Your browser is old and dusty. Try Google Chrome!

Details for ssr2799

ORF ssr2799
Accession NP_441681.1
Symbol rpl27
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L27
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -161 -147 12.0943 0.0481
NP_441061.1_2 Forward -173 -159 9.04604 0.0817
NP_441061.1_2 Reverse -154 -168 8.55439 0.0865
NP_441061.1_2 Reverse -270 -284 -1.96703 0.278
NP_440557.1_1 Reverse -154 -173 0.786102 0.265
NP_440795.1_7 Forward -161 -154 14.6904 0.0123
NP_440795.1_7 Reverse -154 -161 14.6904 0.0123
NP_440795.1_7 Forward -277 -270 10.2655 0.154
NP_440795.1_7 Forward -220 -213 9.77388 0.169
NP_440795.1_7 Reverse -210 -217 9.77388 0.169
NP_442100.1_1 Reverse -21 -40 10.4559 0.2
NP_441418.1_6 Forward -162 -143 -0.590531 0.0102
NP_441418.1_6 Reverse -153 -172 -10.6203 0.0375
NP_441418.1_6 Reverse -269 -288 -19.1751 0.0854
NP_441418.1_6 Reverse -209 -228 -23.895 0.198
NP_441418.1_6 Reverse -194 -213 -30.4831 0.28
NP_441418.1_6 Reverse -141 -160 -30.5815 0.286
NP_440897.1_6 Reverse -153 -172 -1.67294 0.194
NP_441453.1_4 Reverse -153 -161 16.539 0.00633
NP_441453.1_4 Forward -162 -154 16.539 0.00633
NP_441453.1_7 Reverse -119 -126 12.1338 0.295
NP_442151.1_6 Forward -162 -148 7.86607 0.188
NP_440226.1_1 Reverse -153 -172 7.37428 0.107
NP_442623.1_3 Reverse -270 -289 -18.7818 0.263
NP_441098.1_3 Reverse -21 -40 -3.43933 0.28
NP_440150.1_6 Forward -165 -146 3.73603 0.245
NP_442744.1_8 Forward -162 -143 -4.22878 0.297
NP_442655.1_10 Forward -153 -134 -18.2901 0.272
NP_442173.1_1 Forward -161 -153 15.4574 0.00633
NP_442173.1_1 Reverse -154 -162 15.4574 0.00633
NP_442752.1_4 Forward -162 -155 13.8055 0.0199
NP_442752.1_4 Reverse -153 -160 13.8055 0.0199
NP_443027.1_4 Forward -164 -154 14.828 0.0437
NP_443027.1_4 Reverse -151 -161 5.87989 0.294
NP_442975.1_10 Reverse -149 -163 3.34225 0.259
NP_440784.1_7 Forward -161 -154 15.9687 0.0123
NP_440784.1_7 Reverse -154 -161 15.9687 0.0123
NP_441681.1_1 Forward -251 -232 30.4821 0.000238
NP_441681.1_2 Forward -215 -196 32.0554 0.000059
NP_441681.1_3 Forward -271 -252 30.9737 0.0000123
NP_441681.1_4 Forward -332 -313 27.5321 0.00156
NP_441681.1_7 Forward -376 -357 25.8605 0.00192
NP_441681.1_8 Forward -191 -172 20.4523 0.0949
NP_441681.1_9 Forward -231 -217 27.0406 0.00179
NP_441681.1_10 Forward -311 -298 20.5705 0.262
NP_440061.1_9 Reverse -207 -221 6.19383 0.255
NP_440061.1_9 Forward -209 -195 5.1122 0.294
NP_440110.1_8 Reverse -267 -286 -1.7705 0.25
NP_441476.1_5 Reverse -148 -167 14.8474 0.0933
NP_441476.1_5 Forward -167 -148 -0.688862 0.2
NP_439979.1_9 Forward -155 -137 9.65558 0.243
NP_442062.1_3 Forward -41 -22 11.5042 0.152
NP_442062.1_8 Forward -162 -152 19.4496 0.000558
NP_442062.1_8 Reverse -153 -163 19.4496 0.000558
NP_442062.1_8 Forward -150 -140 3.51995 0.267
NP_440761.1_4 Reverse -253 -272 -15.1435 0.278
NP_441859.1_3 Forward -163 -144 2.85027 0.254
NP_440304.1_4 Forward -164 -154 10.8948 0.051
NP_440304.1_4 Forward -349 -339 3.02829 0.299
NP_440304.1_4 Reverse -151 -161 1.84832 0.299
NP_442242.1_4 Forward -161 -154 14.3954 0.0124
NP_442242.1_4 Reverse -154 -161 14.3954 0.0124
NP_440916.1_1 Forward -295 -281 11.2093 0.206
NP_441208.1_1 Forward -220 -201 -5.40875 0.281
NP_441208.1_9 Reverse -150 -164 6.6861 0.234
NP_441594.1_6 Reverse -144 -163 12.7825 0.109
NP_441594.1_6 Forward -159 -140 3.6377 0.226
NP_440370.1_10 Forward -171 -152 7.86593 0.247
NP_440370.1_10 Reverse -144 -163 6.4893 0.291
NP_440132.1_1 Reverse -151 -169 11.1305 0.21
NP_442110.1_7 Forward -162 -148 3.04785 0.218
NP_442110.1_7 Reverse -153 -167 2.2612 0.222
NP_441491.1_6 Forward -126 -112 15.9539 0.205
NP_440330.1_2 Forward -174 -155 11.1109 0.292
NP_441083.1_5 Forward -162 -152 11.3864 0.0159
NP_441083.1_5 Reverse -153 -163 11.3864 0.0159
NP_441434.1_3 Forward -300 -281 13.7658 0.0895
NP_441738.1_2 Forward -160 -153 15.28 0.0102
NP_441738.1_2 Reverse -155 -162 15.28 0.0102
NP_441558.1_5 Forward -164 -145 16.3224 0.0309
NP_440209.1_1 Reverse -153 -161 18.1123 0.00295
NP_440209.1_1 Forward -162 -154 18.1123 0.00295
NP_442889.1_8 Forward -165 -151 4.12889 0.27
NP_440056.1_1 Forward -167 -148 12.5858 0.168
NP_441713.1_1 Reverse -147 -166 -7.4737 0.13
NP_440178.1_7 Reverse -125 -144 -11.0136 0.0862
NP_440178.1_7 Reverse -152 -171 -20.7484 0.199
NP_440659.1_9 Forward -359 -340 13.2741 0.162
NP_441716.1_1 Reverse -153 -167 4.03116 0.259
NP_441327.1_6 Reverse -235 -248 18.0139 0.24
NP_442111.1_4 Forward -163 -149 10.521 0.0535
NP_442111.1_4 Reverse -152 -166 8.75105 0.0694
NP_441163.1_1 Forward -163 -146 13.3128 0.183
NP_440851.1_3 Reverse -23 -42 1.47442 0.285
NP_440906.1_5 Forward -161 -154 15.8704 0.0124
NP_440906.1_5 Reverse -154 -161 15.8704 0.0124
NP_440747.1_10 Reverse -150 -162 15.1819 0.00196
NP_440747.1_10 Forward -165 -153 7.70879 0.00236
NP_440747.1_10 Reverse -206 -218 -4.18925 0.0817
NP_441486.1_1 Forward -165 -151 12.4876 0.0116
NP_441486.1_1 Reverse -150 -164 10.3243 0.0209
NP_441486.1_1 Forward -335 -321 -6.29359 0.288
NP_442634.1_4 Reverse -196 -210 3.53951 0.105
NP_442634.1_4 Reverse -151 -165 -1.67204 0.149
NP_442634.1_4 Reverse -256 -270 -3.04867 0.16
