Your browser is old and dusty. Try Google Chrome!

Details for ssr2549

ORF ssr2549
Accession NP_441344.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -290 -304 11.701 0.0507
NP_440795.1_7 Reverse -40 -47 11.3472 0.0978
NP_440795.1_7 Forward -47 -40 5.74231 0.279
NP_442291.1_5 Reverse -38 -54 -3.57971 0.245
NP_441453.1_4 Reverse -39 -47 6.80426 0.121
NP_442328.1_9 Forward -346 -327 13.6675 0.0597
NP_441818.1_1 Reverse -40 -51 16.6761 0.0128
NP_440226.1_1 Forward -48 -29 5.01433 0.17
NP_441519.1_7 Forward -85 -66 22.2223 0.0367
NP_442655.1_10 Reverse -223 -242 -12.3902 0.261
NP_443002.1_5 Forward -304 -286 14.6697 0.196
NP_442173.1_1 Forward -47 -39 5.62429 0.206
NP_442173.1_1 Reverse -40 -48 4.54265 0.27
NP_442752.1_4 Reverse -39 -46 15.0838 0.0199
NP_442752.1_4 Forward -115 -108 5.54565 0.194
NP_443027.1_4 Reverse -37 -47 10.0098 0.144
NP_442975.1_10 Reverse -11 -25 10.422 0.0553
NP_442975.1_10 Reverse -184 -198 3.8339 0.252
NP_440784.1_7 Reverse -40 -47 6.43063 0.218
NP_440784.1_7 Forward -47 -40 6.23397 0.241
NP_442289.1_4 Reverse -31 -47 10.5799 0.288
NP_440061.1_9 Forward -40 -26 5.99717 0.264
NP_440878.1_9 Forward -92 -73 -2.0655 0.258
NP_441499.1_5 Forward -85 -71 13.0776 0.284
NP_442062.1_3 Forward -273 -254 -1.57384 0.26
NP_442062.1_8 Reverse -39 -49 13.648 0.0206
NP_442062.1_8 Forward -82 -72 9.02648 0.069
NP_442062.1_8 Forward -38 -28 8.73149 0.0721
NP_441900.1_2 Reverse -212 -230 -4.89811 0.288
NP_441802.1_1 Forward -296 -277 8.65258 0.22
NP_440044.1_8 Forward -81 -62 -3.83545 0.292
NP_441781.1_7 Reverse -39 -58 -1.18052 0.27
NP_441035.1_3 Forward -85 -66 -0.983855 0.298
NP_442434.1_2 Forward -127 -109 17.6204 0.164
NP_441594.1_6 Forward -139 -120 4.62101 0.216
NP_441594.1_6 Forward -57 -38 0.58944 0.282
NP_440518.1_9 Reverse -93 -112 7.96426 0.296
NP_442367.1_1 Forward -83 -64 -11.1119 0.264
NP_441925.1_4 Reverse -37 -56 -7.96609 0.203
NP_441083.1_5 Reverse -39 -49 0.0783647 0.245
NP_441083.1_5 Forward -48 -38 -0.216628 0.261
NP_441738.1_2 Forward -46 -39 11.7401 0.0647
NP_441558.1_5 Forward -385 -366 13.5691 0.057
NP_440209.1_1 Reverse -39 -47 8.37755 0.0576
NP_442765.1_1 Forward -168 -149 6.98095 0.288
NP_442765.1_2 Forward -246 -227 21.3373 0.0146
NP_442765.1_6 Forward -339 -320 25.1722 0.00985
NP_442889.1_8 Forward -133 -119 3.24392 0.284
NP_442889.1_8 Forward -85 -71 3.24392 0.284
NP_441713.1_1 Reverse -33 -52 -16.9135 0.289
NP_442570.1_3 Reverse -37 -56 2.16274 0.189
NP_441716.1_1 Forward -338 -324 12.9793 0.0689
NP_441327.1_5 Reverse -90 -99 12.7828 0.29
NP_442111.1_3 Forward -181 -168 13.6216 0.261
NP_442111.1_4 Forward -49 -35 7.76774 0.0867
NP_442111.1_4 Reverse -328 -342 3.53951 0.24
NP_441624.1_7 Reverse -290 -304 8.35772 0.24
NP_440906.1_5 Reverse -40 -47 12.6255 0.0384
NP_440906.1_5 Forward -47 -40 6.0373 0.262
NP_440747.1_10 Reverse -36 -48 -2.4193 0.0434
NP_440403.1_4 Forward -124 -105 -5.60541 0.22
