Your browser is old and dusty. Try Google Chrome!

Details for ssr2422

ORF ssr2422
Accession NP_440877.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -320 -334 4.91614 0.142
NP_440795.1_7 Forward -327 -320 14.6904 0.0123
NP_440795.1_7 Reverse -320 -327 14.6904 0.0123
NP_441418.1_6 Forward -328 -309 -10.9153 0.0415
NP_441418.1_6 Reverse -319 -338 -21.0434 0.136
NP_441480.1_1 Forward -191 -172 -0.590531 0.287
NP_442291.1_10 Reverse -293 -312 17.404 0.213
NP_440897.1_6 Reverse -319 -338 9.83173 0.0705
NP_441453.1_1 Forward -335 -317 3.95163 0.263
NP_441453.1_4 Reverse -319 -327 16.539 0.00633
NP_441453.1_4 Forward -328 -320 16.539 0.00633
NP_442151.1_6 Reverse -319 -333 18.0925 0.0083
NP_442151.1_6 Forward -328 -314 9.14437 0.157
NP_441818.1_1 Reverse -320 -331 10.1862 0.232
NP_440226.1_1 Forward -328 -309 9.0459 0.0786
NP_440226.1_1 Reverse -149 -168 2.0644 0.278
NP_442655.1_10 Reverse -316 -335 -10.227 0.22
NP_442173.1_1 Forward -327 -319 15.4574 0.00633
NP_442173.1_1 Reverse -320 -328 15.4574 0.00633
NP_442752.1_4 Forward -328 -321 13.8055 0.0199
NP_442752.1_4 Reverse -319 -326 13.8055 0.0199
NP_443027.1_4 Forward -330 -320 14.0414 0.0452
NP_443027.1_4 Reverse -317 -327 13.2547 0.0521
NP_442975.1_10 Forward -332 -318 4.91554 0.234
NP_442975.1_10 Reverse -315 -329 4.22722 0.245
NP_442975.1_10 Reverse -287 -301 2.5556 0.273
NP_440784.1_7 Forward -327 -320 15.9687 0.0123
NP_440784.1_7 Reverse -320 -327 15.9687 0.0123
NP_440061.1_9 Forward -330 -316 11.1104 0.117
NP_440061.1_9 Reverse -317 -331 10.422 0.124
NP_440061.1_9 Reverse -44 -58 5.30886 0.29
NP_439979.1_3 Reverse -17 -36 17.278 0.237
NP_442062.1_8 Reverse -319 -329 17.3846 0.00193
NP_442062.1_8 Forward -328 -318 10.3048 0.0493
NP_440761.1_4 Reverse -314 -333 -13.9635 0.257
NP_441859.1_3 Reverse -318 -337 7.57013 0.157
NP_441859.1_3 Forward -329 -310 1.08032 0.296
NP_440304.1_4 Forward -330 -320 10.8948 0.051
NP_440304.1_4 Reverse -317 -327 10.8948 0.051
NP_442242.1_4 Forward -327 -320 14.3954 0.0124
NP_442242.1_4 Reverse -320 -327 14.3954 0.0124
NP_440044.1_8 Reverse -320 -339 -1.67217 0.248
NP_442602.1_3 Forward -143 -124 -4.03212 0.294
NP_439918.1_3 Reverse -244 -263 3.04771 0.271
NP_441208.1_9 Forward -331 -317 7.9644 0.219
NP_441594.1_6 Reverse -322 -341 3.53937 0.227
NP_441594.1_6 Forward -325 -306 2.0644 0.256
NP_442110.1_7 Reverse -319 -333 10.816 0.0644
NP_442110.1_7 Forward -328 -314 3.53951 0.21
NP_442726.1_7 Forward -29 -11 -1.55415 0.296
NP_441925.1_4 Forward -35 -16 -17.0125 0.287
NP_440856.1_4 Reverse -312 -331 -2.75381 0.22
NP_441083.1_5 Reverse -319 -329 20.3345 0.00053
NP_441083.1_5 Forward -328 -318 11.2881 0.0159
NP_441434.1_3 Forward -310 -291 -2.26216 0.262
NP_441738.1_2 Forward -326 -319 15.28 0.0102
NP_441738.1_2 Reverse -321 -328 15.28 0.0102
NP_441738.1_2 Forward -236 -229 8.29857 0.176
NP_441558.1_5 Forward -330 -311 10.5209 0.0968
NP_441558.1_5 Reverse -116 -135 5.70265 0.242
NP_440209.1_1 Reverse -319 -327 18.1123 0.00295
NP_440209.1_1 Forward -328 -320 18.1123 0.00295
NP_442889.1_8 Reverse -316 -330 9.6354 0.0952
NP_440447.1_6 Reverse -311 -329 4.83737 0.162
NP_441713.1_1 Forward -334 -315 2.0644 0.0651
NP_441713.1_1 Reverse -313 -332 -15.2418 0.261
NP_441713.1_2 Reverse -275 -294 15.8307 0.291
NP_441716.1_1 Reverse -319 -333 22.2224 0.00332
NP_441716.1_1 Forward -328 -314 10.6193 0.0936
NP_442111.1_4 Forward -329 -315 22.6157 0.000842
NP_442111.1_4 Reverse -318 -332 9.34103 0.0609
NP_442111.1_4 Reverse -271 -285 2.5562 0.271
NP_440906.1_5 Forward -327 -320 15.8704 0.0124
NP_440906.1_5 Reverse -320 -327 15.8704 0.0124
NP_440747.1_10 Forward -331 -319 17.2469 0.000522
NP_440747.1_10 Reverse -316 -328 17.1486 0.000663
NP_441130.1_10 Forward -330 -316 7.47274 0.158
NP_441130.1_10 Forward -32 -18 4.52282 0.281
NP_441486.1_1 Forward -331 -317 -2.85201 0.175