NP_440403.1_10 Reverse -144 -163 2.45773 0.279
NP_441014.1_8 Forward -210 -191 -9.63698 0.299
NP_442848.1_1 Forward -168 -154 -4.03198 0.279
NP_441012.1_4 Forward -285 -272 13.294 0.217
NP_443018.1_3 Forward -161 -154 14.8871 0.0123
NP_443018.1_3 Reverse -154 -161 14.8871 0.0123
NP_441316.1_7 Forward -164 -149 3.71647 0.137
NP_441182.1_4 Reverse -260 -279 17.6982 0.268
NP_440376.1_1 Forward -162 -153 19.4693 0.000692
NP_440376.1_1 Reverse -153 -162 19.4693 0.000692
NP_441588.1_4 Forward -160 -150 7.35486 0.178
NP_443065.1_6 Reverse -149 -168 2.94938 0.221
NP_442687.1_7 Forward -163 -153 15.8113 0.0125
NP_442687.1_7 Reverse -152 -162 15.8113 0.0125
NP_442687.1_7 Forward -219 -209 13.7464 0.0426
NP_442687.1_7 Forward -175 -165 5.68323 0.189
NP_442191.1_4 Reverse -154 -168 13.3201 0.153
NP_442485.1_3 Reverse -267 -286 1.47442 0.227
NP_442485.1_3 Forward -173 -154 -1.7705 0.261
NP_442485.1_3 Reverse -142 -161 -4.03212 0.277
NP_442583.1_8 Reverse -142 -161 25.5655 0.01
NP_442583.1_8 Forward -173 -154 10.2259 0.225
NP_441422.1_7 Forward -164 -147 5.84037 0.0992
NP_441422.1_7 Reverse -151 -168 -2.81276 0.223
NP_440667.1_2 Reverse -209 -228 -7.37537 0.275
NP_440667.1_2 Forward -350 -331 -8.55534 0.29
NP_442296.1_9 Reverse -147 -166 7.7676 0.0981
NP_442296.1_9 Reverse -312 -331 -5.31042 0.282
NP_441763.1_10 Forward -173 -154 13.47 0.121
NP_441763.1_10 Reverse -142 -161 6.39016 0.269
NP_442658.1_1 Reverse -151 -161 15.9091 0.00966
NP_442658.1_1 Forward -164 -154 15.9091 0.00966
NP_442198.1_4 Forward -370 -351 18.7807 0.201
NP_442782.1_2 Reverse -153 -167 13.0776 0.173
NP_442782.1_2 Forward -162 -148 1.86788 0.281
NP_442782.1_2 Reverse -198 -212 1.47456 0.281
NP_442496.1_5 Forward -355 -337 6.41066 0.283
NP_441414.1_9 Reverse -153 -172 5.01433 0.0496
NP_442300.1_5 Reverse -151 -170 14.6508 0.282
NP_442937.1_5 Reverse -148 -167 13.7658 0.0872
NP_441958.1_5 Forward -163 -153 12.2714 0.00183
NP_441958.1_5 Reverse -152 -162 12.2714 0.00183
NP_442486.1_6 Forward -174 -155 2.0644 0.266
NP_442685.1_2 Forward -38 -28 17.0896 0.11
NP_440203.1_5 Reverse -134 -144 10.6976 0.215
NP_442690.1_1 Forward -40 -21 -13.4719 0.262
NP_442911.1_2 Forward -172 -153 16.6174 0.00881
NP_442911.1_2 Reverse -143 -162 -10.9153 0.292
NP_441591.1_10 Reverse -144 -163 6.29264 0.286
NP_442536.1_7 Forward -168 -149 10.3242 0.273
NP_442536.1_8 Reverse -269 -288 11.2092 0.275
NP_443055.1_3 Reverse -165 -184 13.6054 0.163
NP_440138.1_6 Reverse -331 -350 0.981987 0.291
NP_440138.1_7 Reverse -248 -266 15.3762 0.278
NP_442853.1_5 Reverse -210 -229 5.89851 0.287
NP_441129.1_3 Reverse -110 -129 -17.7985 0.29
NP_441099.1_5 Forward -288 -269 5.99764 0.0469
NP_441099.1_5 Reverse -143 -162 -7.86702 0.181
NP_441099.1_5 Forward -172 -153 -10.1286 0.243
NP_442002.1_9 Forward -163 -156 10.7572 0.185
NP_442002.1_9 Reverse -152 -159 10.7572 0.185
NP_441654.1_6 Forward -40 -22 14.8987 0.229
NP_441646.1_1 Reverse -146 -165 6.09597 0.174
NP_442438.1_10 Forward -167 -153 23.009 0.00719
NP_442438.1_10 Reverse -148 -162 12.0943 0.0412
NP_441000.1_6 Reverse -152 -166 4.71948 0.0933
NP_441000.1_6 Forward -163 -149 -3.93365 0.225
NP_442771.1_1 Forward -164 -146 10.0489 0.0256
NP_442771.1_1 Reverse -151 -169 4.24738 0.0672
NP_442870.1_4 Reverse -234 -248 16.9125 0.22
NP_440147.1_4 Reverse -151 -164 11.3273 0.0326
NP_440147.1_4 Forward -164 -151 2.18257 0.209
NP_441550.1_8 Reverse -151 -161 8.3377 0.124
NP_441550.1_8 Forward -164 -154 6.0761 0.214
NP_441550.1_8 Forward -220 -210 4.60114 0.299
NP_441916.1_7 Forward -162 -152 18.4663 0.00144
NP_441916.1_7 Reverse -153 -163 18.4663 0.00144
NP_441916.1_10 Reverse -315 -334 6.68596 0.202
NP_441916.1_10 Forward -170 -151 5.11266 0.216
NP_440206.1_4 Reverse -154 -173 0.195343 0.289
NP_441041.1_4 Reverse -153 -172 23.0089 0.00407
NP_441041.1_4 Forward -162 -143 8.84924 0.0331
NP_441041.1_4 Forward -278 -259 -8.85033 0.208
NP_441041.1_4 Forward -155 -136 -10.522 0.233
NP_441041.1_7 Reverse -150 -162 15.6777 0.0222
NP_441041.1_7 Forward -165 -153 7.61196 0.162
NP_442396.1_5 Forward -166 -153 5.82081 0.265
NP_442004.1_4 Forward -183 -164 11.6017 0.299
NP_442004.1_6 Reverse -153 -167 9.63603 0.14
NP_442004.1_6 Forward -162 -148 7.27608 0.161
NP_441725.1_4 Reverse -148 -162 2.8506 0.279
NP_441725.1_5 Reverse -154 -164 11.2881 0.0247
NP_441725.1_5 Forward -161 -151 2.04498 0.115
NP_439966.1_7 Forward -164 -154 18.4657 0.00473
NP_439966.1_7 Reverse -151 -161 9.91099 0.0968
NP_439966.1_9 Forward -164 -155 0.983037 0.253
NP_439966.1_9 Reverse -151 -160 0.884706 0.253
NP_442941.1_3 Reverse -154 -164 11.4848 0.0116
NP_442941.1_3 Forward -161 -151 2.63497 0.14
NP_440289.1_2 Forward -165 -152 5.13249 0.0636
NP_440289.1_2 Reverse -150 -163 -3.61896 0.267
NP_441076.1_1 Forward -45 -26 10.9704 0.229
NP_440260.1_8 Reverse -144 -162 9.95058 0.151
NP_440260.1_8 Reverse -227 -245 0.805796 0.195
NP_441514.1_1 Reverse -84 -94 13.7721 0.284
NP_442281.1_1 Reverse -148 -162 19.1735 0.0032
NP_442281.1_1 Forward -167 -153 10.5204 0.0576
NP_441334.1_7 Reverse -139 -158 -20.8467 0.281
NP_442012.1_1 Forward -168 -149 7.66927 0.108
NP_442049.1_4 Forward -149 -130 -7.37537 0.298
