Your browser is old and dusty. Try Google Chrome!

Details for ssr2781

ORF ssr2781
Accession NP_442975.1
Symbol
Category
Definition
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -2 -16 12.291 0.222
NP_441061.1_2 Forward -146 -132 -1.8687 0.274
NP_440557.1_1 Reverse -126 -145 3.34271 0.209
NP_440795.1_7 Forward -133 -126 14.6904 0.0123
NP_440795.1_7 Reverse -126 -133 14.6904 0.0123
NP_441418.1_6 Reverse -125 -144 0.392778 0.00891
NP_441453.1_4 Forward -134 -126 16.6374 0.00633
NP_441453.1_4 Reverse -125 -133 16.539 0.00633
NP_441453.1_8 Reverse -283 -300 13.4119 0.205
NP_441453.1_8 Forward -223 -206 8.49531 0.25
NP_441818.1_9 Reverse -129 -148 -0.000545616 0.191
NP_441818.1_9 Forward -379 -360 -1.18052 0.198
NP_441818.1_9 Reverse -132 -151 -5.80207 0.257
NP_440226.1_1 Reverse -125 -144 8.55425 0.0849
NP_440226.1_1 Forward -134 -115 7.47261 0.105
NP_441098.1_5 Forward -217 -198 8.65258 0.284
NP_442655.1_1 Reverse -357 -376 -0.885524 0.255
NP_442173.1_1 Reverse -126 -134 17.3257 0.00633
NP_442173.1_1 Forward -133 -125 15.4574 0.00633
NP_442752.1_4 Reverse -125 -132 13.8055 0.0199
NP_443027.1_4 Reverse -123 -133 13.2547 0.0521
NP_443027.1_4 Forward -136 -126 7.35486 0.24
NP_442975.1_4 Forward -78 -59 21.4356 0.18
NP_442975.1_10 Forward -138 -124 19.4684 0.00397
NP_440784.1_7 Forward -133 -126 15.9687 0.0123
NP_440784.1_7 Reverse -126 -133 15.9687 0.0123
NP_440061.1_9 Forward -136 -122 7.07881 0.219
NP_441476.1_5 Forward -139 -120 -5.9004 0.271
NP_441499.1_5 Forward -160 -146 12.4876 0.284
NP_442062.1_8 Reverse -125 -135 19.1546 0.00121
NP_442062.1_8 Forward -134 -124 7.84651 0.0871
NP_442062.1_8 Reverse -169 -179 3.61828 0.26
NP_441859.1_3 Reverse -124 -143 1.96529 0.269
NP_441859.1_3 Forward -91 -72 1.86696 0.272
NP_440304.1_4 Reverse -123 -133 10.8948 0.051
NP_442242.1_4 Forward -133 -126 14.3954 0.0124
NP_442242.1_4 Reverse -126 -133 14.3954 0.0124
NP_440044.1_8 Reverse -126 -145 -2.36049 0.262
NP_442762.1_10 Reverse -285 -304 -12.2919 0.284
NP_441935.1_7 Reverse -118 -137 5.99764 0.236
NP_441594.1_6 Forward -93 -74 4.12936 0.222
NP_442196.1_10 Reverse -123 -142 17.0107 0.133
NP_442196.1_10 Reverse -167 -186 10.4225 0.259
NP_442110.1_7 Forward -134 -120 3.73617 0.21
NP_441082.1_10 Reverse -133 -146 13.0973 0.236
NP_442726.1_1 Forward -122 -103 8.84924 0.268
NP_440856.1_4 Reverse -118 -137 -0.787193 0.187
NP_441083.1_5 Forward -134 -124 2.04498 0.195
NP_441083.1_5 Reverse -125 -135 1.55333 0.204
NP_441738.1_2 Forward -132 -125 15.28 0.0102
NP_441738.1_2 Reverse -127 -134 11.5435 0.084
NP_441558.1_5 Reverse -123 -142 19.3707 0.0081
NP_441955.1_8 Reverse -163 -180 9.97027 0.255
NP_440209.1_1 Reverse -125 -133 18.1123 0.00295
NP_440209.1_1 Forward -134 -126 8.57422 0.0425
NP_440447.1_1 Reverse -120 -138 2.0841 0.285
NP_441713.1_1 Reverse -119 -138 -10.4236 0.2
NP_441770.1_10 Reverse -353 -372 13.4708 0.213
NP_442570.1_3 Reverse -220 -239 -1.67217 0.212
NP_442111.1_4 Forward -135 -121 10.4227 0.0544
NP_441163.1_4 Reverse -370 -389 11.8555 0.297
NP_441533.1_7 Forward -310 -292 22.8311 0.0426
NP_440906.1_5 Forward -133 -126 15.8704 0.0124
NP_440906.1_5 Reverse -126 -133 15.8704 0.0124
NP_440747.1_10 Reverse -122 -134 7.31547 0.00577
NP_440747.1_10 Forward -137 -125 -4.28759 0.0903
NP_440747.1_10 Reverse -359 -371 -11.9574 0.178
NP_440747.1_10 Forward -240 -228 -12.2524 0.254
NP_441486.1_1 Forward -137 -123 4.03116 0.0508
NP_441486.1_1 Reverse -122 -136 -2.85201 0.175
NP_441880.2_10 Forward -177 -159 9.75391 0.226
NP_442850.1_5 Reverse -113 -132 19.0757 0.171
NP_442634.1_4 Reverse -123 -137 -1.27871 0.149
NP_440842.1_10 Reverse -175 -189 4.71948 0.254
NP_441014.1_10 Reverse -74 -93 3.14526 0.215
NP_442848.1_5 Forward -150 -132 -2.73412 0.286
NP_441012.1_4 Forward -375 -362 9.2624 0.272
NP_443018.1_3 Forward -133 -126 14.8871 0.0123
NP_443018.1_3 Reverse -126 -133 14.8871 0.0123
NP_443018.1_3 Reverse -235 -242 4.36568 0.254
NP_443018.1_3 Forward -242 -235 4.07068 0.299
NP_441634.1_8 Reverse -123 -137 -2.65535 0.295
NP_440376.1_1 Forward -134 -125 9.73449 0.0365
NP_440376.1_1 Reverse -125 -134 9.63616 0.0385
NP_440376.1_1 Reverse -362 -371 4.22796 0.166
NP_441857.1_5 Forward -141 -123 14.8671 0.123