NP_442848.1_5 Reverse -72 -90 -2.83245 0.286
NP_441012.1_4 Reverse -184 -197 7.29578 0.272
NP_439978.1_2 Reverse -250 -269 15.4366 0.186
NP_443018.1_3 Forward -382 -375 9.38056 0.128
NP_443018.1_3 Reverse -40 -47 5.15232 0.226
NP_443018.1_3 Forward -47 -40 5.05399 0.238
NP_441634.1_8 Reverse -71 -85 -3.34366 0.295
NP_440376.1_1 Reverse -39 -48 7.17789 0.0829
NP_440376.1_1 Forward -82 -73 4.32629 0.163
NP_440376.1_1 Forward -48 -39 -0.196935 0.285
NP_443065.1_6 Reverse -35 -54 12.5858 0.139
NP_442687.1_7 Forward -339 -329 4.69992 0.238
NP_442687.1_7 Forward -116 -106 3.91327 0.278
NP_442191.1_4 Reverse -30 -44 17.1014 0.0243
NP_442191.1_4 Forward -47 -33 16.2288 0.0423
NP_442485.1_3 Forward -59 -40 -1.67217 0.26
NP_441422.1_3 Forward -120 -101 14.903 0.256
NP_442296.1_6 Reverse -30 -49 21.0414 0.0814
NP_442720.1_8 Reverse -298 -316 13.1955 0.297
NP_442658.1_1 Forward -50 -40 8.73102 0.181
NP_442658.1_1 Reverse -37 -47 7.35439 0.214
NP_442544.1_2 Reverse -113 -127 -1.27871 0.272
NP_440800.1_7 Reverse -290 -304 10.226 0.294
NP_441478.1_4 Forward -71 -52 16.3224 0.104
NP_442321.1_1 Reverse -55 -74 -7.76869 0.273
NP_442321.1_4 Reverse -358 -377 -7.57203 0.284
NP_441958.1_5 Forward -49 -39 0.865012 0.12
NP_441958.1_5 Reverse -38 -48 -6.60814 0.283
NP_441127.1_1 Reverse -128 -142 10.0294 0.262
NP_440203.1_5 Forward -302 -292 12.1726 0.164
NP_439990.1_5 Forward -43 -30 7.00078 0.218
NP_442376.1_2 Forward -53 -34 -11.4069 0.286
NP_442376.1_2 Forward -343 -324 -13.3736 0.292
NP_440369.1_5 Forward -131 -112 11.2092 0.251
NP_441941.1_9 Reverse -356 -375 -1.67217 0.298
NP_440993.1_4 Forward -82 -65 2.39878 0.3
NP_441646.1_1 Reverse -66 -85 6.19431 0.173
NP_442438.1_10 Forward -53 -39 8.65272 0.0749
NP_441000.1_6 Forward -49 -35 6.6861 0.0933
NP_442771.1_1 Reverse -327 -345 2.67408 0.0677
NP_442771.1_1 Reverse -37 -55 -6.56903 0.168
NP_440147.1_4 Reverse -327 -340 -0.275709 0.279
NP_440206.1_9 Reverse -51 -70 7.96426 0.279
NP_441041.1_4 Forward -376 -357 -10.9153 0.238
NP_441041.1_4 Forward -130 -111 -11.9969 0.256
NP_441041.1_7 Forward -51 -39 10.2357 0.1
NP_442004.1_6 Reverse -39 -53 3.14618 0.248
NP_440703.1_9 Forward -298 -285 8.77016 0.226
NP_441725.1_5 Reverse -40 -50 10.0098 0.0381
NP_439966.1_7 Reverse -37 -47 8.23937 0.14
NP_439966.1_7 Forward -50 -40 4.01116 0.295
NP_440202.1_8 Reverse -30 -49 16.9065 0.192
NP_442941.1_3 Forward -47 -37 1.25834 0.15
NP_442941.1_3 Reverse -40 -50 -0.314959 0.256
NP_440289.1_2 Forward -51 -38 -2.93064 0.262
NP_440289.1_2 Reverse -36 -49 -4.79893 0.294
NP_440983.1_5 Forward -389 -370 -2.75381 0.231
NP_440260.1_8 Reverse -112 -130 -4.11075 0.264
NP_440260.1_8 Reverse -280 -298 -6.4707 0.291
NP_441079.1_1 Forward -54 -35 17.6007 0.2
NP_440437.1_1 Reverse -33 -52 -4.03212 0.248
NP_442012.1_1 Forward -121 -102 7.7676 0.108
NP_443030.1_3 Forward -54 -36 3.75572 0.298
NP_441644.1_6 Forward -130 -120 7.45273 0.124