NP_440723.1_4 Reverse -320 -339 16.5191 0.0245
NP_441556.1_4 Reverse -186 -205 14.0542 0.176
NP_441556.1_4 Forward -171 -152 10.2943 0.284
NP_441556.1_10 Reverse -148 -162 13.2393 0.182
NP_440498.1_1 Forward -171 -153 16.2438 0.0224
NP_440498.1_1 Reverse -144 -162 6.70565 0.0845
NP_443030.1_4 Forward -174 -155 3.24438 0.205
NP_441644.1_6 Forward -162 -152 10.1076 0.0628
NP_441644.1_6 Reverse -153 -163 10.1076 0.0628
NP_441644.1_6 Reverse -209 -219 8.14104 0.106
NP_441071.1_2 Reverse -28 -47 15.517 0.279
NP_442215.1_2 Forward -220 -204 7.2367 0.0694
NP_442215.1_2 Reverse -151 -167 3.79511 0.0918
NP_442215.1_2 Forward -164 -148 -0.531451 0.168
NP_442215.1_2 Reverse -321 -337 -6.92296 0.281
NP_442029.1_6 Reverse -126 -145 7.66927 0.223
NP_442029.1_6 Reverse -148 -167 3.04771 0.286
NP_440253.1_2 Reverse -330 -348 -0.177514 0.204
NP_440929.1_8 Forward -162 -153 19.2726 0.000701
NP_440929.1_8 Reverse -153 -162 19.2726 0.000701
NP_442933.1_10 Forward -162 -153 17.601 0.00325
NP_442933.1_10 Reverse -153 -162 17.601 0.00325
NP_441751.2_8 Reverse -154 -168 7.86607 0.0336
NP_441751.2_8 Forward -161 -147 -0.590395 0.129
NP_442926.1_5 Reverse -148 -167 15.5124 0.149
NP_442554.1_8 Reverse -154 -164 13.8447 0.0145
NP_442554.1_8 Forward -161 -151 13.2547 0.0187
NP_441762.1_7 Forward -163 -151 19.3118 0.00342
NP_441762.1_7 Reverse -152 -164 12.0354 0.0142
NP_442142.1_4 Forward -165 -152 19.6848 0.0179
NP_442142.1_4 Reverse -150 -163 16.4399 0.0264
NP_442292.1_1 Forward -161 -152 9.63616 0.0183
NP_442292.1_1 Reverse -154 -163 9.63616 0.0183
NP_442476.1_5 Reverse -174 -193 11.7992 0.256
NP_442476.1_6 Reverse -154 -168 1.27789 0.223
NP_440895.1_6 Reverse -147 -160 9.36073 0.224
NP_442381.1_8 Forward -165 -146 -14.6519 0.284
NP_442381.1_8 Reverse -150 -169 -14.9469 0.29
NP_443009.1_5 Reverse -152 -163 11.6612 0.0602
NP_443009.1_5 Forward -163 -152 11.6612 0.0602
NP_442301.1_8 Forward -168 -149 12.5858 0.205
NP_442092.1_5 Forward -220 -201 19.3707 0.127
NP_441715.1_4 Reverse -154 -164 16.303 0.0117
NP_441715.1_4 Forward -161 -151 9.41981 0.097
NP_440357.1_3 Forward -176 -157 -0.590531 0.296
NP_441448.1_2 Forward -160 -141 -0.787962 0.266
NP_440379.1_5 Reverse -194 -213 -7.86702 0.25
NP_440379.1_5 Reverse -144 -163 -11.3086 0.294
NP_441468.1_1 Forward -161 -154 15.8704 0.0124
NP_441468.1_1 Reverse -154 -161 15.8704 0.0124
NP_441468.1_1 Reverse -324 -331 6.72562 0.126
NP_442099.1_1 Forward -311 -293 14.5721 0.274
NP_441020.2_6 Reverse -151 -168 20.3934 0.00602
NP_441020.2_6 Forward -164 -147 12.1336 0.101
NP_441015.1_10 Reverse -148 -167 -6.58872 0.252
NP_441673.1_1 Forward -162 -153 20.8459 0.000698
NP_441673.1_1 Reverse -153 -162 20.8459 0.000698
NP_441673.1_1 Reverse -209 -218 -8.06341 0.254
NP_441826.1_2 Reverse -147 -161 4.91614 0.0979
NP_441826.1_2 Forward -168 -154 2.45787 0.127
NP_441826.1_2 Forward -224 -210 -1.37704 0.245
NP_441826.1_2 Forward -338 -324 -4.62196 0.298
NP_441330.1_1 Forward -167 -148 -4.32711 0.0952
NP_442490.1_9 Reverse -141 -160 -4.13045 0.258
NP_442490.1_9 Forward -162 -143 -5.50708 0.273
NP_442490.1_9 Forward -174 -155 -6.78538 0.275
NP_442868.1_6 Forward -164 -154 0.963343 0.205
NP_442868.1_6 Reverse -151 -161 0.865012 0.205
NP_442719.1_2 Reverse -280 -298 -10.7979 0.283
NP_440051.1_5 Reverse -24 -38 14.5459 0.285
NP_442019.1_4 Forward -105 -86 19.174 0.262
NP_442227.1_2 Forward -181 -162 1.17943 0.25
NP_442361.1_3 Forward -168 -155 8.27909 0.285
NP_442808.1_1 Forward -163 -153 18.4657 0.00201
NP_442808.1_1 Reverse -152 -162 18.4657 0.00201
NP_440145.1_3 Reverse -143 -162 -5.80207 0.279
NP_441906.1_2 Forward -136 -117 0.0970122 0.3
NP_442820.1_4 Forward -99 -82 11.2486 0.265
NP_442542.1_6 Forward -211 -193 18.6037 0.261
NP_442050.1_5 Forward -164 -154 9.12434 0.193
NP_441114.1_3 Forward -337 -328 7.66954 0.231
NP_440558.1_2 Forward -171 -152 -1.37718 0.214
NP_440558.1_2 Reverse -320 -339 -2.16383 0.223
NP_440558.1_2 Reverse -260 -279 -2.65548 0.229
NP_440558.1_2 Reverse -155 -174 -2.75381 0.229
NP_440558.1_2 Forward -159 -140 -4.6221 0.247
NP_440558.1_2 Forward -342 -323 -5.99873 0.269
NP_441878.1_6 Forward -163 -153 10.4031 0.0176
NP_441878.1_6 Reverse -152 -162 10.4031 0.0176
NP_441878.1_6 Forward -219 -209 -0.118297 0.167
NP_441878.1_6 Reverse -208 -218 -7.19813 0.21
NP_441878.1_6 Reverse -146 -156 -7.98478 0.285
NP_441036.1_8 Forward -163 -153 17.7779 0.000554
NP_441036.1_8 Reverse -152 -162 17.7779 0.000554
NP_442650.1_2 Forward -278 -264 12.1926 0.13
NP_442650.1_2 Forward -162 -148 8.55439 0.13
NP_441534.1_5 Reverse -22 -41 2.3594 0.293
NP_441557.1_5 Forward -162 -153 19.9609 0.000699
NP_441557.1_5 Reverse -153 -162 19.9609 0.000699
NP_441445.1_1 Forward -171 -152 7.7676 0.126
NP_441445.1_1 Forward -227 -208 0.491109 0.275
NP_441445.1_1 Reverse -203 -222 -0.0988766 0.286
NP_442419.1_2 Reverse -148 -167 13.0775 0.122
NP_442419.1_2 Forward -167 -148 -5.11376 0.295
NP_441308.1_8 Forward -164 -154 10.1081 0.22
NP_440101.1_3 Forward -167 -148 15.0441 0.0614
NP_440101.1_3 Reverse -148 -167 4.52268 0.214
NP_440101.1_10 Reverse -147 -166 6.29264 0.197
NP_442183.1_1 Reverse -153 -167 9.34103 0.0986
