Your browser is old and dusty. Try Google Chrome!

Details for ssr2406

ORF ssr2406
Accession NP_440866.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -104 -90 11.7993 0.0505
NP_441061.1_2 Reverse -386 -400 2.75286 0.172
NP_441061.1_2 Reverse -377 -391 -1.96703 0.278
NP_440557.1_1 Forward -104 -85 1.0811 0.265
NP_440795.1_7 Forward -104 -97 14.6904 0.0123
NP_440795.1_7 Reverse -97 -104 14.6904 0.0123
NP_441418.1_6 Reverse -96 -115 -10.6203 0.0375
NP_441418.1_6 Forward -105 -86 -20.0601 0.103
NP_441453.1_4 Reverse -96 -104 16.539 0.00633
NP_441453.1_4 Forward -105 -97 16.539 0.00633
NP_441453.1_4 Reverse -256 -264 4.14932 0.264
NP_442151.1_6 Reverse -96 -110 13.4709 0.0512
NP_442151.1_6 Forward -105 -91 10.4227 0.123
NP_441818.1_1 Reverse -97 -108 17.1677 0.00948
NP_441630.1_3 Forward -113 -94 10.3242 0.0907
NP_442744.1_8 Forward -105 -86 5.211 0.152
NP_442655.1_1 Forward -110 -91 2.0644 0.238
NP_442173.1_1 Forward -104 -96 15.4574 0.00633
NP_442173.1_1 Reverse -97 -105 15.4574 0.00633
NP_442752.1_4 Forward -105 -98 13.8055 0.0199
NP_442752.1_4 Reverse -96 -103 13.8055 0.0199
NP_443027.1_4 Reverse -94 -104 14.828 0.0437
NP_443027.1_4 Forward -107 -97 7.35486 0.24
NP_441812.1_3 Reverse -95 -109 8.45605 0.252
NP_442975.1_10 Reverse -92 -106 5.50552 0.219
NP_442975.1_10 Forward -109 -95 4.8172 0.239
NP_442975.1_10 Reverse -34 -48 4.22722 0.245
NP_442975.1_10 Reverse -328 -342 1.76896 0.291
NP_440784.1_7 Forward -104 -97 15.9687 0.0123
NP_440784.1_7 Reverse -97 -104 15.9687 0.0123
NP_440061.1_9 Forward -267 -253 8.75042 0.164
NP_440110.1_4 Reverse -85 -104 7.57094 0.142
NP_440110.1_8 Forward -107 -88 2.0644 0.211
NP_440878.1_4 Forward -151 -133 10.1472 0.29
NP_442062.1_8 Forward -105 -95 19.4496 0.000558
NP_442062.1_8 Reverse -96 -106 17.6796 0.00193
NP_442062.1_8 Reverse -256 -266 4.3066 0.221
NP_440761.1_4 Forward -110 -91 -3.93378 0.132
NP_440304.1_4 Forward -107 -97 18.9579 0.00406
NP_440304.1_4 Reverse -94 -104 10.8948 0.051
NP_442242.1_4 Forward -104 -97 14.3954 0.0124
NP_442242.1_4 Reverse -97 -104 14.3954 0.0124
NP_442602.1_3 Forward -298 -279 -2.85214 0.269
NP_441200.1_4 Forward -189 -170 5.01433 0.299
NP_440307.1_2 Forward -99 -80 10.6192 0.122
NP_441208.1_1 Forward -242 -223 -4.6221 0.263
NP_442110.1_7 Forward -105 -91 12.3893 0.0586
NP_441925.1_4 Reverse -80 -99 -17.4058 0.294
NP_440014.1_6 Reverse -87 -106 14.3558 0.217
NP_441083.1_5 Reverse -96 -106 19.3512 0.000718
NP_441083.1_5 Forward -105 -95 11.3864 0.0159
NP_442827.1_8 Reverse -88 -107 11.995 0.05
NP_442827.1_8 Forward -113 -94 2.55527 0.157
NP_441738.1_2 Forward -103 -96 15.28 0.0102
NP_441738.1_2 Reverse -98 -105 15.28 0.0102
NP_441558.1_5 Forward -107 -88 5.60432 0.245
NP_440209.1_1 Reverse -96 -104 18.1123 0.00295
NP_440209.1_1 Forward -105 -97 18.1123 0.00295
NP_442889.1_8 Forward -108 -94 9.24208 0.101
NP_440178.1_7 Forward -106 -87 -13.1769 0.129
NP_442570.1_3 Forward -273 -254 -1.18052 0.212
NP_442570.1_3 Forward -91 -72 -6.49039 0.258
NP_442570.1_3 Reverse -46 -65 -8.752 0.292
NP_441716.1_1 Reverse -96 -110 11.0127 0.0936
