Your browser is old and dusty. Try Google Chrome!

Details for ssr2595

ORF ssr2595
Accession NP_440789.1
Symbol hliB, scpD
Category Adaptations and atypical conditions
Definition high light-inducible polypeptide HliB, CAB/ELIP/HLIP superfamily
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440637.1_7 Reverse -283 -302 9.3409 0.259
NP_442287.1_1 Forward -151 -141 14.0409 0.266
NP_441812.1_1 Forward -132 -118 16.0269 0.193
NP_441054.1_2 Reverse -66 -85 11.1109 0.271
NP_441054.1_2 Forward -390 -371 10.6192 0.284
NP_440761.1_3 Forward -311 -292 15.4592 0.205
NP_441781.1_7 Forward -254 -235 -2.85214 0.289
NP_441492.1_5 Forward -50 -31 4.99194 0.237
NP_442110.1_2 Reverse -138 -151 15.483 0.196
NP_441925.1_4 Reverse -365 -384 -15.7342 0.273
NP_440769.1_8 Reverse -75 -94 7.86593 0.248
NP_441083.1_5 Forward -13 -3 5.38824 0.12
NP_441738.1_2 Forward -251 -244 6.72528 0.236
NP_441444.1_1 Reverse -262 -281 13.9625 0.177
NP_442136.1_1 Forward -79 -60 7.07928 0.265
NP_441713.1_1 Reverse -115 -134 -14.2585 0.257
NP_441025.1_6 Reverse -52 -71 1.82439 0.28
NP_440538.1_10 Forward -160 -141 10.2259 0.279
NP_441327.1_1 Reverse -175 -194 6.13556 0.25
NP_442111.1_4 Reverse -305 -319 3.14618 0.253
NP_441624.1_7 Forward -248 -234 7.9644 0.241
NP_441163.1_7 Forward -160 -141 19.0757 0.135
NP_442145.1_4 Forward -69 -50 12.1748 0.125
NP_442145.1_4 Forward -79 -60 11.1244 0.136
NP_442145.1_4 Reverse -29 -48 2.62561 0.299
NP_442634.1_4 Reverse -2 -16 2.06454 0.147
NP_441667.1_5 Forward -103 -89 16.8237 0.254
NP_440470.1_5 Reverse -62 -81 14.0846 0.158
NP_440842.1_4 Forward -78 -59 10.197 0.0869
NP_440842.1_4 Forward -68 -49 3.3521 0.207
NP_441014.1_10 Reverse -3 -22 1.17865 0.231
NP_441634.1_9 Reverse -131 -150 10.7167 0.252
NP_441857.1_6 Reverse -237 -247 14.1397 0.254
NP_441422.1_7 Forward -384 -367 -1.43612 0.191
NP_442782.1_2 Forward -396 -382 1.17956 0.282
NP_442496.1_5 Forward -166 -148 7.59063 0.256
NP_440184.1_1 Forward -87 -68 13.5949 0.0864
NP_440203.1_5 Forward -251 -241 9.81266 0.245
NP_441162.1_3 Reverse -227 -246 10.5209 0.211
NP_442690.1_1 Reverse -62 -81 -2.36049 0.136
NP_442690.1_1 Reverse -297 -316 -5.50708 0.158
NP_442690.1_1 Reverse -176 -195 -10.7186 0.218
NP_442690.1_1 Reverse -175 -194 -13.2752 0.258
NP_443055.1_6 Forward -158 -140 8.76983 0.141
NP_443055.1_6 Forward -261 -243 -1.06322 0.271
NP_440993.1_5 Forward -24 -6 18.7012 0.101
NP_441646.1_1 Reverse -238 -257 -0.295539 0.26
NP_442771.1_1 Forward -224 -206 0.707465 0.0909