NP_442183.1_1 Forward -162 -148 8.06273 0.124
NP_442166.1_7 Reverse -154 -168 7.27608 0.3
NP_442397.1_1 Reverse -179 -193 15.3659 0.257
NP_442397.1_9 Forward -345 -326 9.83255 0.246
NP_440440.1_2 Forward -185 -166 15.7316 0.237
NP_441574.1_1 Forward -162 -143 -2.65548 0.228
NP_441574.1_1 Reverse -174 -193 -7.08038 0.283
NP_442444.1_6 Forward -170 -152 13.0173 0.262
NP_440414.1_8 Reverse -226 -245 15.0441 0.152
NP_441467.1_10 Forward -123 -109 5.30946 0.281
NP_442347.1_2 Forward -161 -152 11.1111 0.056
NP_442347.1_2 Reverse -154 -163 11.1111 0.056
NP_442645.1_2 Forward -170 -151 4.81767 0.022
NP_442645.1_2 Reverse -321 -340 1.86774 0.0421
NP_442645.1_2 Reverse -145 -164 -15.3402 0.197
NP_442965.1_2 Forward -167 -148 -8.85033 0.294
NP_441037.1_4 Reverse -151 -161 14.7245 0.028
NP_441037.1_4 Forward -164 -154 7.02532 0.237
NP_442594.1_8 Forward -89 -70 2.0644 0.295
NP_441633.1_3 Reverse -151 -164 10.7374 0.0286
NP_441633.1_3 Forward -164 -151 3.65753 0.0699
NP_441633.1_3 Reverse -207 -220 -1.06236 0.152
NP_442764.1_8 Forward -199 -180 2.26107 0.287
NP_440136.1_2 Forward -161 -154 15.9687 0.0123
NP_440136.1_2 Reverse -154 -161 15.9687 0.0123
NP_440136.1_2 Forward -277 -270 4.26735 0.218
NP_442590.1_10 Forward -162 -143 17.0107 0.113
NP_442998.1_10 Forward -160 -153 15.5754 0.0102
NP_442998.1_10 Reverse -155 -162 15.5754 0.0102
NP_440731.1_2 Forward -174 -155 8.84924 0.275
NP_440299.1_1 Reverse -149 -162 20.1765 0.00128
NP_440299.1_1 Forward -166 -153 16.4399 0.0101
NP_441799.1_1 Forward -166 -152 14.4536 0.0236
NP_441799.1_1 Reverse -149 -163 10.1271 0.0797
NP_441799.1_9 Forward -222 -203 -0.0988766 0.213
NP_441435.1_4 Reverse -143 -162 14.0608 0.225
NP_440256.1_1 Reverse -150 -169 -0.885524 0.0979
NP_441090.1_6 Forward -366 -352 8.45605 0.262
NP_440709.1_1 Reverse -22 -41 2.26028 0.22
NP_441512.1_4 Forward -166 -147 18.0924 0.0684
NP_441559.1_8 Reverse -148 -162 2.45787 0.143
NP_441559.1_8 Forward -167 -153 0.294584 0.169
NP_440915.1_6 Reverse -149 -163 5.60446 0.088
NP_440915.1_6 Forward -166 -152 2.94952 0.11
NP_441296.1_7 Forward -332 -313 15.6341 0.267
NP_442785.1_8 Reverse -166 -184 18.0137 0.269
NP_440748.1_5 Forward -336 -317 8.16093 0.166
NP_440748.1_5 Forward -171 -152 2.94938 0.213
NP_441464.1_10 Reverse -200 -214 7.47274 0.296
NP_440306.1_8 Reverse -25 -44 -2.95123 0.275
NP_440695.1_5 Reverse -153 -172 8.35759 0.15
NP_440695.1_5 Forward -162 -143 -1.57384 0.285
NP_441939.1_3 Reverse -154 -173 12.3892 0.102
NP_441199.1_6 Reverse -149 -168 5.11266 0.155
NP_441199.1_6 Forward -166 -147 0.491109 0.242
NP_442993.1_1 Forward -162 -146 1.14018 0.0569
NP_442993.1_1 Reverse -153 -169 -9.08625 0.179
NP_442993.1_1 Reverse -174 -190 -13.0195 0.283
NP_442386.1_9 Reverse -152 -161 15.7322 0.0144
NP_442386.1_9 Forward -163 -154 15.7322 0.0144
NP_442386.1_9 Forward -279 -270 4.81753 0.282
NP_440570.1_5 Reverse -313 -332 3.04771 0.234
NP_440570.1_5 Forward -154 -135 -2.95047 0.283
NP_441340.1_5 Forward -161 -154 15.6737 0.0124
NP_441340.1_5 Reverse -154 -161 15.6737 0.0124
NP_441947.1_10 Forward -164 -146 2.87075 0.276
NP_442240.1_2 Reverse -199 -218 -12.4886 0.163
NP_442240.1_2 Reverse -115 -134 -20.7484 0.295
NP_440586.1_1 Reverse -193 -212 -6.09707 0.296
NP_440586.1_8 Forward -161 -154 13.2151 0.026
NP_440586.1_8 Reverse -154 -161 13.2151 0.026
NP_442251.1_6 Forward -161 -154 15.2804 0.0124
NP_442251.1_6 Reverse -154 -161 15.2804 0.0124
NP_440684.1_9 Reverse -147 -161 15.4376 0.0981
NP_441262.1_3 Reverse -153 -160 14.7888 0.0223
NP_441262.1_3 Forward -162 -155 14.7888 0.0223
NP_443051.1_1 Reverse -152 -161 10.4228 0.00754
NP_443051.1_1 Forward -163 -154 10.4228 0.00754
NP_439937.1_8 Forward -164 -145 -1.47551 0.249
NP_440408.1_7 Forward -168 -149 11.9958 0.212
NP_440439.1_1 Forward -165 -152 15.5556 0.0137
NP_440439.1_1 Reverse -150 -163 8.57408 0.0518
NP_440372.1_2 Forward -161 -154 16.3621 0.0124
NP_440372.1_2 Reverse -154 -161 16.3621 0.0124
NP_441789.1_7 Forward -213 -194 -2.16459 0.257
NP_441803.1_2 Forward -167 -148 11.5042 0.0716
NP_441803.1_2 Reverse -148 -167 -1.08219 0.294
NP_439977.1_5 Forward -168 -149 -2.16383 0.272
NP_442368.1_3 Reverse -313 -331 3.06741 0.3
NP_440139.1_1 Forward -168 -149 14.9449 0.0474
NP_441572.1_7 Reverse -147 -166 7.27595 0.0771
NP_441572.1_7 Forward -168 -149 -4.03212 0.224
NP_441572.1_7 Forward -213 -194 -4.52377 0.238
NP_440267.1_2 Forward -212 -198 10.717 0.134
NP_440267.1_2 Forward -272 -258 6.48882 0.228
NP_442384.1_10 Forward -162 -149 15.7522 0.00946
NP_442384.1_10 Reverse -153 -166 14.7689 0.0132
NP_442085.1_3 Forward -254 -235 12.3658 0.224
NP_441018.1_7 Reverse -149 -168 10.5209 0.202
NP_442790.1_4 Reverse -144 -163 -13.6686 0.266
NP_442790.1_4 Reverse -203 -222 -15.4385 0.294
NP_442262.1_10 Forward -161 -154 14.1988 0.0123
NP_442262.1_10 Reverse -154 -161 14.1988 0.0123
NP_442262.1_10 Reverse -175 -182 8.20058 0.25
NP_441689.1_5 Forward -164 -154 8.53436 0.132
NP_440163.1_10 Forward -165 -155 16.303 0.0762
NP_440344.1_10 Reverse -146 -163 0.333834 0.0363
NP_440344.1_10 Forward -169 -152 -0.452814 0.0426
NP_440189.1_10 Reverse -300 -319 9.14423 0.241
