719.1_4 Reverse -40 -47 13.5105 0.026
NP_441719.1_4 Forward -47 -40 6.52896 0.188
NP_441004.1_4 Forward -279 -269 8.04317 0.282
NP_442366.1_5 Forward -148 -138 10.206 0.282
NP_439949.1_7 Forward -309 -295 10.816 0.291
NP_440296.1_10 Forward -396 -377 -12.6852 0.269
NP_442206.1_10 Forward -348 -333 10.7963 0.12
NP_442206.1_10 Forward -398 -383 2.63483 0.201
NP_442308.1_3 Forward -95 -76 15.8307 0.251
NP_441851.1_10 Forward -207 -197 10.5998 0.0887
NP_441851.1_10 Reverse -2 -12 6.46988 0.167
NP_441851.1_10 Reverse -38 -48 5.78156 0.2
NP_442622.1_8 Forward -48 -30 0.412472 0.0762
NP_442515.1_1 Reverse -309 -323 6.88276 0.097
NP_440593.1_3 Reverse -269 -288 -0.4922 0.205
NP_441982.1_6 Forward -165 -156 13.2493 0.274
NP_442689.1_8 Reverse -155 -172 8.10198 0.138
NP_441349.1_10 Forward -58 -39 -0.39387 0.0947
NP_440432.1_9 Forward -47 -32 6.6664 0.046
NP_441124.1_5 Reverse -160 -170 13.5811 0.215
NP_442006.1_2 Reverse -30 -47 -8.0243 0.192
NP_443047.1_7 Forward -47 -28 5.211 0.245
NP_441570.1_1 Forward -48 -30 0.314141 0.0395
NP_441078.1_4 Reverse -39 -48 0.0980582 0.205
NP_441078.1_4 Forward -48 -39 0.0980582 0.205
NP_441663.1_8 Reverse -303 -322 3.04771 0.194
NP_440707.1_6 Forward -20 -1 12.88 0.197
NP_441432.1_8 Reverse -38 -47 7.27622 0.101
NP_441072.1_2 Forward -196 -177 5.40766 0.296
NP_442489.1_7 Forward -48 -39 7.57121 0.057
NP_442489.1_7 Reverse -39 -48 0.589713 0.17
NP_442079.1_7 Forward -47 -28 4.916 0.184
NP_440559.1_1 Reverse -40 -49 5.70292 0.137
NP_441659.2_6 Forward -274 -255 15.9282 0.147
NP_441659.2_8 Forward -48 -38 9.02648 0.037
NP_441659.2_8 Reverse -39 -49 1.74999 0.227
NP_440426.1_7 Reverse -29 -48 -0.197208 0.293
NP_442913.1_10 Reverse -187 -206 -1.27885 0.168
NP_442776.1_1 Forward -80 -61 7.17762 0.209
NP_442346.1_5 Reverse -38 -48 6.66654 0.195
NP_442346.1_5 Forward -277 -267 4.3066 0.291
NP_442346.1_5 Forward -49 -39 4.3066 0.291
NP_440459.1_2 Reverse -382 -399 19.41 0.0619
NP_440010.1_10 Forward -148 -129 1.57275 0.297
NP_442603.1_7 Reverse -384 -398 7.17714 0.211
NP_440449.1_6 Reverse -357 -375 5.24068 0.283
NP_441833.1_4 Forward -47 -40 6.52896 0.0924
NP_441833.1_4 Reverse -40 -47 6.23397 0.163
NP_442498.1_7 Forward -150 -133 17.9423 0.131
NP_442162.1_9 Reverse -40 -47 6.62729 0.142
NP_442162.1_9 Forward -47 -40 6.52896 0.178
NP_440224.1_1 Reverse -28 -47 0.0977854 0.139
NP_440875.1_9 Forward -46 -36 13.5309 0.0677
NP_441813.1_5 Reverse -37 -47 8.4365 0.0432
NP_441813.1_5 Forward -50 -40 5.48657 0.123
NP_442497.1_10 Forward -47 -38 7.76787 0.0731
NP_442497.1_10 Reverse -40 -49 5.99792 0.095