NP_441486.1_1 Reverse -316 -330 -5.11362 0.222
NP_442634.1_4 Reverse -317 -331 16.9125 0.01
NP_442634.1_4 Forward -330 -316 -1.18038 0.149
NP_442634.1_4 Reverse -147 -161 -4.62196 0.211
NP_441265.1_3 Forward -334 -320 3.14618 0.181
NP_442848.1_1 Forward -334 -320 -0.983719 0.263
NP_441012.1_4 Forward -304 -291 8.67241 0.272
NP_441012.1_4 Forward -332 -319 7.49244 0.272
NP_443018.1_3 Forward -327 -320 14.8871 0.0123
NP_443018.1_3 Reverse -320 -327 14.8871 0.0123
NP_443018.1_3 Reverse -326 -333 10.2655 0.107
NP_441316.1_7 Forward -330 -315 -1.5934 0.238
NP_441634.1_8 Reverse -40 -54 1.67122 0.185
NP_440376.1_1 Forward -328 -319 19.4693 0.000692
NP_440376.1_1 Reverse -319 -328 19.4693 0.000692
NP_440794.1_2 Reverse -301 -319 18.2295 0.207
NP_442687.1_7 Reverse -318 -328 9.02648 0.0994
NP_442687.1_7 Forward -329 -319 8.92815 0.0994
NP_442191.1_4 Forward -327 -313 18.8467 0.00666
NP_441797.1_7 Reverse -294 -312 12.8022 0.255
NP_441013.1_2 Reverse -314 -332 3.55906 0.23
NP_440667.1_2 Forward -116 -97 -2.65548 0.232
NP_440667.1_2 Reverse -349 -368 -7.08038 0.273
NP_442658.1_1 Reverse -317 -327 14.2375 0.0237
NP_442658.1_1 Forward -330 -320 6.76441 0.214
NP_442198.1_7 Forward -300 -281 12.0933 0.198
NP_440141.1_8 Forward -324 -305 9.83255 0.211
NP_442782.1_2 Forward -328 -314 1.57289 0.281
NP_441414.1_9 Reverse -319 -338 -4.81876 0.162
NP_442937.1_5 Reverse -156 -175 6.4893 0.278
NP_442321.1_4 Reverse -220 -239 -7.86702 0.284
NP_441958.1_5 Reverse -318 -328 21.2195 0.000805
NP_441958.1_5 Forward -329 -319 12.2714 0.00183
NP_440203.1_5 Reverse -322 -332 15.7125 0.0611
NP_439990.1_5 Forward -333 -320 20.7671 0.00296
NP_439990.1_5 Reverse -314 -327 20.1771 0.00546
NP_442376.1_2 Forward -333 -314 -3.73712 0.215
NP_442911.1_2 Forward -338 -319 14.2574 0.0112
NP_442911.1_2 Reverse -309 -328 -1.18052 0.082
NP_440153.1_5 Forward -327 -313 4.42448 0.199
NP_440369.1_5 Forward -134 -115 11.6025 0.239
NP_442536.1_8 Reverse -143 -162 14.9458 0.207
NP_442236.1_2 Reverse -282 -301 17.3057 0.13
NP_440602.1_2 Reverse -205 -224 5.89931 0.254
NP_441099.1_5 Reverse -309 -328 -6.88371 0.167
NP_440809.1_9 Reverse -310 -328 -6.86402 0.225
NP_440809.1_9 Forward -337 -319 -7.94566 0.225
NP_442438.1_10 Forward -333 -319 8.75105 0.0731
NP_442771.1_1 Forward -32 -14 2.77242 0.0672
NP_440484.1_3 Reverse -317 -331 11.701 0.242
NP_440147.1_4 Reverse -317 -330 10.2457 0.0355
NP_440147.1_4 Forward -330 -317 9.16406 0.0428
NP_441550.1_8 Reverse -317 -327 15.8108 0.0132
NP_441550.1_8 Forward -330 -320 12.3692 0.0336
NP_441916.1_7 Forward -328 -318 18.9579 0.00144
NP_441916.1_7 Reverse -319 -329 10.3048 0.0261
NP_441041.1_4 Reverse -319 -338 -1.27885 0.1
NP_441041.1_4 Forward -328 -309 -3.44213 0.122
NP_441041.1_4 Reverse -143 -162 -12.8819 0.276
NP_441041.1_7 Reverse -316 -328 13.3454 0.0485
NP_442396.1_5 Reverse -165 -178 9.75405 0.129
NP_442004.1_6 Reverse -319 -333 8.55439 0.14
NP_442004.1_6 Forward -158 -144 2.94952 0.254
NP_440703.1_9 Forward -306 -293 11.3267 0.192
NP_441725.1_4 Reverse -314 -328 13.7653 0.0693
NP_441725.1_4 Forward -286 -272 5.99717 0.278
NP_441725.1_5 Reverse -320 -330 11.2881 0.0247
NP_441725.1_5 Forward -327 -317 1.94665 0.115
NP_441725.1_5 Reverse -390 -400 -0.511621 0.26
NP_439966.1_7 Forward -330 -320 15.8108 0.0124
NP_439966.1_7 Reverse -317 -327 14.3359 0.0203
NP_442941.1_3 Reverse -320 -330 19.9412 0.00262
NP_442941.1_3 Forward -327 -317 19.2529 0.00262
NP_440289.1_2 Reverse -316 -329 3.16588 0.0811
NP_440289.1_2 Forward -33 -20 -0.37404 0.194
NP_440289.1_2 Forward -331 -318 -3.02898 0.263
NP_442281.1_1 Forward -333 -319 8.84875 0.075
NP_442281.1_1 Reverse -314 -328 8.45543 0.0808
NP_440437.1_1 Reverse -313 -332 0.0977854 0.172
NP_441644.1_6 Forward -328 -318 19.0557 0.000803
NP_441644.1_6 Reverse -319 -329 17.3841 0.00127
NP_442215.1_2 Reverse -317 -333 -4.07137 0.227