NP_441965.1_7 Forward -347 -328 15.3382 0.239
NP_441965.1_10 Forward -165 -149 4.58176 0.237
NP_440297.1_9 Reverse -154 -164 9.32148 0.0917
NP_440297.1_9 Forward -155 -145 6.46988 0.185
NP_440297.1_9 Forward -161 -151 -0.118297 0.282
NP_440350.1_5 Reverse -223 -242 -0.197208 0.176
NP_442280.1_10 Forward -342 -324 11.8829 0.203
NP_440298.1_2 Reverse -380 -399 3.34271 0.295
NP_440999.1_9 Reverse -149 -163 4.03116 0.119
NP_440999.1_9 Forward -222 -208 2.75286 0.144
NP_440999.1_9 Reverse -208 -222 -1.67204 0.246
NP_440888.1_2 Reverse -153 -167 15.0436 0.013
NP_440888.1_2 Forward -162 -148 8.06211 0.172
NP_440179.1_6 Forward -161 -142 10.1275 0.188
NP_440491.1_1 Forward -165 -146 9.4509 0.214
NP_440052.1_5 Reverse -292 -311 -3.83545 0.246
NP_439969.1_3 Forward -178 -159 2.75272 0.24
NP_442948.1_4 Reverse -320 -334 24.779 0.0105
NP_441759.1_2 Forward -211 -192 3.73603 0.166
NP_441543.1_2 Forward -161 -152 18.486 0.00236
NP_441543.1_2 Reverse -154 -163 18.486 0.00236
NP_442845.1_2 Reverse -147 -161 7.76774 0.195
NP_442845.1_2 Reverse -153 -167 4.52282 0.258
NP_442845.1_5 Reverse -199 -218 22.7139 0.0684
NP_441304.1_10 Forward -300 -291 14.7494 0.164
NP_441918.1_7 Reverse -208 -227 6.98095 0.262
NP_441918.1_7 Reverse -329 -348 -2.75381 0.297
NP_439904.1_7 Reverse -261 -280 15.9291 0.139
NP_441469.1_8 Reverse -152 -161 16.126 0.00797
NP_441469.1_8 Forward -163 -154 16.126 0.00797
NP_442315.1_1 Reverse -163 -181 20.177 0.0484
NP_442337.1_8 Reverse -236 -255 -1.27885 0.28
NP_441306.1_10 Forward -125 -111 11.2087 0.267
NP_442578.1_7 Forward -161 -154 14.5921 0.026
NP_442578.1_7 Reverse -154 -161 14.5921 0.026
NP_441462.1_2 Forward -162 -152 11.5831 0.00406
NP_441462.1_2 Reverse -153 -163 11.5831 0.00406
NP_441621.1_7 Forward -164 -150 6.19444 0.068
NP_441621.1_7 Reverse -151 -165 5.99778 0.068
NP_443062.1_1 Reverse -153 -171 15.2739 0.0395
NP_443062.1_1 Forward -162 -144 5.5232 0.227
NP_443062.1_6 Forward -131 -112 3.04771 0.245
NP_443062.1_6 Forward -170 -151 2.55606 0.253
NP_442204.1_1 Reverse -149 -160 8.7118 0.0852
NP_442204.1_1 Forward -166 -155 -0.0396598 0.285
NP_442204.1_5 Reverse -143 -162 -0.295539 0.283
NP_441351.1_8 Forward -164 -145 6.09597 0.202
NP_440516.1_2 Reverse -147 -165 -2.3408 0.299
NP_440516.1_8 Forward -162 -153 16.9127 0.00442
NP_440516.1_8 Reverse -153 -162 16.9127 0.00442
NP_442428.1_4 Reverse -152 -171 13.4708 0.128
NP_442428.1_4 Forward -163 -144 4.03102 0.238
NP_442428.1_5 Forward -161 -154 15.8704 0.0124
NP_442428.1_5 Reverse -154 -161 15.8704 0.0124
NP_441267.1_2 Forward -345 -326 8.25926 0.199
NP_440455.1_2 Reverse -32 -45 16.328 0.225
NP_442612.1_1 Forward -258 -243 17.4828 0.214
NP_440673.1_2 Reverse -328 -347 12.6333 0.142
NP_440673.1_3 Forward -160 -153 12.4288 0.0426
NP_440673.1_3 Reverse -155 -162 12.4288 0.0426
NP_440865.1_9 Forward -168 -149 -8.55534 0.264
NP_441052.1_2 Forward -162 -152 10.5014 0.0285
NP_441052.1_2 Reverse -153 -163 10.5014 0.0285
NP_441052.1_2 Forward -218 -208 5.09324 0.132
NP_442219.1_9 Forward -161 -152 8.35786 0.0681
NP_442219.1_9 Reverse -154 -163 8.35786 0.0681
NP_442219.1_9 Reverse -270 -279 5.89959 0.0993
NP_440436.1_4 Forward -161 -152 18.1905 0.00233
NP_440436.1_4 Reverse -154 -163 18.1905 0.00233
NP_442086.1_6 Forward -162 -143 7.47261 0.276
NP_442412.1_3 Reverse -37 -56 10.3242 0.279
NP_440648.1_1 Reverse -153 -172 3.73603 0.238
NP_442907.1_9 Forward -167 -148 -5.9004 0.284
NP_441086.1_3 Reverse -17 -36 13.9214 0.114
NP_441719.1_4 Forward -161 -154 16.3621 0.0124
NP_441719.1_4 Reverse -154 -161 16.3621 0.0124
NP_441733.1_10 Forward -165 -152 7.78743 0.15
NP_441733.1_10 Reverse -150 -163 7.6891 0.152
NP_441004.1_1 Reverse -147 -166 -12.3902 0.247
NP_442366.1_3 Forward -163 -145 16.2438 0.0198
NP_442366.1_3 Reverse -152 -170 5.03403 0.0899
NP_442366.1_5 Reverse -150 -160 11.9759 0.148
NP_442873.1_3 Forward -172 -153 9.7334 0.182
NP_442873.1_3 Forward -340 -321 6.09517 0.24
NP_441115.1_4 Forward -163 -145 8.76983 0.237
NP_440328.1_4 Reverse -203 -222 -1.18052 0.299
NP_443054.1_2 Forward -164 -150 11.3077 0.0761
NP_442430.1_10 Reverse -143 -162 10.4217 0.262
NP_441966.1_7 Reverse -137 -156 -2.06626 0.297
NP_441851.1_10 Forward -163 -153 16.008 0.00552
NP_441851.1_10 Reverse -152 -162 16.008 0.00552
NP_442011.1_1 Forward -163 -144 -0.295539 0.268
NP_442856.1_7 Reverse -144 -163 1.0811 0.179
NP_442856.1_7 Reverse -159 -178 -5.21209 0.275
NP_441668.1_4 Reverse -199 -218 6.29264 0.163
NP_442515.1_1 Reverse -208 -222 -4.13031 0.298
NP_440593.1_3 Reverse -298 -317 3.83436 0.149
NP_440593.1_3 Forward -337 -318 -5.80207 0.266
NP_440593.1_9 Reverse -206 -220 7.66941 0.281
NP_441046.1_2 Forward -167 -148 3.44104 0.233
NP_440940.1_7 Forward -172 -154 23.4211 0.00697
NP_441661.1_3 Reverse -171 -188 3.97208 0.203
NP_441409.1_8 Forward -242 -223 7.30571 0.289
NP_441409.1_8 Forward -241 -222 7.30571 0.289
NP_439960.1_6 Forward -287 -268 12.3892 0.186
NP_440474.1_8 Reverse -154 -168 8.55376 0.186
NP_440726.1_2 Reverse -143 -162 -0.000545616 0.288
NP_442450.1_5 Forward -164 -154 9.32148 0.115
NP_442450.1_5 Reverse -151 -161 7.55152 0.13
NP_442168.1_5 Forward -277 -258 6.98095 0.186