NP_440821.1_4 Reverse -1 -11 6.07655 0.1
NP_440227.1_2 Reverse -152 -168 9.30165 0.29
NP_441239.1_9 Reverse -75 -87 6.1355 0.2
NP_441892.1_1 Reverse -30 -47 8.00365 0.0841
NP_440604.1_6 Forward -393 -374 -3.44213 0.225
NP_440833.1_6 Reverse -324 -338 9.04542 0.267
NP_442138.1_10 Forward -48 -29 -5.9004 0.274
NP_440546.1_4 Reverse -39 -49 7.13728 0.257
NP_440546.1_4 Reverse -3 -13 6.65249 0.288
NP_440462.1_6 Reverse -37 -47 15.5163 0.0142
NP_440462.1_6 Forward -50 -40 6.56821 0.109
NP_440462.1_6 Reverse -1 -11 3.81494 0.228
NP_442565.1_7 Forward -235 -221 20.4524 0.0961
NP_440868.1_4 Reverse -35 -47 7.80712 0.0637
NP_441249.1_8 Forward -257 -238 14.6508 0.115
NP_441249.1_8 Forward -266 -247 0.884433 0.284
NP_442402.1_4 Reverse -301 -320 -8.55607 0.283
NP_442402.1_4 Reverse -147 -166 -9.14605 0.285
NP_441848.1_4 Forward -170 -154 10.6064 0.25
NP_441848.1_7 Reverse -162 -181 1.6703 0.228
NP_441843.2_9 Reverse -170 -188 11.0756 0.225
NP_442039.1_4 Forward -11 -4 7.80726 0.24
NP_442837.1_3 Forward -47 -40 12.1338 0.0702
NP_442837.1_3 Reverse -40 -47 6.0373 0.25
NP_440160.1_2 Forward -87 -68 -9.24366 0.293
NP_442053.1_1 Forward -48 -39 6.8829 0.111
NP_440505.1_3 Reverse -37 -47 8.33817 0.145
NP_441203.1_1 Reverse -40 -59 -15.1435 0.214
NP_442255.1_3 Reverse -301 -320 11.1109 0.208
NP_440009.1_1 Forward -235 -216 9.93088 0.26
NP_440914.1_1 Reverse -365 -375 7.44401 0.237
NP_440914.1_1 Reverse -197 -207 7.34642 0.241
NP_441011.1_8 Reverse -40 -49 8.25953 0.144
NP_441011.1_8 Forward -47 -38 6.78456 0.184
NP_442533.1_6 Reverse -39 -48 5.40793 0.14
NP_442533.1_6 Forward -393 -384 1.47469 0.298
NP_440263.1_5 Reverse -156 -170 8.94771 0.294
NP_439944.1_9 Reverse -40 -50 6.66654 0.172
NP_441028.1_6 Reverse -169 -179 11.2876 0.193
NP_440116.1_8 Reverse -340 -359 -6.88371 0.218
NP_440115.1_6 Reverse -36 -46 13.0581 0.0818
NP_442728.1_6 Forward -195 -176 15.9291 0.122
NP_441602.1_4 Reverse -28 -47 11.7008 0.278
NP_441972.1_5 Reverse -298 -317 -5.50708 0.222
NP_441106.1_1 Reverse -38 -47 8.75118 0.0469
NP_441106.1_1 Forward -49 -40 7.96454 0.0647
NP_439903.1_6 Reverse -367 -386 -1.27961 0.295
NP_441886.1_7 Forward -342 -323 15.0441 0.0858
NP_441463.1_6 Reverse -382 -396 5.25632 0.297
NP_441626.1_2 Reverse -40 -47 6.13563 0.177
NP_441626.1_2 Forward -47 -40 5.93897 0.231
NP_442794.1_1 Forward -352 -340 4.07055 0.279
NP_442615.1_1 Forward -57 -39 -2.53746 0.145
NP_441193.1_1 Reverse -235 -254 12.1917 0.229
NP_441993.1_1 Forward -191 -172 3.79838 0.228
NP_440114.1_10 Forward -48 -34 7.37441 0.236
NP_440114.1_10 Reverse -39 -53 6.09611 0.285