NP_441644.1_6 Reverse -39 -49 3.51951 0.277
NP_443049.1_1 Forward -392 -373 15.3391 0.29
NP_442215.1_2 Forward -307 -291 -1.41643 0.185
NP_442215.1_2 Reverse -26 -42 -6.23465 0.266
NP_442029.1_6 Reverse -24 -43 2.65439 0.291
NP_440929.1_8 Reverse -39 -48 7.66954 0.0624
NP_440929.1_8 Forward -48 -39 7.57121 0.0706
NP_441751.2_8 Reverse -40 -54 3.24451 0.0692
NP_441751.2_8 Forward -47 -33 -3.63866 0.152
NP_441751.2_8 Forward -337 -323 -6.88358 0.289
NP_442554.1_8 Forward -47 -37 4.3066 0.189
NP_442554.1_8 Reverse -375 -385 3.22496 0.235
NP_442554.1_8 Reverse -40 -50 2.04498 0.285
NP_441762.1_7 Forward -49 -37 -5.76255 0.238
NP_442292.1_1 Forward -47 -38 -0.196935 0.239
NP_442292.1_1 Reverse -40 -49 -0.393597 0.245
NP_442476.1_6 Forward -47 -33 6.29277 0.13
NP_443009.1_5 Forward -49 -38 9.49793 0.0962
NP_443009.1_5 Reverse -38 -49 6.1547 0.173
NP_442250.1_6 Forward -354 -335 9.24257 0.274
NP_442406.1_9 Reverse -367 -386 -0.4922 0.291
NP_442301.1_2 Reverse -178 -197 6.48849 0.263
NP_441715.1_4 Forward -47 -37 10.3048 0.097
NP_441198.1_8 Forward -50 -40 11.4158 0.207
NP_441468.1_1 Reverse -40 -47 12.3305 0.0592
NP_441468.1_1 Forward -47 -40 6.0373 0.223
NP_441015.1_10 Forward -309 -290 -10.3253 0.284
NP_441673.1_1 Reverse -39 -48 1.37636 0.114
NP_441673.1_1 Forward -48 -39 1.1797 0.163
NP_441673.1_1 Reverse -73 -82 -8.06341 0.254
NP_442253.1_5 Forward -85 -68 -2.02611 0.276
NP_442253.1_5 Reverse -352 -369 -3.8944 0.292
NP_440265.1_7 Reverse -57 -71 14.4536 0.287
NP_442868.1_6 Reverse -37 -47 0.57002 0.217
NP_442719.1_2 Reverse -130 -148 -10.5029 0.276
NP_441056.1_1 Reverse -39 -58 -8.26035 0.282
NP_442559.1_3 Forward -387 -368 8.35759 0.285
NP_442808.1_1 Reverse -38 -48 6.17443 0.126
NP_441101.1_10 Reverse -35 -54 -7.17871 0.29
NP_442775.1_6 Forward -376 -357 9.93088 0.285
NP_440031.1_9 Forward -292 -273 7.07928 0.296
NP_440145.1_3 Reverse -29 -48 5.01433 0.0728
NP_442113.1_10 Forward -86 -67 -6.88371 0.265
NP_442050.1_5 Forward -50 -40 12.2709 0.0671
NP_441114.1_3 Reverse -30 -39 7.66954 0.231
NP_440558.1_2 Forward -57 -38 6.68596 0.13
NP_441498.1_3 Reverse -169 -187 6.99988 0.278
NP_441048.1_4 Reverse -338 -357 11.0125 0.266
NP_442688.1_4 Reverse -329 -348 13.7658 0.19
NP_441878.1_6 Forward -49 -39 0.57002 0.14
NP_441878.1_6 Reverse -72 -82 -7.19813 0.21
NP_441878.1_6 Forward -339 -329 -7.59145 0.245
NP_441878.1_6 Forward -83 -73 -7.78811 0.266
NP_441036.1_8 Reverse -38 -48 7.35486 0.201
NP_442650.1_2 Reverse -67 -81 2.5562 0.261
NP_441557.1_5 Forward -48 -39 7.57121 0.049
NP_441557.1_5 Reverse -39 -48 1.08137 0.0794
NP_441557.1_8 Reverse -107 -117 11.9759 0.236
NP_441445.1_1 Forward -347 -328 -0.000545616 0.283
NP_442183.1_1 Reverse -39 -53 8.55439 0.113
NP_441116.1_9 Reverse -92 -106 12.8809 0.246
NP_442347.1_2 Forward -47 -38 14.356 0.056
NP_442645.1_2 Forward -56 -37 -15.6352 0.206
NP_441037.1_4 Forward -50 -40 6.34312 0.267