NP_440253.1_2 Forward -328 -310 0.412472 0.188
NP_440253.1_2 Reverse -319 -337 0.21581 0.192
NP_440929.1_8 Forward -328 -319 19.2726 0.000701
NP_440929.1_8 Reverse -319 -328 19.2726 0.000701
NP_442933.1_10 Forward -328 -319 17.601 0.00325
NP_442933.1_10 Reverse -319 -328 17.601 0.00325
NP_441751.2_8 Reverse -320 -334 6.3911 0.0354
NP_441751.2_8 Forward -327 -313 4.91614 0.0453
NP_441751.2_8 Reverse -273 -287 -5.70361 0.231
NP_442554.1_8 Forward -327 -317 17.2863 0.00543
NP_442554.1_8 Reverse -320 -330 15.9097 0.00747
NP_442554.1_8 Reverse -390 -400 2.92996 0.249
NP_441762.1_7 Reverse -318 -330 -6.74586 0.284
NP_441762.1_7 Forward -329 -317 -6.84419 0.284
NP_442142.1_4 Forward -331 -318 16.0466 0.0264
NP_442142.1_4 Reverse -316 -329 12.9 0.0406
NP_442142.1_4 Reverse -386 -399 8.67183 0.111
NP_442292.1_1 Reverse -320 -329 18.486 0.00229
NP_442292.1_1 Forward -327 -318 17.5026 0.00435
NP_440895.1_6 Forward -334 -321 10.8357 0.202
NP_441523.1_6 Reverse -315 -334 15.9291 0.152
NP_441523.1_6 Forward -332 -313 2.3594 0.295
NP_443009.1_5 Forward -329 -318 14.5128 0.02
NP_443009.1_5 Reverse -318 -329 10.1862 0.0792
NP_443009.1_5 Reverse -148 -159 5.07306 0.218
NP_441715.1_4 Forward -327 -317 16.7946 0.0106
NP_441715.1_4 Reverse -320 -330 14.828 0.0268
NP_441448.1_1 Forward -308 -289 5.50599 0.261
NP_441468.1_1 Forward -327 -320 15.8704 0.0124
NP_441468.1_1 Reverse -320 -327 15.8704 0.0124
NP_441015.1_10 Reverse -314 -333 -8.85033 0.277
NP_441673.1_1 Forward -328 -319 20.8459 0.000698
NP_441673.1_1 Reverse -319 -328 20.8459 0.000698
NP_441826.1_2 Forward -334 -320 5.89945 0.0946
NP_441826.1_2 Reverse -143 -157 -1.77037 0.254
NP_441826.1_2 Reverse -313 -327 -3.83532 0.288
NP_441330.1_1 Reverse -314 -333 -14.2585 0.216
NP_442868.1_6 Reverse -317 -327 10.4031 0.038
NP_442868.1_6 Forward -330 -320 9.91146 0.038
NP_441056.1_1 Forward -328 -309 -8.752 0.283
NP_441612.1_2 Reverse -319 -329 8.54929 0.21
NP_442227.1_4 Reverse -111 -130 15.2399 0.152
NP_443058.1_7 Forward -353 -334 10.3242 0.206
NP_442361.1_3 Forward -351 -338 7.78743 0.288
NP_442808.1_1 Reverse -318 -328 8.73102 0.0481
NP_442808.1_1 Forward -329 -319 8.63269 0.0481
NP_442808.1_1 Reverse -388 -398 5.78111 0.141
NP_442542.1_2 Reverse -317 -330 9.85238 0.131
NP_442050.1_5 Forward -330 -320 16.4991 0.00812
NP_442050.1_5 Reverse -317 -327 15.9091 0.0091
NP_440558.1_2 Forward -31 -12 0.392778 0.191
NP_440558.1_2 Forward -310 -291 -2.75381 0.229
NP_440558.1_2 Reverse -294 -313 -3.93378 0.239
NP_441878.1_6 Reverse -318 -328 10.5014 0.0176
NP_441878.1_6 Forward -329 -319 10.4031 0.0176
NP_441878.1_6 Forward -399 -389 0.668351 0.139
NP_441036.1_8 Reverse -318 -328 15.713 0.00724
NP_441036.1_8 Forward -329 -319 8.33817 0.174
NP_441036.1_8 Reverse -267 -277 6.07655 0.242
NP_441036.1_8 Forward -35 -25 5.97822 0.246
NP_442650.1_2 Reverse -319 -333 6.6861 0.13
NP_441557.1_5 Forward -328 -319 19.9609 0.000699
NP_441557.1_5 Reverse -319 -328 19.9609 0.000699
NP_441557.1_8 Forward -149 -139 13.7459 0.204
NP_441445.1_1 Forward -337 -318 4.916 0.183
NP_442183.1_1 Reverse -319 -333 7.07942 0.149
NP_442166.1_7 Forward -327 -313 11.996 0.184
NP_442347.1_2 Reverse -320 -329 12.4878 0.056
NP_442347.1_2 Reverse -302 -311 5.99792 0.201
NP_442347.1_2 Forward -327 -318 3.34298 0.284
NP_441037.1_4 Reverse -317 -327 7.22024 0.237
NP_442594.1_8 Forward -318 -299 7.66927 0.213
NP_440151.1_6 Reverse -290 -309 14.8474 0.225
NP_441633.1_3 Reverse -317 -330 -3.81562 0.177
NP_441633.1_3 Forward -330 -317 -6.07724 0.236
NP_440136.1_2 Forward -327 -320 15.9687 0.0123
NP_440136.1_2 Reverse -320 -327 15.9687 0.0123
NP_442590.1_10 Forward -328 -309 3.34271 0.294
NP_442998.1_5 Forward -242 -232 11.7798 0.176
NP_442998.1_10 Forward -326 -319 15.5754 0.0102
NP_442998.1_10 Reverse -321 -328 15.5754 0.0102