NP_440293.1_3 Forward -375 -356 -6.58872 0.291
NP_441237.1_9 Reverse -385 -395 11.4848 0.176
NP_441133.1_3 Reverse -356 -375 11.5042 0.295
NP_439910.1_2 Forward -56 -39 -4.48438 0.0788
NP_440457.1_1 Forward -397 -385 3.77555 0.186
NP_440457.1_1 Reverse -35 -47 1.02229 0.248
NP_442680.1_7 Forward -171 -152 -7.08038 0.279
NP_440801.1_8 Reverse -175 -194 1.86774 0.236
NP_442509.1_9 Forward -185 -175 11.091 0.147
NP_440524.1_2 Forward -392 -373 -2.26216 0.27
NP_440554.1_4 Reverse -40 -50 8.4365 0.0749
NP_440554.1_4 Forward -47 -37 8.33817 0.0773
NP_440554.1_4 Forward -11 -1 1.55333 0.296
NP_442862.1_3 Reverse -154 -171 11.1502 0.202
NP_441885.1_5 Reverse -39 -49 0.668351 0.133
NP_442341.1_7 Reverse -2 -16 6.09611 0.135
NP_440423.1_6 Forward -193 -174 -20.1584 0.252
NP_440423.1_10 Reverse -32 -51 20.1573 0.112
NP_443000.1_7 Reverse -37 -47 10.5998 0.0345
NP_443000.1_7 Forward -50 -40 6.96153 0.109
NP_441842.1_10 Reverse -32 -46 6.6861 0.278
NP_441842.1_10 Forward -19 -5 6.3911 0.291
NP_440275.1_3 Reverse -37 -47 6.56821 0.101
NP_440091.1_1 Forward -52 -40 1.80894 0.197
NP_442451.1_2 Forward -20 -1 -10.817 0.28
NP_440880.1_5 Forward -256 -238 24.0119 0.00745
NP_442495.1_4 Reverse -338 -348 11.8781 0.258
NP_442495.1_5 Reverse -93 -112 7.17762 0.291
NP_441105.1_3 Reverse -66 -85 -5.70374 0.223
NP_440216.1_1 Forward -48 -34 -3.147 0.0729
NP_440216.1_9 Reverse -305 -314 11.6028 0.254
NP_440216.1_9 Forward -78 -69 5.3096 0.298
NP_440172.1_1 Reverse -39 -49 10.1081 0.0551
NP_440172.1_1 Forward -393 -383 4.40493 0.189
NP_441226.1_7 Reverse -244 -251 5.34865 0.289
NP_441111.1_7 Forward -47 -39 8.86921 0.0589
NP_441766.1_2 Reverse -39 -48 8.1612 0.0645
NP_441766.1_2 Reverse -3 -12 4.32629 0.187
NP_442154.1_1 Forward -375 -357 -16.6971 0.244
NP_440261.1_5 Reverse -385 -398 -11.2888 0.255
NP_440988.1_10 Reverse -201 -215 3.9307 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCCCGGGCCGATGGATTTAAGGAAACGGGTTTGGCTCTGCCTGATACCTGTCCCTATGGCATTGATGAAGTGTTGCATCGTGTGGTTTCCCTGGGTGATTAATCATCAATTGTGTCGGTCCGGGGTAACGGTTTGTTACGGGTGTTAAGGGTTGGGAGTTTGTTGAGTAAGCTAATGAATGTCGGTTCTCAATTGGGATTCCTATGTCGGACGTGATGATCCGGGGGTCAAATTTAGGCAAAAAGTACATGATTGGCCACCAAGCAGAAGGACGGTCTAATTATGTGGCGCTGCGAGATGTACTGACAGATGGAGCCAGGTCCCTGGTAAAGCGGTTTACGGTTGATAAAAATCGATCGCCTGCTTGGGGTCTATTCCAGTCCCGACAGAGATCCCCGT

CDS

ATGCACTCCGTCACCATTTCCCTGGTGGTTAAAGCGCAAGGTGATTTGCTCATTGGCGATCGCCAGGAAGTATCCGAGGTCAAAGCTTTTGCGGTGAAAGATTTACCGTTGGGAGCATTAAGTCACGACCACGATCAACAACTACAGGATTTTTTGCAGGGGGAAACAATCACTGCCTGA

Protein

MHSVTISLVVKAQGDLLIGDRQEVSEVKAFAVKDLPLGALSHDHDQQLQDFLQGETITA