NP_441633.1_3 Reverse -119 -132 9.2624 0.0377
NP_441633.1_3 Reverse -71 -84 -1.75067 0.163
NP_441633.1_3 Reverse -37 -50 -4.11062 0.181
NP_440136.1_2 Reverse -40 -47 13.7071 0.0244
NP_440136.1_2 Forward -47 -40 6.13563 0.193
NP_442590.1_10 Reverse -32 -51 3.24438 0.294
NP_442998.1_5 Forward -293 -283 9.81313 0.233
NP_442998.1_5 Reverse -91 -101 9.41981 0.241
NP_442998.1_5 Forward -181 -171 8.04317 0.274
NP_442998.1_10 Forward -46 -39 5.74231 0.255
NP_441559.1_4 Reverse -119 -138 9.3409 0.102
NP_441559.1_8 Reverse -34 -48 9.14437 0.067
NP_441559.1_8 Forward -43 -29 2.16287 0.147
NP_441559.1_8 Forward -359 -345 -2.26202 0.19
NP_440915.1_6 Reverse -35 -49 5.40779 0.0903
NP_440695.1_6 Forward -21 -7 9.34482 0.288
NP_442993.1_1 Reverse -39 -55 -7.0213 0.146
NP_442993.1_1 Reverse -73 -89 -9.28291 0.181
NP_442386.1_9 Reverse -38 -47 14.1589 0.0289
NP_442386.1_9 Reverse -28 -37 6.29249 0.226
NP_442386.1_9 Reverse -72 -81 5.9975 0.23
NP_440570.1_5 Forward -387 -368 -1.18052 0.266
NP_441340.1_5 Reverse -40 -47 5.93897 0.198
NP_441340.1_5 Forward -47 -40 5.84064 0.208
NP_442240.1_2 Forward -47 -28 -12.1936 0.159
NP_441912.1_3 Reverse -56 -75 13.1758 0.27
NP_440027.1_3 Reverse -29 -47 11.0314 0.159
NP_443051.1_1 Forward -49 -40 6.19458 0.0849
NP_443051.1_1 Reverse -38 -47 0.688044 0.134
NP_439984.1_10 Reverse -177 -191 10.9137 0.253
NP_439937.1_8 Forward -372 -353 -4.13045 0.278
NP_439937.1_9 Forward -116 -99 -16.5797 0.287
NP_442294.1_3 Reverse -210 -224 13.4703 0.269
NP_440439.1_1 Reverse -36 -49 12.2123 0.0269
NP_440372.1_2 Reverse -40 -47 6.62729 0.151
NP_440372.1_2 Forward -47 -40 6.52896 0.188
NP_440171.1_2 Forward -340 -326 18.1809 0.258
NP_439977.1_5 Reverse -33 -52 -2.65548 0.287
NP_441572.1_7 Forward -54 -35 -3.44213 0.212
NP_440267.1_2 Forward -53 -39 5.30886 0.272
NP_442384.1_10 Forward -48 -35 7.29578 0.0844
NP_442384.1_10 Reverse -29 -42 6.21414 0.108
NP_441877.1_1 Forward -312 -293 15.1424 0.289
NP_442262.1_10 Forward -382 -375 9.47889 0.187
NP_440344.1_10 Forward -55 -38 -10.9742 0.197
NP_440344.1_10 Forward -137 -120 -13.8258 0.296
NP_440282.1_3 Reverse -363 -382 -1.96717 0.298
NP_442065.1_2 Forward -80 -67 16.8333 0.198
NP_442556.1_1 Forward -300 -281 13.2741 0.199
NP_440297.1_8 Reverse -379 -397 10.1472 0.293
NP_440297.1_9 Reverse -40 -50 9.61647 0.0917
NP_442280.1_10 Reverse -111 -129 7.88944 0.268
NP_440888.1_2 Reverse -368 -382 9.83206 0.113
NP_440888.1_2 Forward -82 -68 5.30886 0.284
NP_440822.1_8 Forward -381 -362 10.9142 0.241
NP_441759.1_6 Reverse -371 -390 9.73422 0.257
NP_441917.1_2 Forward -199 -181 4.9357 0.288
NP_441543.1_2 Forward -47 -38 8.84951 0.0968
NP_441469.1_8 Forward -49 -40 13.5694 0.073
NP_441469.1_8 Reverse -38 -47 6.78456 0.227
NP_442578.1_7 Forward -47 -40 5.15232 0.291
NP_440220.1_4 Reverse -7 -26 -1.57461 0.264
NP_441462.1_2 Reverse -39 -49 1.55333 0.0864
NP_441621.1_7 Forward -50 -36 -4.52363 0.232