NP_441076.1_3 Reverse -171 -190 11.7 0.2
NP_442281.1_1 Forward -227 -213 5.40719 0.159
NP_001035871.2_7 Reverse -235 -245 14.1397 0.218
NP_440867.1_10 Forward -243 -224 7.07928 0.251
NP_442215.1_2 Forward -256 -240 -6.92296 0.281
NP_442933.1_1 Reverse -264 -283 9.21455 0.253
NP_441751.2_8 Reverse -5 -19 -6.88358 0.289
NP_442142.1_4 Reverse -204 -217 5.91857 0.178
NP_442142.1_4 Reverse -230 -243 2.47701 0.29
NP_442292.1_2 Reverse -179 -193 16.1311 0.269
NP_440511.1_1 Forward -395 -377 6.50899 0.228
NP_443009.1_5 Forward -255 -244 4.77807 0.23
NP_440158.1_1 Forward -56 -37 15.517 0.0997
NP_441020.2_6 Forward -384 -367 9.38028 0.173
NP_441764.1_1 Reverse -51 -70 18.7807 0.0481
NP_441764.1_4 Reverse -49 -66 17.3345 0.0666
NP_441764.1_4 Reverse -59 -76 13.9923 0.154
NP_441764.1_4 Forward -193 -176 11.7005 0.21
NP_441764.1_4 Reverse -39 -56 9.88619 0.273
NP_442719.1_2 Reverse -141 -159 -10.5029 0.276
NP_441612.1_2 Forward -13 -3 15.1326 0.21
NP_442227.1_2 Forward -252 -233 1.17943 0.25
NP_440789.1_1 Forward -68 -49 21.6314 0.0189
NP_440789.1_10 Forward -154 -136 20.9628 0.0543
NP_441911.1_10 Forward -277 -258 9.33025 0.233
NP_442808.1_1 Forward -151 -141 1.25791 0.289
NP_440558.1_2 Forward -134 -115 -2.95047 0.232
NP_440558.1_2 Reverse -327 -346 -7.37537 0.293
NP_440558.1_5 Forward -381 -367 14.8476 0.279
NP_441048.1_6 Forward -82 -68 15.8633 0.296
NP_442789.1_4 Reverse -2 -21 -4.6221 0.261
NP_440923.1_1 Forward -69 -51 27.7476 0.0000545
NP_440923.1_1 Reverse -183 -201 10.7364 0.291
NP_441878.1_6 Reverse -244 -254 -7.39479 0.222
NP_441557.1_8 Reverse -289 -299 15.5158 0.18
NP_441739.1_2 Forward -157 -141 10.5792 0.169
NP_442397.1_9 Forward -157 -138 3.34271 0.264
NP_441819.1_5 Reverse -298 -317 17.8088 0.144
NP_442645.1_2 Reverse -236 -255 -17.7001 0.261
NP_442047.1_2 Forward -240 -226 16.6175 0.161
NP_442317.1_8 Reverse -37 -56 18.3873 0.134
NP_440977.1_5 Forward -304 -291 16.5383 0.18
NP_440709.1_1 Forward -80 -61 15.7316 0.0302
NP_440709.1_1 Forward -70 -51 14.2566 0.0386
NP_440709.1_1 Forward -60 -41 12.1917 0.0464
NP_440709.1_2 Forward -65 -51 23.5 0.000895
NP_442158.1_4 Reverse -110 -120 12.2714 0.253
NP_441199.1_7 Reverse -48 -67 5.50599 0.231
NP_440677.1_1 Reverse -236 -255 8.65258 0.204
NP_441750.1_4 Reverse -221 -240 1.96607 0.272
NP_440622.1_6 Forward -252 -233 15.8299 0.29
NP_441132.1_2 Reverse -89 -108 8.55425 0.163
NP_442251.1_6 Reverse -214 -221 8.10225 0.245
NP_441912.1_3 Reverse -233 -252 7.27595 0.27
NP_440027.1_4 Forward -77 -58 11.4512 0.0706