NP_440588.1_2 Reverse -144 -163 9.24257 0.0446
NP_440588.1_2 Forward -171 -152 0.294447 0.148
NP_442006.1_2 Reverse -165 -182 -16.4808 0.254
NP_442006.1_2 Reverse -329 -346 -18.939 0.296
NP_442038.1_1 Forward -92 -73 -1.37718 0.299
NP_441570.1_1 Reverse -153 -171 0.805796 0.0361
NP_441570.1_1 Reverse -212 -230 -0.7675 0.0506
NP_440078.1_10 Forward -162 -143 16.5191 0.121
NP_440078.1_10 Reverse -153 -172 5.89931 0.224
NP_441078.1_4 Forward -162 -153 19.6659 0.0007
NP_441078.1_4 Reverse -153 -162 19.6659 0.0007
NP_441078.1_4 Reverse -209 -218 -1.57357 0.266
NP_442388.1_3 Forward -224 -205 6.98095 0.282
NP_441432.1_8 Reverse -152 -161 8.25953 0.0755
NP_441432.1_8 Forward -163 -154 8.25953 0.0755
NP_442320.1_8 Reverse -147 -161 -0.983719 0.0817
NP_442320.1_8 Forward -168 -154 -1.8687 0.0845
NP_442344.1_7 Forward -161 -142 11.0125 0.0298
NP_442344.1_7 Reverse -154 -173 -7.37537 0.182
NP_442344.1_7 Reverse -52 -71 -9.63698 0.262
NP_441732.1_2 Reverse -149 -165 -7.51295 0.0859
NP_441732.1_2 Forward -166 -150 -17.1494 0.24
NP_440760.1_1 Forward -162 -143 -20.8467 0.225
NP_442797.1_7 Forward -163 -145 8.7706 0.186
NP_440131.1_4 Reverse -271 -290 6.4893 0.243
NP_440199.1_10 Reverse -171 -181 9.81313 0.19
NP_442353.1_4 Forward -179 -160 -1.08295 0.298
NP_442727.1_1 Reverse -217 -231 16.1259 0.195
NP_441072.1_2 Forward -166 -147 6.98095 0.261
NP_440713.1_4 Reverse -155 -174 11.1109 0.119
NP_440713.1_4 Forward -172 -153 5.11266 0.215
NP_442489.1_7 Forward -162 -153 20.1576 0.000695
NP_442489.1_7 Reverse -153 -162 20.1576 0.000695
NP_442489.1_7 Reverse -209 -218 -1.27858 0.185
NP_440757.1_7 Reverse -136 -154 -3.42244 0.288
NP_442079.1_7 Reverse -154 -173 3.04771 0.214
NP_442079.1_7 Reverse -142 -161 -0.000545616 0.287
NP_440559.1_1 Reverse -154 -163 8.75118 0.0586
NP_440559.1_1 Forward -161 -152 8.75118 0.0586
NP_441659.2_8 Forward -162 -152 11.9764 0.0147
NP_441659.2_8 Reverse -153 -163 11.9764 0.0147
NP_441659.2_8 Forward -267 -257 3.42162 0.161
NP_441659.2_8 Forward -218 -208 3.32329 0.164
NP_441022.1_1 Forward -39 -30 11.0666 0.284
NP_442913.1_9 Reverse -147 -166 6.78429 0.294
NP_440442.1_3 Forward -169 -155 14.6509 0.287
NP_441800.1_3 Forward -155 -137 9.55725 0.286
NP_441800.1_3 Reverse -318 -336 3.85406 0.289
NP_441800.1_3 Reverse -148 -166 3.65739 0.292
NP_442346.1_1 Reverse -312 -331 10.5209 0.27
NP_442346.1_5 Forward -163 -153 9.02648 0.118
NP_442346.1_5 Reverse -152 -162 9.02648 0.118
NP_442346.1_5 Forward -219 -209 8.53483 0.133
NP_442346.1_5 Forward -268 -258 7.15819 0.178
NP_440545.1_3 Reverse -149 -166 10.5603 0.0314
NP_440545.1_3 Forward -154 -137 1.21881 0.123
NP_440545.1_3 Forward -166 -149 0.137172 0.144
NP_440545.1_3 Forward -222 -205 -6.84433 0.289
NP_441856.1_3 Reverse -195 -214 -1.47551 0.239
NP_440831.1_3 Reverse -144 -163 9.68776 0.188
NP_440250.1_4 Reverse -217 -236 3.53858 0.267
NP_440459.1_2 Reverse -138 -155 9.18362 0.233
NP_441653.1_2 Reverse -142 -161 5.36566 0.248
NP_440010.1_4 Forward -166 -147 0.686995 0.244
NP_441585.1_5 Forward -103 -84 -1.37794 0.298
NP_441585.1_6 Forward -204 -185 18.9765 0.147
NP_441888.1_7 Reverse -148 -162 3.8345 0.225
NP_441888.1_7 Forward -128 -114 1.37622 0.253
NP_441948.1_4 Forward -169 -151 -0.275845 0.139
NP_441047.1_2 Reverse -270 -289 -3.44213 0.297
NP_441833.1_4 Forward -161 -154 15.9687 0.0124
NP_441833.1_4 Reverse -154 -161 15.9687 0.0124
NP_442162.1_9 Forward -161 -154 16.2637 0.0124
NP_442162.1_9 Reverse -154 -161 16.2637 0.0124
NP_440671.1_4 Reverse -147 -161 13.6676 0.0766
NP_440671.1_4 Forward -168 -154 11.701 0.127
NP_440204.1_4 Reverse -225 -244 8.55425 0.155
NP_442199.1_5 Forward -170 -151 8.65258 0.0695
NP_442140.1_3 Forward -161 -151 16.2046 0.0255
NP_442140.1_3 Reverse -154 -164 8.33817 0.119
NP_442021.1_3 Reverse -147 -166 -6.88371 0.261
NP_440875.1_2 Reverse -154 -173 5.40766 0.298
NP_440875.1_9 Reverse -143 -153 16.0616 0.0212
NP_440875.1_9 Forward -153 -143 12.2655 0.127
NP_440875.1_9 Forward -160 -150 9.15072 0.233
NP_440875.1_9 Reverse -155 -165 9.05339 0.233
NP_441813.1_5 Forward -164 -154 17.188 0.00979
NP_441813.1_5 Reverse -151 -161 9.91146 0.021
NP_440590.1_4 Forward -161 -148 11.6223 0.019
NP_440590.1_4 Reverse -42 -55 -0.0790467 0.176
NP_440590.1_4 Reverse -324 -337 -1.35735 0.218
NP_440590.1_4 Reverse -154 -167 -4.9956 0.272
NP_440590.1_4 Reverse -203 -216 -5.88057 0.293
NP_440567.1_1 Reverse -154 -168 18.3875 0.0148
NP_440567.1_1 Forward -161 -147 14.3559 0.0187
NP_442497.1_1 Forward -240 -221 8.06178 0.275
NP_442497.1_10 Forward -161 -152 10.4228 0.0087
NP_442497.1_10 Reverse -154 -163 10.4228 0.0087
NP_440821.1_4 Forward -164 -154 19.0562 0.00399
NP_440821.1_4 Reverse -151 -161 10.2065 0.0163
NP_440821.1_4 Forward -280 -270 3.02829 0.131
NP_441239.1_9 Forward -164 -152 15.8703 0.0178
NP_441239.1_9 Reverse -151 -163 14.887 0.0247
NP_441239.1_9 Reverse -144 -156 3.48056 0.285
NP_441239.1_9 Forward -152 -140 3.18557 0.292
NP_441009.1_4 Reverse -153 -172 11.6025 0.254
NP_441009.1_4 Forward -173 -154 10.5209 0.265
NP_441892.1_1 Reverse -144 -161 -1.14113 0.198
NP_441892.1_1 Forward -159 -142 -1.33779 0.203