NP_443062.1_1 Forward -48 -30 17.0291 0.027
NP_443062.1_6 Forward -362 -343 15.1424 0.0782
NP_443062.1_6 Reverse -65 -84 6.98095 0.178
NP_440504.1_7 Reverse -67 -86 -5.11376 0.297
NP_442487.1_5 Reverse -28 -47 8.55343 0.198
NP_440516.1_8 Reverse -39 -48 -0.196935 0.185
NP_442428.1_5 Forward -47 -40 12.3305 0.0493
NP_442428.1_5 Reverse -40 -47 6.3323 0.193
NP_442859.1_2 Forward -47 -28 3.04771 0.262
NP_440618.1_1 Forward -344 -325 -11.5053 0.297
NP_442120.1_10 Reverse -362 -381 -7.67036 0.222
NP_441867.1_2 Forward -63 -44 -12.1936 0.253
NP_440865.1_9 Forward -54 -35 -7.57203 0.247
NP_441052.1_2 Reverse -329 -339 0.766681 0.256
NP_441052.1_2 Forward -48 -38 0.0783647 0.263
NP_442219.1_9 Forward -47 -38 5.40793 0.166
NP_440436.1_4 Forward -47 -38 15.2406 0.00746
NP_440436.1_4 Forward -65 -56 4.81753 0.239
NP_441884.1_9 Forward -133 -114 -21.24 0.235
NP_441884.1_9 Forward -85 -66 -22.42 0.278
NP_440648.1_5 Forward -70 -51 19.764 0.171
NP_441086.1_3 Forward -189 -170 7.57817 0.27
NP_441719.1_4 Reverse -40 -47 6.62729 0.151
NP_441719.1_4 Forward -47 -40 6.52896 0.188
NP_441733.1_10 Forward -51 -38 8.47575 0.14
NP_441004.1_1 Forward -370 -351 -17.1101 0.289
NP_442366.1_3 Forward -306 -288 -2.63579 0.231
NP_442873.1_9 Reverse -354 -373 4.62021 0.287
NP_442694.1_4 Reverse -212 -221 12.1928 0.257
NP_443054.1_2 Reverse -71 -85 11.2093 0.0761
NP_443054.1_2 Forward -379 -365 -0.492064 0.295
NP_441851.1_10 Reverse -38 -48 14.533 0.0146
NP_441851.1_10 Forward -49 -39 14.0414 0.0235
NP_441851.1_10 Forward -39 -29 4.40493 0.271
NP_442208.1_5 Forward -307 -288 -7.27704 0.27
NP_442208.1_5 Forward -90 -71 -9.83364 0.295
NP_441396.1_5 Forward -61 -52 9.4395 0.205
NP_440593.1_3 Reverse -62 -81 -6.09707 0.27
NP_441982.1_6 Forward -183 -174 11.6259 0.288
NP_441349.1_10 Reverse -63 -82 -6.78538 0.236
NP_440432.1_9 Reverse -107 -122 -4.445 0.209
NP_442450.1_5 Forward -50 -40 8.73149 0.125
NP_440588.1_2 Forward -392 -373 -6.39206 0.28
NP_440588.1_3 Forward -315 -296 8.84924 0.293
NP_440195.1_5 Forward -88 -69 1.37609 0.288
NP_442006.1_2 Forward -224 -207 -16.8741 0.265
NP_441003.1_9 Reverse -280 -299 3.93269 0.291
NP_440483.1_1 Reverse -369 -388 0.884433 0.189
NP_441570.1_1 Forward -130 -112 -11.1906 0.189
NP_441570.1_1 Forward -54 -36 -15.3205 0.229
NP_440078.1_10 Reverse -29 -48 4.12936 0.254
NP_441078.1_4 Forward -48 -39 7.27622 0.0764
NP_441078.1_4 Reverse -39 -48 0.196389 0.205
NP_441078.1_4 Reverse -329 -338 -1.18024 0.237
NP_441078.1_4 Reverse -73 -82 -1.27858 0.246
NP_442348.1_2 Forward -83 -74 7.96454 0.28
NP_442443.1_1 Forward -61 -42 -2.85214 0.264
NP_441094.1_6 Reverse -236 -253 7.21627 0.281
NP_441432.1_8 Reverse -72 -81 5.60459 0.147
NP_441432.1_8 Reverse -295 -304 2.65466 0.292
NP_440313.1_5 Reverse -20 -38 13.883 0.214
NP_442797.1_7 Reverse -38 -56 -0.669169 0.284
NP_440131.1_4 Reverse -367 -386 10.2259 0.243
NP_440578.1_10 Reverse -281 -300 9.43923 0.286