NP_441588.1_4 Reverse -127 -137 17.188 0.0369
NP_442687.1_7 Reverse -124 -134 8.04317 0.116
NP_442687.1_7 Forward -135 -125 6.27322 0.175
NP_442687.1_7 Forward -372 -362 5.97822 0.179
NP_442687.1_7 Reverse -190 -200 4.60159 0.243
NP_442589.1_5 Reverse -91 -110 14.1591 0.265
NP_441846.1_10 Reverse -289 -308 -16.7168 0.256
NP_440642.1_10 Reverse -80 -94 3.24392 0.277
NP_441013.1_2 Reverse -357 -375 -3.22577 0.29
NP_441422.1_7 Reverse -59 -76 -0.747806 0.168
NP_441422.1_7 Forward -136 -119 -2.12444 0.209
NP_440533.1_9 Forward -134 -115 3.24438 0.253
NP_442296.1_9 Forward -140 -121 5.80098 0.136
NP_442658.1_1 Forward -136 -126 15.0242 0.0188
NP_442658.1_1 Reverse -123 -133 14.2375 0.0237
NP_442198.1_8 Reverse -273 -292 17.7974 0.157
NP_442782.1_2 Forward -134 -120 3.93283 0.257
NP_441958.1_5 Reverse -124 -134 19.9412 0.00158
NP_441958.1_5 Forward -135 -125 2.53664 0.0409
NP_440651.1_7 Forward -320 -301 13.6675 0.265
NP_440203.1_5 Forward -144 -134 10.9926 0.206
NP_440203.1_5 Reverse -210 -220 9.02601 0.275
NP_439905.1_1 Reverse -285 -298 14.3756 0.127
NP_443001.1_7 Reverse -126 -145 14.8474 0.166
NP_440984.1_7 Reverse -357 -371 10.521 0.125
NP_441162.1_5 Forward -381 -363 18.0137 0.166
NP_439990.1_5 Forward -177 -164 6.80412 0.221
NP_441580.1_6 Forward -145 -126 2.85105 0.117
NP_442064.1_4 Reverse -218 -237 4.22689 0.294
NP_442236.1_3 Reverse -75 -94 6.58763 0.282
NP_442210.1_5 Reverse -295 -314 10.8159 0.237
NP_439975.1_2 Reverse -5 -23 4.73903 0.292
NP_442002.1_1 Forward -225 -207 -10.6006 0.296
NP_441294.1_7 Forward -138 -124 11.9383 0.12
NP_441646.1_7 Forward -376 -362 15.2409 0.243
NP_442438.1_10 Forward -139 -125 7.66941 0.09
NP_442431.1_7 Forward -45 -26 10.1275 0.2
NP_442431.1_10 Reverse -294 -312 12.2122 0.0901
NP_440377.1_1 Forward -54 -37 12.8198 0.252
NP_441000.1_6 Forward -135 -121 -2.45868 0.216
NP_441000.1_6 Reverse -124 -138 -3.54032 0.224
NP_441000.1_6 Forward -71 -57 -5.11362 0.261
NP_440147.1_4 Forward -136 -123 17.6205 0.00602
NP_440147.1_4 Reverse -123 -136 7.00078 0.0778
NP_441550.1_8 Reverse -123 -133 15.8108 0.0132
NP_441550.1_8 Forward -245 -235 6.27276 0.214
NP_441916.1_7 Forward -134 -124 19.6462 0.00144
NP_441916.1_7 Reverse -125 -135 16.4013 0.00539
NP_441916.1_7 Reverse -362 -372 3.12662 0.227
NP_441041.1_4 Forward -134 -115 -1.67217 0.102
NP_441041.1_4 Reverse -125 -144 -10.522 0.233
NP_441041.1_4 Forward -299 -280 -13.5702 0.291
NP_441041.1_7 Forward -137 -125 18.1071 0.0066
NP_441041.1_7 Reverse -122 -134 10.0414 0.103
NP_441041.1_7 Forward -181 -169 5.47405 0.255
NP_442396.1_1 Reverse -6 -24 13.0972 0.18
NP_440569.1_6 Reverse -129 -148 4.12936 0.24
NP_442004.1_6 Forward -134 -120 8.94771 0.14
NP_441725.1_4 Reverse -120 -134 4.62054 0.278
NP_441725.1_5 Forward -133 -123 1.94665 0.115
NP_439966.1_7 Reverse -123 -133 14.3359 0.0203
NP_439966.1_7 Forward -245 -235 7.45273 0.15
NP_439966.1_9 Forward -136 -127 0.884706 0.253
NP_442941.1_3 Forward -133 -123 19.2529 0.00262
NP_442941.1_3 Reverse -126 -136 0.0783647 0.231
NP_440289.1_2 Forward -137 -124 -3.12731 0.265
NP_440983.1_9 Reverse -116 -135 2.0644 0.292
NP_442281.1_1 Forward -139 -125 20.9434 0.00192
NP_442281.1_1 Reverse -120 -134 3.44058 0.231
NP_441334.1_7 Forward -136 -117 -4.52377 0.12
NP_442012.1_1 Reverse -119 -138 4.22769 0.171
NP_442012.1_2 Reverse -123 -142 1.67108 0.3
NP_441860.1_1 Reverse -258 -272 15.6463 0.277
NP_441556.1_10 Reverse -76 -90 9.73513 0.293
NP_440498.1_1 Reverse -116 -134 8.18062 0.0795
NP_440375.1_8 Reverse -115 -134 -0.787193 0.273
NP_441644.1_6 Forward -134 -124 16.6958 0.00284
NP_443049.1_6 Reverse -137 -147 11.153 0.278
NP_442215.1_2 Forward -111 -95 -6.33298 0.268
NP_442177.1_5 Reverse -135 -149 11.996 0.22
NP_442247.1_8 Reverse -123 -137 11.8976 0.247
NP_440253.1_2 Reverse -125 -143 3.46073 0.116
NP_440929.1_8 Forward -134 -125 9.93116 0.0249
NP_440929.1_8 Reverse -125 -134 9.83282 0.0254
NP_440780.1_1 Reverse -34 -53 8.92807 0.274
NP_442933.1_10 Forward -134 -125 17.601 0.00325
NP_442933.1_10 Reverse -125 -134 17.601 0.00325
NP_441751.2_8 Forward -133 -119 14.6509 0.0119
NP_442926.1_1 Reverse -288 -307 1.17943 0.205
NP_442554.1_8 Forward -133 -123 17.2863 0.00543
NP_442554.1_8 Reverse -126 -136 3.61828 0.218