NP_442998.1_10 Reverse -23 -30 4.07068 0.276
NP_440299.1_1 Forward -332 -319 22.3398 0.000547
NP_440299.1_1 Reverse -315 -328 11.1301 0.0518
NP_441799.1_1 Reverse -315 -329 7.76712 0.133
NP_441799.1_1 Forward -332 -318 6.29216 0.176
NP_440256.1_1 Forward -331 -312 8.16093 0.0239
NP_440256.1_1 Reverse -316 -335 1.27776 0.077
NP_441559.1_8 Reverse -314 -328 20.4524 0.0414
NP_441559.1_8 Forward -333 -319 2.75286 0.143
NP_440915.1_6 Forward -332 -318 12.8809 0.0206
NP_440915.1_6 Reverse -315 -329 10.6193 0.0301
NP_441179.1_9 Reverse -387 -397 9.616 0.28
NP_442785.1_2 Forward -390 -371 22.2223 0.0489
NP_441704.1_8 Forward -339 -320 6.88182 0.254
NP_442452.1_8 Forward -334 -320 13.6669 0.273
NP_442866.1_1 Forward -116 -97 -7.17871 0.264
NP_441464.1_1 Forward -332 -313 8.35759 0.261
NP_440695.1_5 Forward -328 -309 4.916 0.186
NP_441494.1_6 Reverse -144 -157 8.57408 0.23
NP_442386.1_9 Forward -329 -320 13.8639 0.0289
NP_442386.1_9 Reverse -318 -327 6.39082 0.219
NP_442386.1_9 Reverse -388 -397 4.52254 0.297
NP_441340.1_5 Forward -327 -320 15.6737 0.0124
NP_441340.1_5 Reverse -320 -327 15.6737 0.0124
NP_442484.1_2 Reverse -308 -327 2.16274 0.226
NP_440168.1_9 Forward -317 -298 -0.197208 0.273
NP_442474.1_9 Forward -264 -245 16.9124 0.0906
NP_442240.1_2 Forward -327 -308 -20.2567 0.295
NP_442714.1_5 Forward -305 -286 -1.18052 0.3
NP_442714.1_7 Reverse -298 -317 0.0977854 0.244
NP_441160.1_5 Forward -317 -298 -5.60541 0.288
NP_440586.1_8 Forward -327 -320 13.2151 0.026
NP_440586.1_8 Reverse -320 -327 13.2151 0.026
NP_440586.1_8 Reverse -326 -333 9.08521 0.178
NP_440586.1_8 Forward -397 -390 5.8403 0.283
NP_442251.1_6 Forward -327 -320 15.2804 0.0124
NP_442251.1_6 Reverse -320 -327 15.2804 0.0124
NP_441262.1_3 Reverse -319 -326 14.7888 0.0223
NP_441262.1_3 Forward -328 -321 14.7888 0.0223
NP_440027.1_3 Forward -307 -289 3.45998 0.272
NP_443051.1_1 Reverse -318 -327 19.5676 0.00335
NP_443051.1_1 Forward -329 -320 10.4228 0.00754
NP_439937.1_9 Reverse -318 -335 -6.84499 0.157
NP_439937.1_9 Forward -329 -312 -16.4814 0.287
NP_440398.1_2 Reverse -134 -153 0.884433 0.281
NP_440439.1_1 Reverse -316 -329 10.934 0.0339
NP_440439.1_1 Forward -331 -318 7.00078 0.0703
NP_439943.1_7 Forward -333 -314 13.1758 0.101
NP_440372.1_2 Forward -327 -320 16.3621 0.0124
NP_440372.1_2 Reverse -320 -327 16.3621 0.0124
NP_440316.1_10 Forward -399 -389 8.92815 0.236
NP_442488.1_7 Reverse -52 -71 9.63589 0.273
NP_439977.1_5 Reverse -313 -332 13.8641 0.0531
NP_439977.1_5 Forward -334 -315 0.0977854 0.214
NP_439977.1_5 Reverse -15 -34 -1.96717 0.266
NP_441572.1_7 Forward -334 -315 -1.86883 0.19
NP_441572.1_7 Reverse -313 -332 -5.99873 0.278
NP_440267.1_2 Forward -286 -272 5.21053 0.276
NP_442384.1_10 Forward -328 -315 18.8988 0.00338
NP_442384.1_10 Reverse -319 -332 17.4239 0.00585
NP_442790.1_4 Forward -337 -318 -10.1286 0.201
NP_442262.1_10 Forward -327 -320 14.1988 0.0123
NP_442262.1_10 Reverse -320 -327 14.1988 0.0123
NP_442262.1_10 Reverse -326 -333 9.18389 0.211
NP_441689.1_5 Forward -330 -320 15.3192 0.0403
NP_441689.1_5 Reverse -317 -327 8.3377 0.132
NP_440163.1_10 Forward -331 -321 12.4681 0.159
NP_440344.1_10 Forward -335 -318 2.89044 0.0279
NP_440344.1_10 Reverse -312 -329 -5.76269 0.109
NP_440282.1_10 Reverse -120 -139 -8.65367 0.263
NP_440531.1_6 Forward -305 -286 -0.0988766 0.203
NP_442910.1_1 Forward -335 -316 -6.98204 0.254
NP_441640.1_8 Reverse -320 -339 4.71934 0.117
NP_440297.1_9 Reverse -390 -400 9.32148 0.0917
NP_440297.1_9 Reverse -320 -330 9.32148 0.0917
NP_440297.1_9 Forward -327 -317 -0.216628 0.282
NP_440650.1_6 Reverse -313 -332 8.55425 0.239
NP_440894.1_10 Reverse -286 -305 4.42435 0.254
NP_440894.1_10 Reverse -302 -321 2.94938 0.279
NP_440999.1_9 Reverse -315 -329 10.226 0.0548
NP_440999.1_9 Forward -332 -318 0.786239 0.177
NP_440888.1_2 Reverse -319 -333 16.8135 0.00536