NP_440713.1_4 Reverse -370 -389 4.71934 0.223
NP_442489.1_7 Reverse -39 -48 0.688044 0.152
NP_442489.1_7 Forward -48 -39 0.491382 0.178
NP_442489.1_7 Reverse -73 -82 -1.27858 0.185
NP_442489.1_7 Forward -338 -329 -1.77023 0.247
NP_442489.1_7 Forward -82 -73 -1.77023 0.247
NP_440559.1_1 Reverse -40 -49 6.68623 0.134
NP_442763.1_1 Forward -60 -41 10.2259 0.245
NP_441659.2_8 Reverse -39 -49 6.27322 0.0797
NP_440426.1_7 Forward -243 -224 8.75091 0.18
NP_441022.1_1 Forward -178 -169 13.2728 0.216
NP_441040.1_5 Reverse -34 -53 12.7825 0.148
NP_439956.1_7 Reverse -232 -251 11.1109 0.228
NP_439956.1_7 Reverse -23 -42 0.884433 0.294
NP_440708.1_6 Forward -70 -51 -9.44032 0.266
NP_440118.1_5 Reverse -165 -184 -2.55715 0.279
NP_440545.1_3 Forward -342 -325 2.39878 0.102
NP_440831.1_3 Reverse -112 -131 5.61052 0.28
NP_440459.1_2 Forward -385 -368 14.0018 0.119
NP_440010.1_3 Forward -382 -363 -8.16202 0.294
NP_441943.1_8 Forward -20 -1 -4.91709 0.231
NP_441888.1_7 Forward -43 -29 9.5377 0.144
NP_441948.1_4 Forward -55 -37 0.412472 0.136
NP_441047.1_2 Reverse -88 -107 -3.54046 0.298
NP_441833.1_4 Reverse -40 -47 6.43063 0.125
NP_441833.1_4 Forward -47 -40 6.13563 0.198
NP_442699.1_8 Forward -300 -281 -4.13045 0.238
NP_442162.1_9 Reverse -40 -47 6.52896 0.178
NP_442162.1_9 Forward -47 -40 6.43063 0.208
NP_442199.1_5 Reverse -333 -352 -7.37537 0.293
NP_442140.1_3 Forward -382 -372 10.3048 0.0902
NP_442140.1_3 Forward -47 -37 4.40493 0.243
NP_442723.1_1 Reverse -358 -377 4.81688 0.276
NP_440875.1_9 Forward -46 -36 13.5309 0.0677
NP_440875.1_9 Reverse -31 -41 9.3454 0.233
NP_441813.1_5 Reverse -37 -47 9.7148 0.0241
NP_441813.1_5 Forward -50 -40 5.48657 0.123
NP_440590.1_4 Forward -47 -34 -4.20895 0.258
NP_442497.1_10 Reverse -40 -49 8.25953 0.047
NP_442497.1_10 Forward -47 -38 0.589713 0.153
NP_440821.1_4 Forward -50 -40 9.41981 0.0286
NP_440821.1_4 Reverse -37 -47 7.05986 0.0753
NP_441239.1_9 Forward -385 -373 9.97041 0.0912
NP_441239.1_9 Reverse -37 -49 9.77374 0.0972
NP_441239.1_9 Forward -50 -38 4.46387 0.253
NP_441009.1_4 Forward -388 -369 11.5042 0.254
NP_442568.1_1 Reverse -347 -366 4.81688 0.267
NP_440665.1_1 Forward -389 -370 4.52268 0.141
NP_442270.1_9 Forward -375 -356 -3.3438 0.182
NP_441017.1_6 Forward -302 -288 13.372 0.195
NP_440354.1_5 Reverse -41 -60 2.65439 0.251
NP_441617.1_6 Reverse -283 -302 -2.85214 0.258
NP_442052.1_8 Forward -254 -244 14.4347 0.253
NP_442809.1_6 Forward -304 -285 2.55606 0.265
NP_440462.1_6 Reverse -37 -47 15.5163 0.0142
NP_440868.1_2 Reverse -291 -305 19.2345 0.113
NP_440868.1_4 Reverse -35 -47 7.90546 0.0637
NP_441582.1_5 Reverse -71 -90 8.16011 0.164
NP_441269.1_6 Forward -197 -179 11.7205 0.292
NP_440812.1_10 Forward -60 -47 21.1604 0.108
NP_442402.1_10 Reverse -48 -58 13.8442 0.182
NP_441848.1_4 Reverse -86 -102 11.9433 0.213
NP_441848.1_4 Forward -186 -170 9.4605 0.283
NP_440653.1_10 Forward -382 -363 11.5042 0.129