NP_441762.1_7 Forward -135 -123 4.07055 0.0572
NP_441762.1_7 Reverse -124 -136 2.79224 0.0676
NP_442142.1_4 Forward -309 -296 14.8666 0.0302
NP_442142.1_4 Reverse -122 -135 13.8833 0.0324
NP_442142.1_4 Forward -137 -124 6.31189 0.169
NP_442292.1_1 Forward -133 -124 17.5026 0.00435
NP_442292.1_1 Reverse -126 -135 0.688044 0.23
NP_442476.1_6 Forward -133 -119 9.2427 0.0909
NP_442381.1_8 Forward -137 -118 -3.63879 0.126
NP_443009.1_5 Reverse -124 -135 18.5443 0.00265
NP_443009.1_5 Forward -135 -124 3.79477 0.278
NP_440807.1_9 Forward -73 -54 18.879 0.279
NP_441715.1_4 Forward -133 -123 16.7946 0.0106
NP_441715.1_4 Reverse -126 -136 8.1415 0.107
NP_440357.1_6 Forward -306 -287 4.62101 0.29
NP_440015.1_9 Forward -134 -116 2.37909 0.207
NP_441448.1_1 Forward -77 -58 3.53937 0.296
NP_440183.1_1 Forward -133 -114 11.1109 0.244
NP_440183.1_9 Reverse -83 -102 -21.1417 0.296
NP_441468.1_1 Forward -133 -126 15.8704 0.0124
NP_441468.1_1 Reverse -126 -133 15.8704 0.0124
NP_441468.1_1 Reverse -235 -242 4.36568 0.237
NP_441015.1_10 Reverse -120 -139 -4.6221 0.209
NP_441673.1_1 Forward -134 -125 11.1111 0.0121
NP_441673.1_1 Reverse -125 -134 11.0128 0.018
NP_441826.1_2 Forward -249 -235 -2.65535 0.273
NP_441826.1_2 Forward -140 -126 -4.22864 0.293
NP_441330.1_1 Reverse -120 -139 -2.65548 0.0791
NP_441330.1_1 Reverse -357 -376 -13.8652 0.206
NP_442868.1_6 Reverse -123 -133 10.4031 0.038
NP_442868.1_6 Forward -239 -229 1.06167 0.205
NP_441056.1_1 Reverse -228 -247 0.58944 0.155
NP_440051.1_10 Forward -144 -132 21.5729 0.029
NP_442227.1_2 Forward -198 -179 -3.93378 0.3
NP_442361.1_3 Forward -140 -127 16.8339 0.0562
NP_442808.1_1 Forward -148 -138 13.0576 0.0481
NP_442808.1_1 Forward -135 -125 9.91099 0.0481
NP_440031.1_8 Reverse -303 -322 17.5024 0.186
NP_440031.1_10 Reverse -264 -283 3.24438 0.256
NP_440145.1_3 Reverse -115 -134 6.68596 0.0509
NP_440145.1_3 Forward -381 -362 -1.27885 0.15
NP_442542.1_9 Forward -141 -127 4.42388 0.297
NP_442050.1_5 Reverse -123 -133 15.9091 0.0091
NP_441493.2_7 Forward -386 -367 17.2074 0.159
NP_440558.1_2 Reverse -116 -135 4.71934 0.149
NP_440558.1_2 Forward -246 -227 2.3594 0.169
NP_440558.1_2 Forward -324 -305 -5.31042 0.256
NP_440558.1_2 Reverse -203 -222 -7.27704 0.291
NP_441878.1_6 Forward -135 -125 0.668351 0.139
NP_441878.1_6 Reverse -124 -134 0.668351 0.139
NP_441878.1_6 Forward -372 -362 0.57002 0.14
NP_441878.1_6 Forward -378 -368 -7.88644 0.278
NP_441878.1_6 Reverse -361 -371 -7.88644 0.278
NP_441036.1_8 Forward -135 -125 17.4829 0.0012
NP_441036.1_8 Reverse -124 -134 11.7798 0.106
NP_441557.1_5 Reverse -125 -134 18.6826 0.0015
NP_441557.1_5 Forward -134 -125 10.5211 0.00695
NP_441590.1_4 Forward -247 -228 4.32522 0.288
NP_441590.1_4 Forward -145 -126 3.73524 0.29
NP_441590.1_4 Forward -310 -291 2.9486 0.29
NP_440101.1_3 Reverse -120 -139 12.5858 0.0849
NP_442166.1_7 Forward -133 -119 9.63603 0.19
NP_442166.1_7 Reverse -126 -140 7.27608 0.3
NP_442397.1_9 Forward -115 -96 3.04771 0.264
NP_442135.1_3 Reverse -285 -304 6.68596 0.26
NP_442347.1_2 Reverse -208 -217 6.09625 0.191
NP_442347.1_2 Forward -133 -124 3.34298 0.284
NP_442645.1_2 Reverse -117 -136 -4.32711 0.0562
NP_441037.1_4 Reverse -123 -133 7.22024 0.237
NP_442508.1_8 Reverse -130 -147 13.1169 0.256
NP_441633.1_3 Forward -136 -123 -4.01229 0.179
NP_441633.1_3 Reverse -167 -180 -5.38892 0.236
NP_441633.1_3 Reverse -123 -136 -6.17557 0.238
NP_440136.1_2 Forward -133 -126 15.9687 0.0123
NP_440136.1_2 Reverse -126 -133 15.9687 0.0123
NP_442998.1_10 Forward -132 -125 15.5754 0.0102
NP_442998.1_10 Reverse -127 -134 5.74231 0.255
NP_440731.1_2 Reverse -120 -139 7.37428 0.277
NP_440299.1_1 Forward -138 -125 8.47516 0.0926
NP_440299.1_1 Reverse -121 -134 7.49186 0.112
NP_440299.1_1 Forward -375 -362 4.54195 0.207
NP_441799.1_1 Reverse -121 -135 17.4035 0.011
NP_441799.1_1 Forward -138 -124 5.80051 0.194
NP_440640.1_6 Reverse -126 -145 0.196116 0.276
NP_441007.1_5 Forward -242 -223 11.8975 0.203
NP_441007.1_10 Reverse -120 -133 3.36254 0.182
NP_442334.1_2 Forward -168 -151 -8.61428 0.297
NP_440256.1_1 Reverse -122 -141 20.5506 0.0041
NP_440256.1_1 Reverse -287 -306 -4.72043 0.164
NP_440256.1_1 Forward -137 -118 -5.99873 0.198