NP_441167.1_1 Reverse -58 -77 12.2908 0.109
NP_440439.1_1 Forward -384 -371 0.215946 0.199
NP_442239.1_5 Reverse -40 -59 11.3255 0.259
NP_440819.1_5 Forward -279 -271 7.68924 0.266
NP_440316.1_10 Forward -243 -233 13.0581 0.214
NP_440316.1_10 Reverse -237 -247 7.35486 0.251
NP_441877.1_9 Reverse -69 -86 1.41547 0.297
NP_442790.1_4 Forward -391 -372 -7.17871 0.151
NP_442693.1_6 Reverse -366 -385 -0.4922 0.29
NP_440350.1_5 Reverse -272 -291 0.786102 0.158
NP_441896.1_1 Reverse -184 -203 18.8781 0.0528
NP_440999.1_9 Forward -226 -212 -1.8687 0.252
NP_440888.1_2 Forward -234 -220 9.53707 0.123
NP_442077.1_4 Reverse -176 -195 5.80098 0.289
NP_441543.1_2 Reverse -307 -316 6.39124 0.153
NP_442710.1_7 Reverse -54 -73 -1.45616 0.221
NP_442337.1_8 Reverse -130 -149 7.47261 0.191
NP_442337.1_8 Reverse -9 -28 0.982764 0.241
NP_440071.1_6 Reverse -234 -248 13.8049 0.26
NP_440148.1_6 Reverse -73 -87 16.157 0.3
NP_441929.1_6 Reverse -213 -232 4.42435 0.294
NP_442780.1_1 Reverse -53 -72 6.98095 0.291
NP_440454.1_2 Forward -81 -67 10.2293 0.291
NP_441353.1_1 Forward -146 -127 19.2565 0.159
NP_441443.1_1 Forward -297 -278 -5.31042 0.298
NP_441052.1_2 Forward -13 -3 4.10993 0.166
NP_442577.1_9 Forward -154 -140 11.897 0.253
NP_441004.1_2 Forward -384 -365 -2.65548 0.264
NP_440296.1_6 Reverse -66 -84 9.83765 0.298
NP_443054.1_2 Reverse -242 -256 0.982901 0.251
NP_441851.1_10 Reverse -243 -253 6.37155 0.172
NP_441982.1_6 Forward -280 -271 12.1989 0.288
NP_440338.1_4 Forward -81 -62 11.8967 0.15
NP_442689.1_8 Reverse -301 -318 15.0835 0.0681
NP_442689.1_8 Reverse -179 -196 -4.09106 0.26
NP_442689.1_8 Reverse -66 -83 -6.15601 0.28
NP_442689.1_8 Reverse -151 -168 -6.84433 0.289
NP_442843.1_1 Forward -338 -319 -12.0953 0.298
NP_442944.1_10 Reverse -371 -390 8.25926 0.269
NP_441031.1_1 Forward -82 -63 11.161 0.193
NP_441031.1_1 Reverse -56 -75 6.53351 0.267
NP_440483.1_1 Forward -247 -228 -7.27704 0.258
NP_441570.1_1 Reverse -4 -22 0.609134 0.0379
NP_441570.1_1 Reverse -116 -134 -11.2889 0.191
NP_441570.1_6 Forward -251 -232 8.65258 0.0485
NP_441432.1_3 Reverse -214 -233 17.4032 0.244
NP_441432.1_8 Reverse -224 -233 2.55633 0.298
NP_443024.1_3 Reverse -119 -129 10.5014 0.289
NP_441732.1_2 Forward -17 -1 -8.39793 0.138
NP_440629.1_1 Forward -200 -182 10.6389 0.0777
NP_440629.1_1 Reverse -52 -70 7.09898 0.152
NP_442298.1_4 Reverse -71 -85 18.728 0.271
NP_442400.1_10 Forward -92 -79 14.672 0.173
NP_442400.1_10 Forward -194 -181 7.31916 0.29
NP_440713.1_4 Reverse -131 -150 3.14605 0.251