NP_439942.1_7 Forward -68 -49 1.67108 0.19
NP_440696.1_3 Forward -48 -30 -0.275845 0.243
NP_442039.1_4 Forward -47 -40 11.6422 0.0747
NP_441811.1_8 Forward -54 -40 6.09611 0.287
NP_442679.1_1 Reverse -78 -97 -3.44213 0.255
NP_440825.1_2 Reverse -336 -355 18.4857 0.0707
NP_442837.1_3 Reverse -40 -47 12.8221 0.0384
NP_442837.1_3 Forward -47 -40 12.4288 0.0594
NP_440160.1_9 Forward -305 -286 11.6025 0.216
NP_442053.1_1 Reverse -39 -48 5.99792 0.153
NP_440505.1_3 Reverse -37 -47 15.123 0.014
NP_440505.1_3 Forward -117 -107 4.3066 0.3
NP_441011.1_8 Forward -47 -38 13.3727 0.0328
NP_440303.1_1 Reverse -236 -255 10.0292 0.281
NP_442533.1_6 Forward -48 -39 6.68623 0.105
NP_442541.1_10 Forward -82 -68 3.34225 0.254
NP_442232.1_3 Forward -56 -37 -11.7019 0.282
NP_442322.1_4 Reverse -180 -197 -8.61494 0.286
NP_441482.1_7 Reverse -33 -47 -10.6202 0.211
NP_439944.1_9 Reverse -40 -50 5.38824 0.254
NP_442203.1_1 Forward -272 -258 13.9534 0.282
NP_441028.1_6 Reverse -286 -296 5.19112 0.265
NP_441028.1_6 Forward -98 -88 4.7978 0.277
NP_441527.1_7 Forward -106 -87 11.5033 0.282
NP_441059.1_2 Reverse -225 -244 -8.26035 0.299
NP_440608.1_6 Forward -129 -110 4.91521 0.256
NP_441972.1_5 Reverse -46 -65 -2.85214 0.192
NP_441106.1_1 Reverse -38 -47 8.45619 0.0548
NP_439903.1_1 Forward -361 -342 3.04771 0.214
NP_441286.1_1 Reverse -38 -50 -4.48425 0.161
NP_441286.1_1 Reverse -120 -132 -6.05754 0.245
NP_440670.1_8 Reverse -39 -48 6.5879 0.11
NP_440670.1_8 Forward -48 -39 5.50626 0.152
NP_441930.1_2 Forward -54 -44 11.2881 0.298
NP_440083.1_2 Forward -379 -360 3.53937 0.154
NP_442614.1_2 Reverse -39 -53 14.1593 0.104
NP_440907.2_8 Forward -47 -37 6.96107 0.138
NP_440907.2_8 Reverse -107 -117 5.87944 0.184
NP_440907.2_8 Reverse -40 -50 4.99446 0.228
NP_440907.2_8 Reverse -330 -340 3.8145 0.297
NP_441021.1_1 Reverse -40 -59 -5.9004 0.177
NP_441463.1_3 Reverse -291 -310 -8.94866 0.276
NP_441463.1_6 Reverse -293 -307 6.41593 0.273
NP_441463.1_6 Forward -249 -235 5.25632 0.297
NP_441626.1_2 Reverse -40 -47 6.0373 0.212
NP_441626.1_2 Forward -47 -40 5.93897 0.231
NP_442221.1_3 Reverse -244 -263 20.5506 0.0881
NP_442362.1_1 Forward -69 -50 6.78429 0.288
NP_442794.1_1 Reverse -117 -129 6.1355 0.192
NP_442794.1_1 Forward -368 -356 4.75886 0.249
NP_442615.1_1 Forward -347 -329 6.31233 0.0355
NP_441431.1_2 Forward -386 -372 7.3738 0.244
NP_441431.1_2 Forward -85 -71 5.70218 0.291
NP_441836.1_1 Forward -349 -330 12.3759 0.259
NP_441836.1_2 Forward -310 -291 -6.39206 0.297
NP_440114.1_10 Reverse -39 -53 14.0609 0.0446
NP_442437.1_3 Forward -46 -27 9.93006 0.262
NP_441720.1_2 Forward -86 -67 7.57013 0.213
NP_440766.1_4 Forward -52 -38 0.491246 0.28
NP_440766.1_5 Reverse -133 -145 9.18366 0.276
NP_442743.1_1 Reverse -280 -299 4.91521 0.288
NP_442743.1_5 Reverse -62 -81 4.32602 0.221
NP_442930.1_1 Forward -178 -168 15.1225 0.202
NP_442930.1_1 Forward -102 -92 9.71433 0.28