NP_440665.1_1 Forward -332 -313 -13.6686 0.257
NP_440665.1_1 Forward -204 -185 -14.0619 0.261
NP_440604.1_6 Reverse -153 -172 5.99764 0.109
NP_440604.1_6 Reverse -198 -217 4.62101 0.124
NP_442270.1_9 Reverse -142 -161 -10.227 0.253
NP_440945.1_8 Forward -161 -142 19.0757 0.197
NP_442643.1_1 Forward -168 -149 -1.37718 0.143
NP_440354.1_7 Forward -290 -272 8.47561 0.242
NP_442138.1_10 Forward -162 -143 -4.42544 0.255
NP_440546.1_4 Forward -162 -152 11.8882 0.0679
NP_440546.1_4 Reverse -153 -163 11.8882 0.0679
NP_440546.1_4 Forward -386 -376 9.07643 0.156
NP_441656.1_3 Reverse -230 -249 8.75091 0.293
NP_440462.1_6 Forward -164 -154 15.418 0.0142
NP_440462.1_6 Reverse -151 -161 9.02648 0.0498
NP_442611.1_1 Reverse -153 -172 3.04771 0.213
NP_440868.1_4 Forward -166 -154 15.7719 0.0164
NP_440868.1_4 Reverse -149 -161 8.6921 0.0582
NP_442479.1_9 Forward -95 -76 -7.76869 0.266
NP_441868.1_4 Forward -334 -320 11.406 0.296
NP_441848.1_4 Forward -47 -31 14.9035 0.156
NP_440653.1_10 Forward -161 -142 5.99764 0.218
NP_440696.1_6 Reverse -198 -217 3.34271 0.288
NP_442039.1_4 Forward -161 -154 15.1821 0.0124
NP_442039.1_4 Reverse -154 -161 15.1821 0.0124
NP_441811.1_4 Forward -164 -145 5.60432 0.203
NP_442409.1_5 Reverse -140 -159 16.7157 0.216
NP_440825.1_6 Reverse -85 -104 10.9142 0.282
NP_440825.1_7 Forward -161 -151 12.4217 0.155
NP_442837.1_3 Forward -161 -154 15.7721 0.0124
NP_442837.1_3 Reverse -154 -161 15.7721 0.0124
NP_442053.1_1 Forward -162 -153 18.3876 0.0007
NP_442053.1_1 Reverse -153 -162 18.3876 0.0007
NP_440505.1_3 Forward -164 -154 13.8447 0.0247
NP_440505.1_3 Reverse -151 -161 6.76487 0.169
NP_441102.1_2 Forward -305 -286 7.86593 0.298
NP_441408.2_7 Forward -143 -124 1.17943 0.215
NP_440914.1_1 Forward -162 -152 8.6151 0.186
NP_440914.1_1 Reverse -153 -163 8.6151 0.186
NP_441011.1_8 Forward -161 -152 16.9127 0.00602
NP_441011.1_8 Reverse -154 -163 16.9127 0.00602
NP_442533.1_6 Forward -162 -153 17.2076 0.00137
NP_442533.1_6 Reverse -153 -162 17.2076 0.00137
NP_442533.1_6 Forward -332 -323 12.0944 0.0325
NP_442533.1_6 Reverse -209 -218 11.0128 0.0486
NP_442533.1_6 Forward -155 -146 9.93116 0.0587
NP_442533.1_6 Reverse -258 -267 2.06468 0.275
NP_442322.1_4 Forward -215 -198 -9.00826 0.286
NP_442229.1_1 Forward -164 -150 11.1104 0.18
NP_442229.1_1 Reverse -151 -165 9.83206 0.184
NP_441482.1_7 Reverse -147 -161 0.982901 0.0554
NP_441482.1_7 Forward -168 -154 0.294584 0.0586
NP_442293.1_4 Reverse -274 -292 14.1788 0.226
NP_439944.1_9 Reverse -154 -164 10.3048 0.0887
NP_441697.1_5 Reverse -21 -40 -3.58137 0.217
NP_441697.1_5 Forward -39 -20 -10.0748 0.278
NP_440116.1_5 Reverse -150 -167 4.46374 0.196
NP_440116.1_8 Reverse -259 -278 -4.52377 0.174
NP_440116.1_8 Forward -161 -142 -10.1286 0.299
NP_441527.1_4 Forward -253 -234 -11.2207 0.278
NP_439965.1_1 Forward -171 -152 -1.86883 0.174
NP_441972.1_5 Reverse -142 -161 -0.787193 0.169
NP_441972.1_5 Forward -134 -115 -7.4737 0.249
NP_441972.1_5 Reverse -324 -343 -8.752 0.272
NP_441106.1_1 Reverse -152 -161 18.191 0.0028
NP_441106.1_1 Forward -163 -154 18.191 0.0028
NP_441106.1_1 Reverse -257 -266 2.26134 0.293
NP_440429.1_2 Forward -161 -142 9.43923 0.272
NP_440480.1_8 Forward -171 -158 15.3589 0.29
NP_439903.1_6 Forward -165 -146 6.78348 0.167
NP_442704.1_7 Forward -118 -99 13.5691 0.181
NP_441286.1_1 Reverse -152 -164 4.95553 0.027
NP_441286.1_1 Reverse -268 -280 0.0389777 0.119
NP_441286.1_1 Forward -163 -151 -3.50094 0.145
NP_441286.1_1 Reverse -208 -220 -4.68091 0.168
NP_440670.1_8 Forward -162 -153 18.3876 0.000699
NP_440670.1_8 Reverse -153 -162 18.3876 0.000699
NP_441930.1_1 Reverse -149 -168 7.66927 0.235
NP_440886.1_7 Forward -163 -153 17.7774 0.0011
NP_440886.1_7 Reverse -152 -162 17.7774 0.0011
NP_441001.1_10 Reverse -164 -183 9.73422 0.249
NP_442614.1_2 Reverse -153 -167 7.47274 0.273
NP_442382.1_8 Reverse -200 -219 15.2988 0.294
NP_442072.1_9 Reverse -152 -170 -12.7639 0.091
NP_442072.1_9 Forward -163 -145 -14.0422 0.129
NP_442401.1_2 Forward -212 -193 6.98015 0.282
NP_441753.1_10 Forward -171 -152 5.70265 0.186
NP_441808.1_8 Reverse -156 -175 8.65258 0.259
NP_441808.1_8 Forward -317 -298 6.98095 0.283
NP_440907.2_8 Forward -161 -151 14.2375 0.0312
NP_440907.2_8 Reverse -154 -164 7.84605 0.117
NP_441021.1_1 Forward -161 -142 -2.75381 0.145
NP_441021.1_1 Reverse -339 -358 -12.4886 0.288
NP_441463.1_3 Forward -172 -153 16.4207 0.0166
NP_441463.1_3 Reverse -143 -162 -9.14533 0.277
NP_441626.1_2 Forward -161 -154 15.7721 0.0124
NP_441626.1_2 Reverse -154 -161 15.7721 0.0124
NP_442211.1_3 Forward -173 -154 7.86106 0.275
NP_442211.1_7 Forward -156 -137 11.0117 0.211
NP_442365.1_7 Reverse -149 -168 -5.21209 0.262
NP_442794.1_1 Reverse -149 -161 12.4287 0.0721
NP_442615.1_1 Reverse -144 -162 17.7187 0.00617
NP_442615.1_1 Forward -171 -153 2.67408 0.0637
NP_441962.1_4 Forward -317 -298 -6.09707 0.175
NP_441962.1_4 Forward -167 -148 -13.5702 0.275
NP_441742.1_7 Reverse -149 -168 16.6174 0.245
NP_440387.1_1 Forward -162 -146 23.5596 0.00159
NP_440387.1_1 Reverse -153 -169 21.888 0.00209
NP_441431.1_2 Forward -165 -151 12.192 0.126
NP_441431.1_2 Reverse -150 -164 8.25877 0.221