NP_440888.1_2 Forward -328 -314 14.2569 0.0193
NP_440600.1_4 Reverse -311 -329 -6.96235 0.291
NP_442948.1_2 Reverse -318 -337 4.62101 0.26
NP_442033.1_10 Forward -330 -311 -7.86702 0.186
NP_442033.1_10 Reverse -307 -326 -7.86702 0.186
NP_442033.1_10 Reverse -317 -336 -9.83364 0.222
NP_441543.1_2 Reverse -320 -329 16.9127 0.00359
NP_441543.1_2 Forward -327 -318 15.9293 0.00518
NP_442845.1_2 Forward -334 -320 12.6843 0.104
NP_442845.1_2 Reverse -319 -333 7.86607 0.195
NP_441304.1_10 Reverse -227 -236 13.4711 0.241
NP_441551.1_5 Forward -332 -316 7.43266 0.247
NP_441319.1_8 Forward -334 -316 6.70565 0.27
NP_441918.1_7 Forward -399 -380 -3.44213 0.297
NP_441469.1_8 Reverse -318 -327 6.5879 0.227
NP_441469.1_8 Forward -329 -320 6.48957 0.227
NP_441548.1_1 Reverse -344 -363 19.3707 0.0595
NP_443064.1_6 Reverse -319 -329 12.5669 0.0796
NP_443064.1_6 Forward -328 -318 10.8217 0.13
NP_442578.1_7 Forward -327 -320 14.5921 0.026
NP_442578.1_7 Reverse -320 -327 14.5921 0.026
NP_441462.1_2 Forward -328 -318 20.2362 0.000805
NP_441462.1_2 Reverse -319 -329 11.5831 0.00406
NP_441621.1_7 Forward -330 -316 -5.11362 0.248
NP_443062.1_1 Forward -328 -310 7.66836 0.17
NP_443062.1_1 Reverse -319 -337 5.13317 0.238
NP_443062.1_6 Forward -336 -317 8.45592 0.143
NP_443062.1_6 Reverse -311 -330 0.982764 0.283
NP_440349.1_3 Forward -50 -31 12.585 0.269
NP_440519.1_8 Reverse -244 -260 3.89344 0.244
NP_442204.1_1 Reverse -315 -326 21.1015 0.0035
NP_442204.1_1 Forward -332 -321 9.69511 0.0736
NP_442204.1_2 Reverse -309 -328 11.0125 0.223
NP_442487.1_5 Reverse -378 -397 2.75194 0.3
NP_440516.1_8 Forward -328 -319 16.9127 0.00442
NP_440516.1_8 Reverse -319 -328 16.9127 0.00442
NP_442428.1_5 Forward -327 -320 15.8704 0.0124
NP_442428.1_5 Reverse -320 -327 15.8704 0.0124
NP_441443.1_1 Reverse -349 -368 -3.3438 0.287
NP_442120.1_10 Forward -116 -97 1.37609 0.156
NP_442120.1_10 Forward -346 -327 -10.3253 0.257
NP_440673.1_3 Forward -326 -319 12.4288 0.0426
NP_440673.1_3 Reverse -321 -328 12.4288 0.0426
NP_440673.1_3 Reverse -151 -158 9.08556 0.202
NP_440865.1_9 Forward -334 -315 -9.63698 0.294
NP_441052.1_2 Reverse -319 -329 19.9412 0.00106
NP_441052.1_2 Forward -328 -318 10.4031 0.0285
NP_441052.1_2 Reverse -325 -335 1.25834 0.249
NP_442219.1_8 Forward -260 -241 9.42334 0.23
NP_442219.1_9 Reverse -320 -329 17.7976 0.00718
NP_442219.1_9 Forward -327 -318 8.25953 0.0681
NP_440436.1_4 Reverse -320 -329 17.2072 0.00233
NP_440436.1_4 Forward -327 -318 9.24241 0.0871
NP_441884.1_9 Forward -363 -344 -23.6983 0.284
NP_441719.1_4 Forward -327 -320 16.3621 0.0124
NP_441719.1_4 Reverse -320 -327 16.3621 0.0124
NP_441004.1_1 Reverse -30 -49 -16.4218 0.284
NP_441004.1_2 Reverse -25 -44 -2.75381 0.265
NP_442366.1_3 Reverse -318 -336 6.01734 0.0829
NP_441115.1_4 Reverse -318 -336 12.6047 0.0997
NP_441115.1_4 Forward -329 -311 10.3431 0.181
NP_442206.1_10 Reverse -319 -334 4.40479 0.178
NP_442206.1_10 Forward -328 -313 1.84819 0.215
NP_441851.1_3 Forward -188 -169 13.0775 0.229
NP_441851.1_10 Forward -329 -319 15.8113 0.00552
NP_441851.1_10 Reverse -318 -328 8.53483 0.114
NP_442515.1_1 Forward -329 -315 -4.62196 0.298
NP_440593.1_3 Forward -157 -138 -5.21209 0.259
NP_441349.1_10 Forward -338 -319 1.37609 0.084
NP_441409.1_6 Forward -334 -315 19.764 0.0044
NP_441409.1_6 Reverse -313 -332 0.884433 0.0648
NP_442843.1_1 Reverse -289 -308 -8.06369 0.253
NP_441477.1_5 Reverse -300 -319 8.45592 0.272
NP_440877.1_1 Forward -163 -144 20.649 0.0846
NP_440877.1_4 Forward -24 -9 21.6127 0.0522
NP_440877.1_5 Forward -64 -46 20.2753 0.202
NP_440877.1_6 Forward -250 -231 20.1573 0.18
NP_440431.1_3 Reverse -318 -337 7.07928 0.0886
NP_440431.1_3 Forward -329 -310 -4.22878 0.178
NP_442450.1_5 Forward -330 -320 9.32148 0.115
NP_440588.1_2 Forward -337 -318 2.45773 0.119
NP_442006.1_2 Forward -398 -381 -15.6941 0.228