NP_441022.1_1 Forward -84 -75 12.6973 0.232
NP_440363.1_7 Forward -386 -367 19.5296 0.107
NP_439956.1_7 Reverse -130 -149 2.26107 0.275
NP_440545.1_3 Forward -381 -364 -6.15601 0.27
NP_440025.1_3 Reverse -153 -167 12.063 0.269
NP_440250.1_4 Reverse -63 -82 5.89851 0.253
NP_440010.1_3 Forward -245 -226 -6.09707 0.25
NP_442828.1_5 Forward -48 -29 10.815 0.289
NP_441593.1_2 Reverse -86 -105 10.8159 0.183
NP_441329.1_1 Reverse -37 -56 12.7478 0.175
NP_441329.1_1 Reverse -182 -201 4.72643 0.281
NP_441329.1_3 Forward -89 -79 14.8103 0.25
NP_440671.1_1 Reverse -59 -78 9.76781 0.191
NP_440671.1_6 Forward -152 -133 13.2733 0.226
NP_440772.1_8 Reverse -360 -379 8.84924 0.253
NP_442723.1_1 Forward -257 -238 3.73524 0.278
NP_442897.1_3 Reverse -3 -22 22.9106 0.0129
NP_440604.1_6 Reverse -213 -232 -3.83545 0.235
NP_441508.1_1 Reverse -52 -71 19.3036 0.0922
NP_441508.1_1 Reverse -62 -81 16.5164 0.101
NP_441508.1_1 Forward -76 -57 12.3837 0.23
NP_442629.1_5 Reverse -111 -125 15.1426 0.279
NP_441541.1_7 Forward -88 -70 12.7678 0.218
NP_442216.1_4 Forward -252 -244 15.3586 0.255
NP_443035.1_10 Forward -240 -223 5.74204 0.273
NP_440675.1_4 Reverse -144 -163 11.2092 0.299
NP_442465.1_2 Reverse -277 -296 1.86696 0.259
NP_441474.1_1 Forward -120 -101 -2.75457 0.285
NP_442402.1_4 Reverse -262 -281 -8.75273 0.284
NP_442402.1_6 Reverse -241 -250 15.4377 0.241
NP_442402.1_6 Forward -300 -291 14.1594 0.241
NP_441848.1_4 Reverse -166 -182 8.60108 0.288
NP_441848.1_7 Forward -185 -166 -2.16459 0.262
NP_440696.1_3 Reverse -131 -149 -2.24246 0.274
NP_442679.1_1 Forward -292 -273 -2.85214 0.244
NP_440160.1_1 Reverse -47 -66 11.969 0.205
NP_440160.1_9 Reverse -233 -252 9.73422 0.235
NP_440505.1_1 Forward -238 -221 18.5243 0.273
NP_440505.1_3 Forward -299 -289 5.09324 0.246
NP_440505.1_7 Forward -384 -365 -0.885524 0.271
NP_442360.1_5 Reverse -239 -249 13.1564 0.289
NP_440548.1_3 Reverse -116 -135 18.1907 0.133
NP_440914.1_1 Reverse -245 -255 8.41992 0.191
NP_441482.1_7 Reverse -207 -221 -9.83351 0.209
NP_441697.1_5 Forward -73 -54 -6.54162 0.232
NP_441697.1_5 Forward -83 -64 -7.01908 0.239
NP_440816.1_2 Forward -88 -69 6.82221 0.27
NP_441028.1_6 Reverse -271 -281 12.0743 0.192
NP_442664.1_3 Reverse -128 -142 10.226 0.291
NP_441527.1_4 Forward -276 -257 -8.06949 0.24
NP_441527.1_4 Forward -51 -32 -9.2154 0.255
NP_441527.1_4 Forward -284 -265 -9.69285 0.261
NP_440115.1_6 Reverse -365 -375 8.82982 0.125
NP_441106.1_3 Forward -70 -51 19.174 0.0559