NP_440502.1_3 Reverse -17 -27 13.9847 0.278
NP_440457.1_1 Reverse -35 -47 7.61046 0.101
NP_440457.1_1 Forward -52 -40 6.72548 0.113
NP_440457.1_1 Reverse -325 -337 0.825626 0.25
NP_440457.1_1 Reverse -375 -387 -0.256015 0.259
NP_441984.1_3 Forward -48 -30 13.2938 0.153
NP_441984.1_3 Forward -388 -370 8.27895 0.232
NP_440473.1_1 Forward -386 -367 12.3179 0.238
NP_442509.1_9 Reverse -39 -49 12.0743 0.105
NP_442509.1_9 Forward -48 -38 11.4843 0.128
NP_442509.1_9 Reverse -121 -131 7.45273 0.219
NP_441489.1_3 Forward -185 -171 12.903 0.198
NP_442439.1_3 Reverse -170 -189 6.78429 0.279
NP_440524.1_3 Forward -74 -55 9.43923 0.278
NP_442514.1_5 Forward -306 -287 -6.68779 0.27
NP_441440.1_1 Forward -60 -41 7.37428 0.284
NP_440554.1_4 Forward -47 -37 6.66654 0.116
NP_441885.1_5 Forward -48 -38 -0.609952 0.215
NP_441275.1_2 Forward -264 -245 18.879 0.0231
NP_442341.1_9 Reverse -37 -51 8.94708 0.162
NP_441173.1_9 Reverse -175 -183 12.9004 0.206
NP_441173.1_9 Forward -241 -233 11.0321 0.228
NP_442534.1_6 Reverse -238 -255 19.8034 0.249
NP_442534.1_7 Reverse -367 -386 7.27595 0.269
NP_440423.1_6 Forward -56 -37 -14.5535 0.229
NP_443000.1_7 Reverse -37 -47 2.04498 0.226
NP_440507.2_8 Reverse -161 -180 8.94757 0.123
NP_440275.1_3 Reverse -37 -47 5.68323 0.136
NP_440091.1_1 Forward -52 -40 0.923956 0.225
NP_441902.1_3 Forward -295 -285 12.7873 0.235
NP_441105.1_3 Reverse -284 -303 -6.39206 0.234
NP_440216.1_1 Forward -48 -34 -2.85201 0.0608
NP_440216.1_1 Reverse -39 -53 -11.8985 0.228
NP_440216.1_9 Forward -381 -372 7.47288 0.286
NP_442015.1_10 Reverse -117 -130 0.314277 0.231
NP_442015.1_10 Reverse -35 -48 -0.275709 0.259
NP_441226.1_7 Forward -47 -40 11.5435 0.0757
NP_441226.1_7 Reverse -189 -196 8.59356 0.197
NP_441535.1_3 Reverse -209 -228 11.7992 0.156
NP_441111.1_7 Forward -47 -39 8.86921 0.0589
NP_441766.1_2 Forward -48 -39 6.48957 0.096
NP_442417.1_5 Reverse -188 -202 9.63603 0.128
NP_440416.1_9 Forward -55 -36 -8.06369 0.109
NP_440416.1_9 Reverse -114 -133 -17.5035 0.241
NP_440416.1_9 Reverse -367 -386 -18.5851 0.26
NP_440591.1_9 Forward -55 -37 4.9357 0.264
NP_440261.1_5 Forward -47 -34 -4.9956 0.183
NP_440261.1_10 Forward -376 -362 11.996 0.266
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCGGGGTTTTGATCCACCCCATGGCAGAGGGCGTTGAAAATGGCCGGTAATTGTTCGGCGGGTTGATAGCCCTGCATGAAACTATTAAAGGAGGTGACAATGCCTAGGGCAAAAATCGGATCGTAGGTAAAATCAATGTTCACACTGAGCAAATGCATTTCCACCAAGAGTTCTTCGACAAAACGCCGGTAGATGGAACTAATGGGACGGCTGTAGTGGGTAAAAAATTTTCGTTTGGCGTCAGAAACAGTGCGAATTTTAGTCACAGGGCCGATTACAAAGGGGGGGATAGTTCCCTACATTTTCCCTTGTTAAGCGGCCTTTGCCAACCTGAACCCTTGCTGGGGGAAGTGCGATCCCCGGGCATTGCTAGAATGGGACAGTCTTAGGGAACAGACC

CDS

ATGCCAGACTTCCAGGCATTTATCGCCATCATTACCACCATCTTGGTGTTTGCCATCGGAGTAGCCCTCAAATATGAAACCATCTACTTCAAAAACTACGAACTCTCCATCCCCCAATGGGCCGGCCTCAGCTTCGCCGGGTTTACTTTCACGTTTGTGGTCTTGGATTAA

Protein

MPDFQAFIAIITTILVFAIGVALKYETIYFKNYELSIPQWAGLSFAGFTFTFVVLD