NP_442243.1_1 Reverse -313 -331 -0.866561 0.258
NP_441570.1_1 Reverse -319 -337 -16.5005 0.247
NP_441570.1_1 Forward -328 -310 -16.9921 0.26
NP_441078.1_4 Forward -328 -319 19.6659 0.0007
NP_441078.1_4 Reverse -319 -328 19.6659 0.0007
NP_442729.1_5 Forward -399 -389 18.2696 0.059
NP_442729.1_8 Forward -332 -319 8.37742 0.125
NP_441663.1_8 Reverse -313 -332 -1.57384 0.243
NP_442348.1_2 Reverse -229 -238 7.76787 0.28
NP_442443.1_1 Reverse -11 -30 -6.88371 0.299
NP_441091.1_5 Reverse -315 -334 6.19431 0.22
NP_440526.1_3 Reverse -320 -331 7.92465 0.126
NP_440526.1_3 Reverse -119 -130 4.28642 0.267
NP_441432.1_8 Reverse -318 -327 16.8143 0.00595
NP_441432.1_8 Forward -329 -320 16.8143 0.00595
NP_442320.1_8 Forward -334 -320 5.89945 0.0309
NP_441732.1_2 Reverse -315 -331 2.91013 0.0145
NP_441732.1_2 Forward -332 -316 -7.51295 0.0859
NP_441732.1_2 Forward -320 -304 -16.8544 0.207
NP_441732.1_2 Forward -272 -256 -16.8544 0.207
NP_440199.1_10 Forward -331 -321 7.64985 0.231
NP_442727.1_1 Reverse -6 -20 11.406 0.294
NP_442751.1_2 Reverse -290 -309 14.3549 0.129
NP_440713.1_4 Forward -338 -319 9.83255 0.136
NP_440713.1_4 Reverse -309 -328 8.45592 0.17
NP_442489.1_7 Forward -328 -319 20.1576 0.000695
NP_442489.1_7 Reverse -319 -328 20.1576 0.000695
NP_442079.1_7 Reverse -320 -339 3.04771 0.214
NP_442079.1_7 Forward -327 -308 0.58944 0.277
NP_440559.1_1 Reverse -320 -329 17.4043 0.00658
NP_440559.1_1 Forward -327 -318 8.65285 0.0586
NP_441659.2_8 Forward -328 -318 20.9245 0.000805
NP_441659.2_8 Reverse -319 -329 18.1713 0.00133
NP_441659.2_8 Reverse -118 -128 -0.118297 0.287
NP_441040.1_5 Reverse -314 -333 2.55606 0.28
NP_442849.1_6 Forward -183 -169 13.5693 0.259
NP_442346.1_5 Forward -329 -319 16.6963 0.00248
NP_442346.1_5 Reverse -318 -328 16.303 0.00248
NP_442346.1_5 Forward -159 -149 6.66654 0.195
NP_442346.1_5 Forward -399 -389 6.17489 0.212
NP_442346.1_5 Forward -301 -291 4.89658 0.269
NP_440545.1_3 Forward -332 -315 14.1985 0.0157
NP_440545.1_3 Reverse -315 -332 7.11867 0.0518
NP_441923.1_6 Forward -397 -383 17.5025 0.126
NP_440459.1_2 Reverse -340 -357 10.7569 0.192
NP_440010.1_4 Forward -162 -143 -0.29631 0.25
NP_440010.1_10 Reverse -244 -263 3.24438 0.264
NP_442603.1_7 Reverse -319 -333 19.7634 0.00895
NP_442603.1_7 Forward -328 -314 9.53707 0.146
NP_441585.1_2 Forward -317 -298 16.9124 0.201
NP_441888.1_7 Reverse -314 -328 3.8345 0.225
NP_441833.1_4 Forward -327 -320 15.9687 0.0124
NP_441833.1_4 Reverse -320 -327 15.9687 0.0124
NP_442162.1_9 Forward -327 -320 16.2637 0.0124
NP_442162.1_9 Reverse -320 -327 16.2637 0.0124
NP_443015.1_4 Reverse -215 -234 17.994 0.203
NP_440671.1_4 Forward -334 -320 18.3875 0.0136
NP_440671.1_4 Reverse -313 -327 7.86607 0.207
NP_442140.1_3 Forward -397 -387 11.6814 0.0738
NP_442140.1_3 Reverse -289 -299 5.09324 0.227
NP_442140.1_3 Forward -327 -317 4.69992 0.238
NP_442140.1_3 Reverse -320 -330 4.40493 0.243
NP_441609.1_1 Forward -209 -190 3.44104 0.189
NP_440875.1_9 Forward -326 -316 16.5483 0.0145
NP_441813.1_5 Reverse -317 -327 18.1713 0.00743
NP_441813.1_5 Forward -330 -320 15.9097 0.01
NP_440590.1_4 Forward -327 -314 6.4108 0.0575
NP_440590.1_4 Reverse -320 -333 6.1158 0.0583
NP_440567.1_1 Reverse -320 -334 6.58777 0.0816
NP_442497.1_10 Forward -327 -318 17.601 0.00813
NP_442497.1_10 Reverse -320 -329 10.4228 0.0087
NP_440821.1_4 Forward -330 -320 18.2696 0.00448
NP_440821.1_4 Reverse -317 -327 2.24165 0.131
NP_441239.1_9 Reverse -317 -329 13.0187 0.0389
NP_441239.1_9 Reverse -387 -399 6.43049 0.189
NP_441239.1_9 Forward -308 -296 5.15219 0.227
NP_441239.1_9 Forward -330 -318 4.36554 0.253
NP_441951.1_6 Reverse -380 -399 13.7658 0.205
NP_441009.1_4 Reverse -319 -338 15.9291 0.158
NP_442568.1_8 Reverse -64 -78 9.63603 0.257
NP_441892.1_1 Reverse -310 -327 -0.649475 0.188
NP_441892.1_1 Reverse -316 -333 -0.944468 0.193