NP_441512.1_4 Reverse -121 -140 17.7974 0.0728
NP_441559.1_8 Reverse -120 -134 -1.08205 0.18
NP_440915.1_6 Forward -138 -124 13.4709 0.0187
NP_440915.1_6 Reverse -121 -135 -1.5737 0.239
NP_442069.1_4 Forward -145 -126 4.52268 0.254
NP_442069.1_6 Forward -237 -218 14.4541 0.11
NP_441464.1_10 Reverse -136 -150 10.816 0.238
NP_440702.1_2 Reverse -129 -148 -5.80207 0.257
NP_440702.1_8 Reverse -81 -100 11.7992 0.232
NP_442386.1_9 Forward -135 -126 16.7155 0.0144
NP_442386.1_9 Forward -148 -139 7.57079 0.219
NP_442386.1_9 Reverse -124 -133 6.39082 0.219
NP_442386.1_9 Reverse -212 -221 5.70251 0.241
NP_441750.1_1 Forward -75 -56 -8.55534 0.296
NP_441340.1_5 Forward -133 -126 15.6737 0.0124
NP_441340.1_5 Reverse -126 -133 15.6737 0.0124
NP_441340.1_5 Forward -242 -235 3.97235 0.274
NP_442484.1_2 Forward -145 -126 17.2074 0.0323
NP_442484.1_2 Forward -304 -285 4.12936 0.192
NP_442484.1_2 Reverse -223 -242 -1.86883 0.3
NP_442791.1_5 Forward -162 -143 -10.227 0.279
NP_440168.1_8 Forward -249 -230 16.4207 0.081
NP_440168.1_8 Forward -135 -116 6.98095 0.187
NP_441254.1_1 Reverse -255 -268 10.4418 0.295
NP_439976.1_4 Forward -306 -287 9.24175 0.278
NP_440586.1_8 Forward -133 -126 13.2151 0.026
NP_440586.1_8 Reverse -126 -133 13.2151 0.026
NP_442251.1_6 Forward -133 -126 15.2804 0.0124
NP_442251.1_6 Reverse -126 -133 15.2804 0.0124
NP_441262.1_3 Reverse -125 -132 14.7888 0.0223
NP_441262.1_3 Forward -134 -127 13.9038 0.0336
NP_440027.1_3 Forward -253 -235 7.58986 0.208
NP_440027.1_3 Forward -309 -291 6.1149 0.23
NP_440027.1_3 Reverse -358 -376 5.52492 0.24
NP_440027.1_8 Forward -137 -118 5.89851 0.279
NP_443051.1_1 Reverse -124 -133 19.5676 0.00335
NP_443051.1_1 Forward -135 -126 1.08137 0.123
NP_440408.1_7 Reverse -284 -303 7.57094 0.287
NP_440439.1_1 Reverse -122 -135 18.8005 0.0105
NP_442239.1_8 Forward -377 -358 8.65258 0.249
NP_440372.1_2 Forward -133 -126 16.3621 0.0124
NP_440372.1_2 Reverse -126 -133 16.3621 0.0124
NP_441803.1_2 Reverse -120 -139 11.2092 0.0756
NP_441803.1_2 Reverse -285 -304 10.5209 0.0857
NP_441803.1_2 Forward -311 -292 4.62101 0.177
NP_440139.1_1 Reverse -119 -138 5.30853 0.161
NP_441572.1_7 Forward -140 -121 5.01433 0.0903
NP_441572.1_7 Reverse -291 -310 -4.72043 0.243
NP_442384.1_10 Forward -134 -121 17.4239 0.00585
NP_442384.1_10 Reverse -362 -375 4.34585 0.16
NP_442114.1_4 Forward -134 -123 7.23683 0.291
NP_441877.1_5 Forward -46 -27 0.786102 0.276
NP_441018.1_7 Reverse -302 -321 8.06259 0.256
NP_441018.1_7 Forward -297 -278 6.98095 0.278
NP_442262.1_10 Forward -133 -126 14.1988 0.0123
NP_442262.1_10 Reverse -126 -133 14.1988 0.0123
NP_441689.1_5 Reverse -123 -133 8.3377 0.132
NP_440344.1_10 Forward -141 -124 0.137172 0.0369
NP_440531.1_6 Reverse -117 -136 -2.36049 0.249
NP_442917.1_2 Forward -379 -360 6.58763 0.173
NP_441965.1_3 Reverse -224 -243 -0.39387 0.259
NP_441965.1_10 Forward -246 -230 4.58176 0.237
NP_442529.1_4 Forward -143 -124 15.0441 0.167
NP_440297.1_9 Forward -236 -226 4.20827 0.238
NP_440297.1_9 Forward -133 -123 -0.216628 0.282
NP_442280.1_10 Forward -133 -115 5.16222 0.29
NP_441896.1_3 Forward -143 -124 -1.47551 0.26
NP_442078.1_4 Forward -91 -72 18.584 0.193
NP_440999.1_9 Forward -138 -124 11.7993 0.0438
NP_440888.1_2 Forward -134 -120 11.5037 0.0657
NP_440888.1_2 Reverse -125 -139 7.66879 0.186
NP_440888.1_4 Reverse -170 -184 15.9443 0.231
NP_440600.1_4 Forward -142 -124 -0.570838 0.155
NP_441345.1_6 Forward -170 -151 16.1257 0.204
NP_439969.1_3 Forward -139 -120 7.66927 0.141
NP_442277.1_4 Forward -143 -124 13.8633 0.0497
NP_442033.1_10 Forward -136 -117 -7.86702 0.186
NP_441543.1_2 Forward -133 -124 15.9293 0.00518
NP_441543.1_2 Reverse -126 -135 15.4377 0.00784
NP_442845.1_2 Reverse -132 -146 9.04604 0.182
NP_442845.1_2 Reverse -119 -133 7.07942 0.199
NP_442845.1_2 Forward -254 -240 6.58777 0.207
NP_442845.1_2 Reverse -228 -242 6.48943 0.209
NP_441469.1_8 Forward -135 -126 8.06287 0.227
NP_441469.1_8 Reverse -124 -133 6.5879 0.227
NP_442315.1_1 Reverse -298 -316 4.34571 0.272
NP_443064.1_8 Forward -101 -91 14.9258 0.29
NP_442337.1_8 Reverse -217 -236 -1.57384 0.286
NP_442578.1_7 Forward -133 -126 14.5921 0.026
NP_442578.1_7 Reverse -126 -133 14.5921 0.026