NP_441431.1_2 Reverse -48 -62 6.29216 0.275
NP_441431.1_2 Forward -221 -207 6.0955 0.28
NP_441993.1_1 Reverse -147 -166 2.04414 0.265
NP_441174.1_2 Forward -165 -151 14.0609 0.176
NP_440467.1_3 Reverse -142 -161 18.3855 0.0473
NP_440114.1_10 Reverse -153 -167 7.57108 0.231
NP_442357.1_10 Reverse -202 -216 18.1901 0.282
NP_440725.1_1 Reverse -181 -200 13.2741 0.272
NP_441272.1_7 Reverse -221 -231 14.6313 0.218
NP_440766.1_4 Reverse -149 -163 9.04604 0.0871
NP_440766.1_4 Forward -166 -152 8.06273 0.0871
NP_440766.1_5 Reverse -283 -295 6.98735 0.29
NP_442743.1_5 Forward -167 -148 12.5858 0.136
NP_442743.1_5 Reverse -154 -173 9.63589 0.148
NP_441531.1_6 Reverse -272 -285 10.7374 0.254
NP_442930.1_1 Reverse -31 -41 9.616 0.28
NP_439910.1_2 Forward -170 -153 -11.7609 0.0788
NP_440457.1_1 Forward -166 -154 10.8554 0.092
NP_440457.1_1 Reverse -149 -161 -0.452677 0.263
NP_440798.1_6 Forward -161 -148 3.26421 0.151
NP_440798.1_6 Reverse -154 -167 2.77255 0.16
NP_440801.1_8 Forward -163 -144 -1.86883 0.283
NP_440142.1_7 Forward -161 -142 10.2259 0.203
NP_440473.1_3 Reverse -148 -167 17.6007 0.205
NP_440473.1_9 Forward -397 -378 0.687771 0.123
NP_442509.1_9 Forward -162 -152 16.2041 0.00739
NP_442509.1_9 Reverse -153 -163 16.2041 0.00739
NP_440448.1_4 Forward -381 -362 7.27595 0.297
NP_440554.1_4 Reverse -154 -164 14.6313 0.02
NP_440554.1_4 Forward -161 -151 7.35486 0.103
NP_441885.1_5 Forward -162 -152 11.4848 0.00668
NP_441885.1_5 Reverse -153 -163 11.4848 0.00668
NP_441885.1_5 Forward -332 -322 -1.29827 0.259
NP_442341.1_7 Forward -163 -149 17.7975 0.0111
NP_442341.1_7 Reverse -152 -166 8.06273 0.0947
NP_442341.1_9 Reverse -151 -165 9.6354 0.147
NP_442341.1_9 Forward -164 -150 8.25877 0.174
NP_441173.1_9 Reverse -183 -191 12.2121 0.21
NP_442395.2_4 Reverse -152 -171 1.37531 0.244
NP_442395.2_4 Forward -163 -144 0.293673 0.274
NP_442534.1_7 Forward -163 -144 13.0775 0.181
NP_443000.1_7 Forward -164 -154 8.73149 0.0437
NP_443000.1_7 Reverse -151 -161 1.94665 0.226
NP_440507.2_3 Reverse -144 -163 10.1267 0.208
NP_440507.2_3 Reverse -314 -333 7.27514 0.283
NP_440275.1_3 Forward -164 -154 8.4365 0.0602
NP_440275.1_3 Reverse -151 -161 8.33817 0.0602
NP_440091.1_1 Forward -166 -154 10.8554 0.0429
NP_441902.1_2 Forward -320 -306 19.9608 0.27
NP_440679.1_10 Reverse -155 -174 -14.1602 0.226
NP_441359.1_5 Forward -165 -146 4.42435 0.223
NP_441122.1_1 Reverse -325 -340 4.50312 0.28
NP_439962.1_4 Reverse -307 -326 -6.39206 0.283
NP_439962.1_4 Reverse -145 -164 -9.047 0.298
NP_440149.1_8 Reverse -153 -172 -4.03212 0.201
NP_441105.1_3 Reverse -142 -161 -0.885524 0.143
NP_441105.1_3 Forward -194 -175 -8.752 0.278
NP_442373.1_1 Forward -341 -322 8.84924 0.0787
NP_440216.1_1 Reverse -153 -167 6.88276 0.0116
NP_440216.1_1 Forward -162 -148 -2.16369 0.0482
NP_440216.1_1 Reverse -198 -212 -12.6851 0.296
NP_440172.1_1 Forward -162 -152 8.73149 0.0586
NP_440172.1_1 Reverse -153 -163 8.73149 0.0586
NP_440172.1_1 Reverse -258 -268 4.69992 0.171
NP_442371.1_1 Forward -43 -33 14.6309 0.185
NP_441718.1_4 Reverse -142 -161 10.9134 0.299
NP_442015.1_10 Reverse -149 -162 20.1771 0.00366
NP_442015.1_10 Forward -166 -153 9.45906 0.0486
NP_442015.1_10 Reverse -137 -150 0.0192843 0.245
NP_441226.1_7 Forward -161 -154 14.4934 0.0123
NP_441226.1_7 Reverse -154 -161 14.4934 0.0123
NP_441111.1_7 Forward -161 -153 18.7023 0.00294
NP_441111.1_7 Reverse -154 -162 18.7023 0.00294
NP_442379.1_10 Forward -169 -152 7.02034 0.109
NP_442379.1_10 Forward -214 -197 -1.14113 0.223
NP_441766.1_2 Forward -162 -153 17.5026 0.00297
NP_441766.1_2 Reverse -153 -162 17.5026 0.00297
NP_442417.1_5 Forward -162 -148 10.1277 0.124
NP_442417.1_5 Reverse -311 -325 7.17775 0.195
NP_442417.1_5 Reverse -114 -128 5.40779 0.263
NP_440416.1_9 Forward -169 -150 11.3075 0.0204
NP_440416.1_9 Reverse -146 -165 2.0644 0.0413
NP_443052.1_8 Forward -172 -153 0.196116 0.0669
NP_443052.1_9 Reverse -298 -317 5.11266 0.149
NP_443052.1_9 Reverse -301 -320 -5.50708 0.271
NP_440591.1_9 Reverse -308 -326 6.70565 0.215
NP_440591.1_9 Reverse -146 -164 5.23069 0.253
NP_442154.1_6 Forward -163 -144 4.71934 0.234
NP_440261.1_5 Forward -161 -148 -10.4038 0.201
NP_440261.1_5 Reverse -154 -167 -10.6005 0.201
NP_440261.1_5 Reverse -210 -223 -12.1738 0.272
NP_440988.1_10 Forward -280 -266 6.73827 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGCACCGGAAGACAGCTATGTGGTCGATAAGGTGTTGCTAGTCAAAGACGGAGACAATGTCACCATTGGCCAGCCCTACGTCGCTGGAGCCACTGTAGAAGGGGAAATTCTCTCCCACCGTCGGGGTCGCAAAGTCATCGTCTACAAAATGCAACCCAAAAAGAAAACCCGCAAAAAACGGGGTCACCGCCAAGAGCTCACCCGCCTATTGGTGAAATCCATCTCCGTCAACGGCACGGCGATCGCCGAGGCCCTCGAAGTGGATGCTAAAACCCCAGTGGTGGCTGGTTAAGACAACAACCAGTCAAATTTGGCTAGTATTGTAGGTCGGGTACAATCAGAACTCGCTGGCTAGCCTGAAAAAAATTTGTTAACCATTAACAGGAGACATTAATAACC

CDS

ATGGCCCATAAGAAAGGAACGGGGAGTACCCGGAACGGTCGCGATTCTAACGCCCAACGCTTGGGAGTCAAACGCTACGGTGGTCAAACCGTTACCGCTGGCAGCATCATCGTGCGTCAACGGGGTACCCAAGTTCATCCCGGCAACAACGTCGGCCGGGGCAAAGATGACACCCTTTTCGCTTTGATTGACGGTGTGGTTAAGTTTGAGCATAAAACCAGAAGCCGCCGCAAAGTGAGTGTTTATCCCGCCACTGCTGAATAA

Protein

MAHKKGTGSTRNGRDSNAQRLGVKRYGGQTVTAGSIIVRQRGTQVHPGNNVGRGKDDTLFALIDGVVKFEHKTRSRRKVSVYPATAE