NP_441892.1_4 Forward -38 -19 -0.4922 0.28
NP_442044.1_1 Reverse -314 -333 -14.2585 0.284
NP_442643.1_1 Forward -334 -315 -1.86883 0.143
NP_442772.1_4 Forward -27 -8 -2.26216 0.22
NP_440833.1_6 Reverse -305 -319 10.0287 0.255
NP_440546.1_4 Forward -328 -318 13.5365 0.0459
NP_440546.1_4 Reverse -319 -329 10.046 0.109
NP_440546.1_4 Forward -398 -388 8.78555 0.171
NP_440462.1_6 Reverse -317 -327 18.7612 0.00454
NP_440462.1_6 Forward -330 -320 7.74818 0.0699
NP_440868.1_4 Reverse -315 -327 8.00379 0.0602
NP_440868.1_4 Forward -332 -320 6.1355 0.0878
NP_442402.1_4 Forward -185 -166 -7.6711 0.278
NP_442460.1_7 Forward -340 -321 9.83255 0.112
NP_442039.1_4 Forward -327 -320 15.1821 0.0124
NP_442039.1_4 Reverse -320 -327 15.1821 0.0124
NP_442039.1_7 Forward -304 -294 14.1397 0.211
NP_442039.1_7 Reverse -345 -355 11.3864 0.257
NP_441811.1_8 Reverse -143 -157 18.1908 0.0593
NP_442273.1_10 Reverse -183 -201 10.1472 0.224
NP_442837.1_3 Forward -327 -320 15.7721 0.0124
NP_442837.1_3 Reverse -320 -327 15.7721 0.0124
NP_440160.1_2 Reverse -130 -149 -4.22878 0.26
NP_439994.1_3 Reverse -318 -337 14.1941 0.113
NP_442053.1_1 Forward -328 -319 18.3876 0.0007
NP_442053.1_1 Reverse -319 -328 18.3876 0.0007
NP_440505.1_3 Reverse -317 -327 17.188 0.00332
NP_440505.1_3 Forward -330 -320 16.303 0.00696
NP_441252.1_6 Forward -243 -236 11.6422 0.288
NP_441203.1_1 Reverse -320 -339 -10.0303 0.137
NP_440914.1_1 Reverse -319 -329 17.5935 0.000537
NP_440914.1_1 Forward -328 -318 16.3248 0.00196
NP_440914.1_1 Forward -306 -296 9.00547 0.186
NP_441011.1_8 Forward -327 -318 16.6177 0.00602
NP_441011.1_8 Reverse -320 -329 8.25953 0.144
NP_442533.1_6 Forward -328 -319 17.2076 0.00137
NP_442533.1_6 Reverse -319 -328 17.2076 0.00137
NP_441482.1_7 Reverse -313 -327 16.4209 0.00702
NP_441482.1_7 Forward -334 -320 0.589577 0.0554
NP_439944.1_9 Reverse -320 -330 19.0562 0.00329
NP_439944.1_9 Forward -327 -317 9.12481 0.1
NP_442269.1_10 Forward -157 -138 11.1109 0.176
NP_441028.1_6 Forward -356 -346 5.78111 0.243
NP_440116.1_5 Forward -331 -314 6.23369 0.169
NP_440116.1_8 Forward -327 -308 11.6025 0.0278
NP_440116.1_8 Reverse -320 -339 -4.72043 0.178
NP_440115.1_6 Reverse -316 -326 14.0414 0.0615
NP_440115.1_6 Forward -331 -321 9.41981 0.115
NP_440007.1_9 Forward -332 -318 10.6193 0.163
NP_440007.1_9 Reverse -315 -329 10.226 0.163
NP_439965.1_1 Forward -337 -318 2.0644 0.115
NP_441972.1_5 Reverse -308 -327 -8.752 0.272
NP_441106.1_1 Reverse -318 -327 18.486 0.0028
NP_441106.1_1 Forward -329 -320 9.63616 0.0311
NP_439903.1_6 Reverse -316 -335 3.9319 0.205
NP_439903.1_6 Forward -331 -312 -0.787962 0.285
NP_439903.1_6 Forward -182 -163 -1.27961 0.295
NP_441286.1_1 Reverse -318 -330 11.937 0.0108
NP_441286.1_1 Forward -329 -317 5.93884 0.0258
NP_440670.1_8 Forward -328 -319 18.3876 0.000699
NP_440670.1_8 Reverse -319 -328 18.3876 0.000699
NP_440886.1_7 Reverse -318 -328 8.04271 0.0805
NP_440886.1_7 Forward -329 -319 7.94438 0.0805
NP_442614.1_2 Reverse -319 -333 9.2427 0.242
NP_442382.1_9 Forward -272 -253 7.66846 0.29
NP_442072.1_9 Forward -329 -311 -14.4355 0.145
NP_442072.1_9 Reverse -20 -38 -21.9087 0.215
NP_440028.1_6 Forward -133 -115 10.5406 0.277
NP_442022.1_4 Reverse -33 -52 7.07928 0.268
NP_440907.2_8 Forward -327 -317 9.616 0.103
NP_442264.1_2 Forward -338 -321 6.03703 0.267
NP_441463.1_3 Forward -338 -319 -9.53865 0.28
NP_441463.1_6 Reverse -317 -331 6.80246 0.267
NP_441626.1_2 Forward -327 -320 15.7721 0.0124
NP_441626.1_2 Reverse -320 -327 15.7721 0.0124
NP_442365.1_7 Forward -332 -313 -3.3438 0.217
NP_442794.1_1 Forward -332 -320 19.7052 0.00523
NP_442794.1_1 Reverse -315 -327 10.5604 0.0721
NP_442615.1_1 Reverse -310 -328 -0.275845 0.114
NP_442615.1_1 Forward -337 -319 -1.75081 0.132
NP_441962.1_4 Reverse -320 -339 -12.5869 0.26
NP_441962.1_4 Forward -311 -292 -14.4552 0.288