NP_440710.1_1 Reverse -117 -135 -8.63398 0.273
NP_441462.1_2 Reverse -125 -135 10.5998 0.0068
NP_441462.1_2 Forward -134 -124 10.5014 0.00824
NP_441462.1_2 Reverse -362 -372 -0.806614 0.254
NP_441621.1_7 Forward -136 -122 -3.54032 0.19
NP_443062.1_1 Forward -134 -116 10.5936 0.114
NP_441601.1_4 Forward -310 -291 -5.9004 0.295
NP_440519.1_8 Reverse -294 -310 2.22182 0.267
NP_442204.1_1 Reverse -121 -132 11.3667 0.0565
NP_441560.1_10 Forward -224 -205 6.58763 0.287
NP_442487.1_6 Forward -115 -96 13.2733 0.196
NP_440516.1_8 Reverse -125 -134 9.4395 0.0183
NP_440516.1_8 Forward -134 -125 7.17789 0.0754
NP_442428.1_5 Forward -133 -126 15.8704 0.0124
NP_442428.1_5 Reverse -126 -133 15.8704 0.0124
NP_442428.1_5 Reverse -235 -242 4.759 0.223
NP_442859.1_2 Reverse -235 -254 2.94938 0.262
NP_442120.1_10 Forward -90 -71 -11.5053 0.262
NP_442823.1_8 Reverse -120 -139 17.404 0.173
NP_440673.1_3 Reverse -127 -134 14.0021 0.0426
NP_440673.1_3 Forward -132 -125 12.4288 0.0426
NP_440673.1_7 Forward -189 -170 2.16274 0.232
NP_440673.1_7 Forward -145 -126 1.57275 0.244
NP_441052.1_2 Forward -134 -124 1.94665 0.221
NP_441052.1_2 Reverse -125 -135 0.668351 0.256
NP_440992.1_2 Reverse -120 -139 19.3707 0.152
NP_442219.1_9 Reverse -126 -135 9.04618 0.0681
NP_442219.1_9 Forward -133 -124 8.25953 0.0681
NP_442219.1_9 Reverse -229 -238 5.70292 0.135
NP_440436.1_4 Reverse -126 -135 16.9122 0.00357
NP_440436.1_4 Forward -242 -233 10.324 0.0802
NP_440436.1_4 Forward -133 -124 9.24241 0.0871
NP_441884.1_8 Forward -135 -116 -9.34199 0.268
NP_441719.1_4 Forward -133 -126 16.3621 0.0124
NP_441719.1_4 Reverse -126 -133 16.3621 0.0124
NP_441733.1_10 Reverse -122 -135 7.09911 0.156
NP_441004.1_1 Reverse -291 -310 0.58944 0.116
NP_441004.1_1 Forward -376 -357 -7.27704 0.197
NP_441004.1_2 Reverse -298 -317 -1.18052 0.259
NP_442813.1_2 Forward -328 -309 -1.37718 0.273
NP_442366.1_3 Reverse -124 -142 -4.30741 0.268
NP_442873.1_5 Forward -310 -291 6.68515 0.299
NP_441115.1_4 Reverse -124 -142 12.8014 0.0969
NP_442694.1_3 Reverse -224 -242 -4.40575 0.268
NP_442206.1_7 Forward -379 -360 8.25926 0.295
NP_442206.1_10 Reverse -125 -140 1.15987 0.236
NP_442854.1_6 Reverse -234 -253 4.03102 0.252
NP_440328.1_4 Forward -140 -121 5.30933 0.148
NP_443054.1_2 Reverse -123 -137 8.65272 0.114
NP_441851.1_10 Reverse -124 -134 9.7148 0.114
NP_441851.1_10 Forward -135 -125 6.76487 0.156
NP_441396.1_5 Reverse -301 -310 8.65285 0.21
NP_441396.1_5 Reverse -7 -16 8.35786 0.224
NP_440593.1_3 Forward -248 -229 -1.96717 0.219
NP_441349.1_10 Reverse -115 -134 5.60432 0.0427
NP_440432.1_9 Reverse -126 -141 -2.97003 0.177
NP_441062.1_10 Reverse -368 -387 4.52268 0.26
NP_439960.1_6 Reverse -119 -138 11.1109 0.208
NP_440431.1_3 Forward -67 -48 9.24257 0.0748
NP_442168.1_5 Forward -133 -114 -0.197208 0.264
NP_442168.1_5 Forward -247 -228 -2.36049 0.264
NP_440588.1_2 Reverse -116 -135 7.57094 0.0493
NP_442006.1_2 Forward -99 -82 -18.7424 0.295
NP_441003.1_9 Reverse -359 -378 4.916 0.274
NP_440483.1_1 Reverse -292 -311 -7.17871 0.258
NP_441570.1_1 Forward -134 -116 -7.84733 0.0968
NP_441570.1_1 Reverse -125 -143 -17.3854 0.273
NP_441570.1_1 Forward -237 -219 -17.5821 0.283
NP_441078.1_4 Forward -134 -125 9.93116 0.0203
NP_441078.1_4 Reverse -125 -134 9.83282 0.0226
NP_441078.1_4 Reverse -362 -371 -1.86856 0.272
NP_441663.1_8 Reverse -356 -375 -2.65548 0.271
NP_442348.1_2 Forward -216 -207 7.57121 0.28
NP_442443.1_1 Reverse -153 -172 -6.98204 0.299
NP_441432.1_8 Reverse -124 -133 16.8143 0.00595
NP_443024.1_3 Forward -180 -170 16.4996 0.255
NP_442320.1_8 Forward -140 -126 5.21113 0.0401
NP_442344.1_7 Forward -370 -351 -8.94866 0.232
NP_440313.1_5 Forward -142 -124 12.2114 0.239
NP_442003.1_4 Reverse -126 -145 9.93088 0.296
NP_442815.1_1 Forward -341 -322 6.39097 0.203
NP_440760.1_1 Reverse -362 -381 -21.0434 0.228
NP_442797.1_1 Reverse -360 -379 -6.58872 0.296
NP_442797.1_7 Forward -244 -226 -1.35749 0.297
NP_441057.1_3 Reverse -53 -72 -2.65548 0.159
NP_441057.1_3 Forward -51 -32 -11.7019 0.24
NP_442353.1_4 Forward -140 -121 8.25844 0.156
NP_440913.1_1 Reverse -123 -141 6.80398 0.221
NP_440913.1_1 Reverse -167 -185 4.6407 0.26
NP_441072.1_2 Reverse -121 -140 6.4893 0.28