NP_441106.1_3 Reverse -68 -87 16.7157 0.103
NP_441106.1_3 Forward -80 -61 11.6025 0.217
NP_439903.1_6 Forward -225 -206 0.588665 0.259
NP_439903.1_6 Forward -257 -238 -0.492971 0.282
NP_439903.1_6 Reverse -1 -20 -1.27961 0.295
NP_441186.1_4 Forward -88 -78 15.3192 0.238
NP_440205.1_9 Forward -174 -156 16.3413 0.2
NP_439899.1_1 Reverse -48 -66 9.73552 0.165
NP_439899.1_1 Reverse -38 -56 4.28466 0.268
NP_442295.1_7 Reverse -373 -391 16.6363 0.289
NP_441427.1_1 Forward -388 -369 7.17762 0.263
NP_440907.2_8 Reverse -369 -379 3.8145 0.297
NP_441463.1_2 Reverse -66 -84 8.05944 0.14
NP_441962.1_4 Reverse -368 -387 -11.9969 0.25
NP_440358.1_8 Reverse -114 -133 5.40766 0.189
NP_440935.1_3 Reverse -18 -37 16.7157 0.167
NP_440293.1_3 Forward -384 -365 -6.88371 0.294
NP_442930.1_1 Forward -183 -173 15.5158 0.199
NP_442930.1_1 Reverse -175 -185 9.22267 0.289
NP_440502.1_3 Reverse -290 -300 16.3223 0.1
NP_440457.1_1 Forward -381 -369 1.51394 0.236
NP_440054.1_4 Forward -30 -11 11.1109 0.22
NP_441436.1_8 Forward -397 -378 8.94757 0.275
NP_441489.1_3 Forward -89 -75 8.89237 0.232
NP_442582.1_3 Forward -81 -67 14.7174 0.21
NP_442936.1_10 Reverse -172 -186 10.8908 0.23
NP_442936.1_10 Forward -186 -172 7.92401 0.27
NP_441275.1_1 Forward -69 -51 10.7372 0.0571
NP_440507.2_3 Reverse -204 -223 13.47 0.145
NP_440552.1_8 Forward -56 -39 14.9489 0.141
NP_440552.1_8 Forward -66 -49 9.79232 0.287
NP_441397.1_3 Reverse -44 -63 12.1917 0.293
NP_441389.1_5 Forward -291 -272 10.0292 0.286
NP_441207.1_7 Forward -84 -70 7.90002 0.293
NP_440175.1_7 Reverse -131 -149 14.9258 0.13
NP_440216.1_9 Forward -138 -129 5.70292 0.29
NP_440172.1_1 Reverse -213 -223 2.92996 0.258
NP_442116.1_2 Forward -142 -123 12.4867 0.289
NP_442564.1_10 Forward -217 -203 13.2743 0.244
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTTGGGAAACGGTTTGCAGCGGTTGGGTCGCCTGCATTACTATGACGGACTCCTGGCACACGAAATGGGACGCACTTCTGGTCAGTTTATAGCAAAAATGCTGGGGAAAGGAAGACAACTAGGGAAAAAGAACAGGACATCAAATGGTCATTCCCCAGACCCTGGCGTCTTTGCCAGAGTAATCTCCCTGGCGCGGATGTTACACAAATGTAACGAAAAATATTTTCCCTCTCAGAATTTAGGCAAAGTGCCCAAACCCATCCTAGGCAAGCAATTCGTCCACCAACAAAAAGCTCTTTTGGTCAACAGACTTGACAAAAATCTTAACAATACGTTACATTTATTTACATAAGGTTACAAAATAAAAACCTCAAATACCCAATCAAGGAGATCAACACT

CDS

ATGACTAGCCGCGGATTTCGCCTCGACCAAGACAACCGTCTCAACAACTTCGCCATTGAACCCCCTGTGTACGTTGACAGCAGTGTTCAAGCCGGTTGGACTGAATACGCCGAAAAAATGAATGGTCGTTTTGCCATGATTGGCTTTGTTTCTCTCTTGGCAATGGAAGTAATTACTGGCCACGGCATTGTGGGTTGGTTGCTCTCTCTCTAA

Protein

MTSRGFRLDQDNRLNNFAIEPPVYVDSSVQAGWTEYAEKMNGRFAMIGFVSLLAMEVITGHGIVGWLLSL