NP_440387.1_1 Forward -328 -312 -2.5964 0.148
NP_440387.1_1 Reverse -319 -335 -3.57971 0.162
NP_440387.1_1 Reverse -272 -288 -5.84132 0.254
NP_441431.1_2 Reverse -316 -330 6.58715 0.266
NP_441431.1_2 Forward -300 -286 6.29216 0.275
NP_441488.1_8 Reverse -314 -328 8.75042 0.178
NP_441993.1_1 Forward -334 -315 8.28142 0.15
NP_441993.1_1 Reverse -143 -162 4.67549 0.215
NP_442698.1_10 Reverse -261 -280 0.196116 0.297
NP_442323.1_7 Reverse -314 -333 7.4718 0.18
NP_442323.1_7 Forward -333 -314 3.34192 0.245
NP_442323.1_7 Reverse -96 -115 0.883656 0.298
NP_440766.1_4 Forward -332 -318 7.86607 0.0871
NP_442743.1_5 Reverse -320 -339 6.88262 0.173
NP_439910.1_2 Forward -336 -319 -22.3806 0.232
NP_440457.1_1 Forward -332 -320 8.29878 0.101
NP_440457.1_1 Reverse -315 -327 7.70879 0.101
NP_442297.1_4 Reverse -315 -334 11.9461 0.294
NP_442509.1_9 Reverse -319 -329 8.14104 0.192
NP_442509.1_9 Forward -328 -318 8.04271 0.192
NP_440554.1_4 Forward -327 -317 17.9746 0.0131
NP_440554.1_4 Reverse -320 -330 7.05986 0.106
NP_441885.1_5 Reverse -319 -329 20.9245 0.000538
NP_441885.1_5 Forward -328 -318 11.3864 0.00668
NP_440478.1_4 Reverse -315 -334 15.0441 0.158
NP_442341.1_7 Reverse -318 -332 7.66941 0.0994
NP_442341.1_7 Forward -329 -315 1.67122 0.282
NP_442341.1_9 Reverse -317 -331 21.73 0.00245
NP_441173.1_9 Forward -174 -166 10.2454 0.261
NP_442395.2_4 Reverse -318 -337 5.11187 0.169
NP_443000.1_7 Reverse -317 -327 20.3345 0.00223
NP_443000.1_7 Forward -330 -320 17.0896 0.00865
NP_440275.1_3 Reverse -317 -327 16.1063 0.0155
NP_440275.1_3 Forward -330 -320 8.1415 0.0602
NP_440091.1_1 Forward -332 -320 -0.452677 0.273
NP_442451.1_2 Reverse -289 -308 -8.752 0.253
NP_441105.1_3 Forward -339 -320 10.1275 0.0425
NP_441105.1_3 Reverse -308 -327 4.32602 0.0807
NP_440216.1_1 Forward -328 -314 7.37441 0.00942
NP_440216.1_1 Reverse -319 -333 -10.3252 0.145
NP_440216.1_9 Reverse -327 -336 15.9293 0.128
NP_440216.1_9 Reverse -326 -335 6.78456 0.289
NP_440216.1_9 Forward -295 -286 5.60459 0.292
NP_440216.1_9 Reverse -120 -129 5.40793 0.294
NP_440172.1_1 Forward -328 -318 17.5813 0.00421
NP_440172.1_1 Reverse -319 -329 15.0247 0.00945
NP_442015.1_10 Forward -332 -319 18.8988 0.00492
NP_442015.1_10 Reverse -315 -328 13.4906 0.0354
NP_441226.1_7 Forward -327 -320 14.4934 0.0123
NP_441226.1_7 Reverse -320 -327 14.4934 0.0123
NP_441111.1_7 Forward -327 -319 18.7023 0.00294
NP_441111.1_7 Reverse -320 -328 18.7023 0.00294
NP_441766.1_2 Forward -328 -319 17.5026 0.00297
NP_441766.1_2 Reverse -319 -328 17.5026 0.00297
NP_442417.1_5 Forward -328 -314 7.07942 0.197
NP_442179.1_4 Reverse -281 -300 27.2371 0.00107
NP_440416.1_9 Forward -335 -316 3.04771 0.0381
NP_440416.1_9 Reverse -312 -331 -14.7502 0.18
NP_440591.1_9 Forward -335 -317 3.85406 0.295
NP_442154.1_1 Reverse -147 -165 -18.9587 0.288
NP_440261.1_5 Forward -327 -314 4.8375 0.0516
NP_440261.1_5 Reverse -320 -333 -2.93064 0.0983
NP_440261.1_5 Forward -126 -113 -4.9956 0.183
NP_440988.1_10 Forward -330 -316 5.38289 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGGCCATGGTGGAGCAGTACCTGGATGTAGACCTAAAGCAACTCTGTCCCCAATGGAGTGCTATTTTCCATGGCGATCGCCTGGGATATTGGGACCAATGGCAACCATTGCAGAGCCAGTTTATCGACCCCGTATATCGTCACCACTGTCGTCAACTGGTGCAAAATCCCCTTGTAAACAGTGACCAGCCAACTTCTAGCAACCTTTAAAGTTGGTGCCTGATGGTTTCCCAAACTGACAAAGCAATCATCCTCGCCCCGGGTTAGGGAATTTACGATGGTCTGGAGACGCCATTATGCTTGGGACACTCTTTAGCATCTATGGTTTAGCTTCTTTTGAAATCTGGGCTGCCACTACAATTAATCCAGGGGCGCTAGTACCTCCGCAAAAGGAGACTCC

CDS

ATGACTAACAATGACAATATTCGCTTAGAGCAGATCTCCGAAGATCTTGAAGCTCAAAGACATAGCTTGAATGAACAGGGGCAACGCCTAGACCGAATTGAAACGATTCTTACTAACCTAGTGACAGAAATTAAAATCTATGACAGCAAACTAGATACTTACCAGAAAGCTTCCCAGCAAATTGTCAATATTGCCTTTGGCCTTTTGGCCACCTCGGCCCTCGCCATAATCATTCCCGCCGTTCTTAACCGCTAA

Protein

MTNNDNIRLEQISEDLEAQRHSLNEQGQRLDRIETILTNLVTEIKIYDSKLDTYQKASQQIVNIAFGLLATSALAIIIPAVLNR