NP_440713.1_2 Forward -233 -214 13.2741 0.109
NP_440713.1_4 Reverse -115 -134 8.45592 0.17
NP_440713.1_4 Reverse -218 -237 7.86593 0.174
NP_440713.1_4 Forward -226 -207 3.83436 0.237
NP_440713.1_4 Reverse -213 -232 3.34271 0.246
NP_442489.1_7 Forward -134 -125 10.4228 0.0151
NP_442489.1_7 Reverse -125 -134 10.3245 0.0193
NP_442489.1_7 Reverse -362 -371 -1.18024 0.18
NP_440559.1_1 Reverse -126 -135 8.84951 0.0586
NP_440559.1_1 Forward -133 -124 8.65285 0.0586
NP_441659.2_8 Forward -134 -124 18.6629 0.00133
NP_441659.2_8 Reverse -125 -135 2.33998 0.205
NP_441659.2_8 Reverse -57 -67 0.668351 0.26
NP_441040.1_2 Reverse -53 -72 -10.6203 0.248
NP_441040.1_2 Forward -173 -154 -16.4218 0.296
NP_439956.1_7 Reverse -217 -236 7.37428 0.257
NP_442346.1_5 Reverse -124 -134 15.8113 0.0045
NP_442346.1_5 Forward -135 -125 6.8632 0.188
NP_442346.1_5 Forward -372 -362 5.97822 0.219
NP_442346.1_10 Forward -111 -92 0.884433 0.226
NP_440545.1_3 Forward -138 -121 -5.95935 0.265
NP_440459.1_2 Forward -143 -126 10.8552 0.189
NP_440459.1_2 Reverse -359 -376 8.59364 0.254
NP_440010.1_3 Forward -126 -107 -6.49039 0.25
NP_440010.1_10 Forward -126 -107 1.47442 0.299
NP_441943.1_2 Reverse -38 -57 15.0441 0.223
NP_442603.1_7 Forward -102 -88 6.29216 0.249
NP_442603.1_9 Forward -136 -118 12.5072 0.189
NP_441585.1_5 Forward -144 -125 3.34192 0.255
NP_441585.1_5 Reverse -38 -57 2.06362 0.28
NP_441888.1_7 Reverse -164 -178 11.7993 0.0771
NP_441888.1_7 Forward -311 -297 2.5562 0.225
NP_441888.1_7 Forward -139 -125 1.86788 0.235
NP_441948.1_4 Forward -141 -123 -2.43913 0.166
NP_441502.1_3 Reverse -123 -142 12.9791 0.21
NP_441833.1_4 Forward -133 -126 15.9687 0.0124
NP_441833.1_4 Reverse -126 -133 15.9687 0.0124
NP_441895.1_3 Forward -144 -125 -7.96535 0.192
NP_442699.1_8 Reverse -301 -320 -3.04881 0.218
NP_442162.1_9 Forward -133 -126 16.2637 0.0124
NP_442162.1_9 Reverse -126 -133 16.2637 0.0124
NP_440671.1_4 Reverse -119 -133 7.37441 0.219
NP_442404.1_9 Forward -315 -301 8.55376 0.296
NP_440224.1_1 Reverse -114 -133 -1.86883 0.189
NP_442199.1_5 Reverse -117 -136 0.196116 0.174
NP_442140.1_3 Reverse -126 -136 15.9097 0.0313
NP_442140.1_3 Forward -133 -123 4.69992 0.238
NP_442140.1_3 Reverse -298 -308 3.71661 0.283
NP_441696.1_6 Forward -133 -114 2.0644 0.285
NP_441671.1_10 Reverse -114 -133 2.16274 0.257
NP_440875.1_9 Forward -132 -122 16.5483 0.0145
NP_441813.1_5 Reverse -123 -133 18.1713 0.00743
NP_441813.1_5 Forward -136 -126 9.12481 0.0308
NP_440590.1_4 Reverse -126 -139 10.049 0.0314
NP_440590.1_4 Forward -133 -120 -5.38892 0.277
NP_440567.1_1 Reverse -126 -140 14.3559 0.0187
NP_440567.1_1 Forward -133 -119 12.4876 0.023
NP_442497.1_10 Forward -133 -124 17.601 0.00813
NP_442497.1_10 Reverse -126 -135 8.55452 0.0294
NP_440821.1_4 Reverse -123 -133 2.24165 0.131
NP_440821.1_4 Forward -136 -126 1.455 0.135
NP_441239.1_9 Reverse -123 -135 11.4454 0.0607
NP_441239.1_9 Forward -136 -124 10.7571 0.0723
NP_441239.1_9 Forward -245 -233 10.0687 0.0888
NP_441239.1_9 Forward -131 -119 8.88877 0.12
NP_441239.1_9 Reverse -282 -294 5.25052 0.223
NP_441951.1_4 Forward -127 -108 1.67108 0.283
NP_441892.1_1 Forward -143 -126 5.15205 0.105
NP_441508.1_4 Forward -58 -44 13.3805 0.297
NP_440354.1_5 Forward -296 -277 6.98095 0.174
NP_442138.1_1 Forward -308 -289 -0.29631 0.298
NP_440546.1_4 Forward -134 -124 14.3121 0.0459
NP_440546.1_4 Reverse -125 -135 13.5365 0.0459
NP_440546.1_4 Forward -293 -283 10.3369 0.109
NP_440546.1_4 Forward -102 -92 7.91294 0.214
NP_440546.1_4 Forward -222 -212 7.42815 0.241
NP_441230.1_5 Reverse -108 -127 2.85105 0.209
NP_440462.1_6 Reverse -123 -133 18.7612 0.00454
NP_440462.1_6 Forward -136 -126 8.33817 0.0646
NP_442611.1_1 Forward -134 -115 3.24438 0.209
NP_440868.1_4 Reverse -121 -133 15.0836 0.0164
NP_440868.1_4 Forward -247 -235 -1.04266 0.291
NP_442479.1_5 Forward -53 -34 5.84723 0.273
NP_441474.1_1 Forward -309 -290 1.47364 0.247
NP_441474.1_1 Forward -148 -129 -0.689632 0.255
NP_441474.1_1 Forward -144 -125 -2.65624 0.284
NP_442402.1_4 Forward -295 -276 -3.83621 0.22
NP_442402.1_4 Forward -50 -31 -6.29447 0.255
NP_442402.1_4 Forward -30 -11 -8.6544 0.284
NP_440036.1_4 Forward -87 -68 19.174 0.184
NP_441848.1_7 Forward -26 -7 -1.67294 0.254
NP_441084.1_6 Reverse -123 -137 12.8346 0.152
NP_440653.1_10 Reverse -126 -145 4.32602 0.252
NP_440696.1_6 Reverse -120 -139 11.7008 0.207
NP_442039.1_4 Forward -133 -126 15.1821 0.0124
NP_442039.1_4 Reverse -126 -133 15.1821 0.0124
NP_441811.1_8 Reverse -306 -320 7.57108 0.241
NP_440825.1_7 Reverse -126 -136 14.8615 0.152
NP_442837.1_3 Forward -133 -126 15.7721 0.0124
NP_442837.1_3 Reverse -126 -133 15.7721 0.0124
NP_442053.1_1 Reverse -125 -134 9.24284 0.068
NP_442053.1_1 Forward -134 -125 8.94785 0.07
NP_440505.1_3 Reverse -123 -133 17.188 0.00332
NP_441102.1_1 Reverse -126 -145 12.6841 0.108
NP_441102.1_2 Reverse -138 -157 6.88262 0.298
NP_442456.1_5 Forward -389 -371 9.36059 0.26
NP_440914.1_1 Forward -134 -124 15.0561 0.00832
NP_441011.1_8 Reverse -126 -135 18.191 0.00602
NP_441011.1_8 Forward -133 -124 16.6177 0.00602
NP_442533.1_1 Reverse -129 -148 -13.0786 0.236
NP_442533.1_6 Reverse -125 -134 15.1427 0.00675
NP_442533.1_6 Forward -134 -125 7.47288 0.0898
NP_442533.1_6 Forward -371 -362 5.01461 0.16
NP_442533.1_6 Reverse -239 -248 2.35967 0.259
NP_443050.1_2 Forward -132 -113 8.25926 0.265
NP_442229.1_1 Reverse -123 -137 11.7003 0.18
NP_443016.1_1 Forward -108 -89 -7.96535 0.289
NP_441482.1_7 Reverse -119 -133 6.58777 0.0271
NP_441482.1_7 Forward -377 -363 -9.24352 0.196
NP_439944.1_9 Forward -133 -123 9.12481 0.1
NP_441028.1_6 Forward -190 -180 3.8145 0.281
NP_441028.1_6 Reverse -208 -218 3.51951 0.292
NP_440116.1_8 Reverse -126 -145 2.3594 0.0891
NP_440116.1_8 Forward -133 -114 -2.85214 0.141
NP_440115.1_6 Reverse -122 -132 14.0414 0.0615
NP_439965.1_7 Reverse -209 -228 9.93029 0.294
NP_441680.1_4 Forward -308 -289 10.4225 0.153
NP_441347.1_5 Reverse -119 -133 22.1234 0.0213
NP_443045.1_5 Reverse -179 -192 13.8487 0.275
NP_441972.1_5 Forward -242 -223 -7.76869 0.252
NP_441106.1_1 Reverse -124 -133 18.486 0.0028
NP_441106.1_1 Forward -135 -126 17.306 0.00607
NP_441106.1_1 Reverse -361 -370 8.94785 0.0405
NP_441106.1_1 Reverse -233 -242 2.85133 0.255
NP_440670.1_8 Reverse -125 -134 8.94785 0.0606
NP_440670.1_8 Forward -134 -125 8.84951 0.0606
NP_440886.1_7 Forward -310 -300 10.6976 0.0805
NP_440886.1_7 Forward -135 -125 9.02601 0.0805
NP_440886.1_7 Forward -148 -138 4.60114 0.227
NP_442614.1_2 Reverse -306 -320 6.48943 0.291
NP_442717.1_5 Forward -352 -333 9.73422 0.265
NP_442072.1_9 Reverse -124 -142 -13.5505 0.115
NP_440028.1_6 Forward -177 -159 12.6055 0.24
NP_440907.2_8 Reverse -126 -136 11.3859 0.0902
NP_440907.2_8 Forward -133 -123 9.616 0.103
NP_441287.1_1 Reverse -90 -104 20.5508 0.0927
NP_441463.1_3 Reverse -115 -134 0.58944 0.13
NP_441626.1_2 Forward -133 -126 15.7721 0.0124
NP_441626.1_2 Reverse -126 -133 15.7721 0.0124
NP_441626.1_2 Reverse -229 -236 4.759 0.258
NP_441626.1_6 Forward -138 -120 8.57317 0.251
NP_442211.1_3 Forward -96 -77 15.9339 0.192
NP_442211.1_3 Reverse -288 -307 13.016 0.241
NP_441901.1_2 Forward -132 -113 8.16093 0.172
NP_442365.1_7 Reverse -230 -249 -5.21209 0.262
NP_441460.1_5 Forward -113 -99 14.6503 0.251
NP_440107.1_5 Reverse -352 -371 9.73422 0.139
NP_442794.1_1 Forward -241 -229 8.9871 0.0865
NP_442615.1_1 Reverse -116 -134 -1.65248 0.131
NP_442615.1_1 Forward -143 -125 -3.81576 0.17
NP_441962.1_4 Forward -183 -164 -9.34199 0.215
NP_441962.1_4 Forward -89 -70 -15.1435 0.299
NP_440387.1_1 Forward -134 -118 -2.10475 0.146
NP_441431.1_2 Reverse -122 -136 16.6169 0.0341
NP_441431.1_2 Forward -246 -232 10.422 0.159
NP_441431.1_2 Reverse -359 -373 8.3571 0.218
NP_441431.1_2 Forward -137 -123 6.78381 0.261
NP_441836.1_2 Forward -72 -53 0.982764 0.197
NP_440634.1_4 Reverse -168 -187 7.66927 0.257
NP_441993.1_1 Forward -377 -358 2.1416 0.262
NP_441993.1_1 Forward -384 -365 1.36194 0.28
NP_441993.1_1 Forward -376 -357 0.777198 0.292
NP_441174.1_2 Reverse -122 -136 14.4542 0.161
NP_440114.1_10 Forward -134 -120 10.6193 0.142
NP_441425.1_4 Forward -59 -45 13.5693 0.299
NP_440287.1_6 Forward -143 -124 8.94757 0.151
NP_440287.1_6 Reverse -123 -142 0.392778 0.293
NP_439910.1_2 Forward -142 -125 -12.0559 0.0788
NP_442867.1_8 Reverse -107 -126 10.3242 0.21
NP_440457.1_1 Reverse -121 -133 10.2654 0.092
NP_442940.1_2 Forward -318 -299 0.491109 0.296
NP_440798.1_6 Forward -133 -120 1.00259 0.24
NP_441984.1_4 Reverse -132 -146 16.8142 0.167
NP_441332.1_6 Forward -148 -138 15.3256 0.121
NP_441436.1_2 Reverse -287 -306 -3.14714 0.28
NP_442509.1_4 Forward -243 -224 16.2241 0.237
NP_442509.1_9 Reverse -125 -135 6.86274 0.248
NP_442514.1_5 Forward -130 -111 -9.24438 0.295
NP_441440.1_9 Reverse -89 -108 15.9291 0.239
NP_440554.1_4 Forward -133 -123 17.9746 0.0131
NP_440554.1_4 Reverse -126 -136 9.41981 0.0646
NP_441845.1_6 Reverse -157 -175 4.9357 0.211
NP_441885.1_5 Reverse -125 -135 10.2065 0.012
NP_441885.1_5 Forward -134 -124 1.65166 0.106
NP_440478.1_9 Reverse -117 -136 12.0942 0.255
NP_440478.1_9 Forward -375 -356 9.63589 0.255
NP_440478.1_10 Forward -136 -122 13.1759 0.134
NP_440478.1_10 Reverse -112 -126 7.9644 0.257
NP_442341.1_7 Forward -288 -274 1.47456 0.288
NP_442341.1_7 Reverse -124 -138 1.47456 0.288
NP_441173.1_9 Forward -284 -276 12.2121 0.21
NP_442395.2_4 Forward -135 -116 14.7483 0.0507
NP_442534.1_8 Forward -387 -368 16.4207 0.142
NP_440191.1_4 Reverse -65 -75 13.439 0.282
NP_443000.1_7 Reverse -123 -133 20.3345 0.00223
NP_443000.1_7 Forward -136 -126 1.25834 0.26
NP_441842.1_10 Forward -141 -127 13.4709 0.0753
NP_440275.1_3 Reverse -123 -133 16.1063 0.0155
NP_440275.1_3 Reverse -360 -370 1.84832 0.282
NP_442932.1_9 Reverse -12 -31 6.39097 0.249
NP_440091.1_1 Forward -138 -126 5.44718 0.117
NP_441307.1_6 Reverse -125 -144 5.211 0.277
NP_440679.1_10 Reverse -131 -150 -14.3569 0.23
NP_440679.1_10 Reverse -361 -380 -16.4218 0.261
NP_439962.1_4 Forward -186 -167 0.196116 0.197
NP_439962.1_4 Reverse -317 -336 -1.37718 0.214
NP_439962.1_4 Forward -142 -123 -6.29373 0.283
NP_439962.1_4 Reverse -289 -308 -6.39206 0.283
NP_440804.1_4 Forward -55 -46 16.716 0.145
NP_440149.1_8 Reverse -125 -144 -0.0988766 0.144
NP_440149.1_8 Reverse -284 -303 -6.09707 0.24
NP_442214.1_1 Reverse -164 -183 8.45592 0.298
NP_441105.1_3 Reverse -114 -133 5.01433 0.0734
NP_441105.1_3 Reverse -223 -242 -0.4922 0.137
NP_440216.1_1 Forward -134 -120 6.6861 0.0139
NP_440216.1_1 Reverse -125 -139 -1.47537 0.0328
NP_440216.1_1 Forward -371 -357 -3.83532 0.09
NP_440216.1_9 Forward -230 -221 10.2261 0.286
NP_440172.1_1 Reverse -125 -135 10.9931 0.0445
NP_440172.1_1 Forward -134 -124 7.84651 0.0718
NP_440172.1_1 Reverse -169 -179 2.53664 0.277
NP_442371.1_1 Forward -58 -48 13.2542 0.206
NP_442015.1_10 Forward -138 -125 4.64084 0.166
NP_441226.1_7 Forward -133 -126 14.4934 0.0123
NP_441226.1_7 Reverse -126 -133 14.4934 0.0123
NP_441226.1_7 Forward -146 -139 5.34865 0.289
NP_441111.1_7 Forward -133 -125 18.7023 0.00294
NP_441111.1_7 Reverse -126 -134 8.86921 0.0589
NP_440244.1_1 Forward -94 -75 -9.24366 0.287
NP_441766.1_2 Reverse -125 -134 17.896 0.00297
NP_441766.1_2 Forward -134 -125 9.4395 0.0285
NP_441766.1_9 Forward -301 -282 -0.590531 0.261
NP_442417.1_5 Reverse -125 -139 8.25939 0.164
NP_440416.1_1 Forward -134 -115 4.71934 0.0648
NP_440416.1_9 Forward -141 -122 -5.40875 0.0797
NP_440416.1_9 Forward -378 -359 -17.8968 0.248
NP_440416.1_9 Reverse -118 -137 -18.2901 0.256
NP_443052.1_9 Forward -310 -291 3.34271 0.162
NP_443052.1_9 Forward -282 -263 -2.85214 0.242
NP_443052.1_9 Forward -148 -129 -5.9004 0.274
NP_442154.1_1 Reverse -130 -148 -12.6655 0.217
NP_442154.1_1 Reverse -298 -316 -17.9754 0.273
NP_441430.1_6 Forward -139 -120 11.9958 0.238
NP_440261.1_5 Forward -133 -120 -2.83231 0.0932
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACTATCCCATTTAAAGGAATGGAGCCTGGGCCGTCGTCGGGTGGCTCAGACCTATAATGATCTGTTCCAAGGGGTGGAAGGCATTATTACCCCCACCATCACTGCTGGCCATGTGTTTCACCAATACACCCTGCGGATTTTGAACGGTCAAAGGGACGCCCTCGCTAACGCAATGCAAGGCATGGGGATTAGTACCATGATCTATTACCCTGTGCCCCAGGATCAATTGCCGGTGTACCGGGGTCAGTATGCCCCCAACCCCATCAGCGATCGCCTGGCCACGGAGGTGTTGAGTTTACCCATCTGGCCGGAAATGGAAACCGAAACGGTGCAAACGGTGGCTGAAAAAATTAGCCAGGTTTTACCTAGTTTGTAAACTTCTCCCACCATCAATCATCT

CDS

ATGCCCATGGAAGCCGGACAACAATTCCTCACCCCCGCTGAGTCCCACGCTGTTGATGGGGCCCTGCTCAGTCAGTCGGAAAAGTTTCTCACCCGCCTCACCATTTCTTCCTTCCGGCTTTTGCAAACCATTGCGGCGGAGGAACAATTGGCGATCGCCGACCTCACCCCGGAAATTATCATTGCTTGGTTTGAAAAGGATGCCAAAAGGAAACGGGAGCAGGGGACAGAAAAACCTGTGCTGGATTGGTAG

Protein

MPMEAGQQFLTPAESHAVDGALLSQSEKFLTRLTISSFRLLQTIAAEEQLAIADLTPEIIIAWFEKDAKRKREQGTEKPVLDW