NP_441716.1_1 Forward -105 -91 3.73617 0.259
NP_442111.1_4 Forward -106 -92 17.2075 0.0109
NP_441624.1_7 Reverse -182 -196 10.521 0.217
NP_441163.1_1 Reverse -88 -105 13.0178 0.183
NP_441163.1_1 Reverse -351 -368 6.52796 0.255
NP_440906.1_5 Forward -104 -97 15.8704 0.0124
NP_440906.1_5 Reverse -97 -104 15.8704 0.0124
NP_440747.1_10 Reverse -93 -105 7.70879 0.00236
NP_440747.1_10 Forward -108 -96 -1.92764 0.0192
NP_441130.1_10 Reverse -94 -108 11.701 0.106
NP_441486.1_1 Reverse -93 -107 11.5043 0.016
NP_441486.1_1 Forward -108 -94 10.7177 0.0189
NP_441486.1_1 Reverse -253 -267 -4.91696 0.213
NP_441486.1_1 Forward -268 -254 -5.70361 0.254
NP_442634.1_4 Forward -107 -93 6.29277 0.0508
NP_441265.1_3 Forward -111 -97 3.24451 0.181
NP_440470.1_5 Forward -326 -307 5.68135 0.294
NP_440403.1_4 Forward -104 -85 -0.4922 0.166
NP_441014.1_10 Reverse -95 -114 1.47364 0.227
NP_442848.1_5 Reverse -180 -198 -0.472507 0.276
NP_442848.1_9 Reverse -80 -99 -0.787193 0.28
NP_442848.1_9 Forward -82 -63 -0.983855 0.282
NP_441012.1_4 Reverse -81 -94 14.9656 0.188
NP_441012.1_4 Reverse -92 -105 7.19745 0.272
NP_443018.1_3 Forward -104 -97 14.8871 0.0123
NP_443018.1_3 Reverse -97 -104 14.8871 0.0123
NP_443018.1_3 Forward -264 -257 4.26735 0.267
NP_443018.1_3 Reverse -257 -264 4.16902 0.278
NP_441316.1_7 Forward -107 -92 -2.08505 0.243
NP_441634.1_9 Forward -93 -74 14.8466 0.165
NP_440376.1_1 Forward -105 -96 19.4693 0.000692
NP_440376.1_1 Reverse -96 -105 19.4693 0.000692
NP_440376.1_1 Forward -265 -256 4.62128 0.154
NP_440376.1_1 Forward -379 -370 1.37636 0.252
NP_441857.1_5 Forward -272 -254 8.57394 0.185
NP_441857.1_5 Forward -112 -94 3.16574 0.246
NP_442730.1_8 Reverse -88 -107 8.55343 0.185
NP_442687.1_7 Forward -106 -96 18.5646 0.0028
NP_442687.1_7 Reverse -95 -105 15.8113 0.0125
NP_442687.1_7 Reverse -255 -265 13.4514 0.0488
NP_442687.1_7 Forward -45 -35 6.37155 0.171
NP_442191.1_7 Forward -389 -370 13.5691 0.206
NP_442485.1_3 Forward -94 -75 -4.22878 0.278
NP_441846.1_10 Forward -106 -87 -22.9117 0.271
NP_442958.1_3 Reverse -85 -104 -0.590531 0.268
NP_442530.1_2 Reverse -202 -212 15.5163 0.203
NP_440533.1_9 Forward -105 -86 12.7825 0.0866
NP_440667.1_2 Forward -223 -204 -3.24547 0.232
NP_441763.1_10 Reverse -85 -104 10.9134 0.143
NP_442658.1_1 Reverse -94 -104 15.9091 0.00966
NP_442658.1_1 Forward -107 -97 14.8275 0.0188
NP_442782.1_2 Forward -105 -91 7.57108 0.202
NP_440656.1_8 Forward -116 -97 -8.16202 0.273
NP_441414.1_9 Forward -105 -86 -3.93378 0.143
NP_441487.1_6 Reverse -88 -107 10.3242 0.175
NP_441958.1_5 Forward -106 -96 20.5312 0.000966
NP_441958.1_5 Reverse -95 -105 12.2714 0.00183
NP_441958.1_5 Reverse -255 -265 -0.0199663 0.178
NP_442836.1_10 Forward -242 -232 14.0414 0.212
NP_439905.1_1 Reverse -80 -93 9.55739 0.216
NP_442911.1_2 Reverse -86 -105 6.68596 0.0279
NP_441580.1_6 Reverse -85 -104 -5.99873 0.235
NP_440153.1_5 Forward -104 -90 10.3243 0.0989
NP_440153.1_8 Reverse -79 -92 -2.43899 0.238
NP_440993.1_2 Reverse -66 -82 6.25339 0.228
NP_440993.1_2 Reverse -91 -107 2.32015 0.268
NP_440993.1_4 Reverse -74 -91 7.70866 0.226
NP_441099.1_5 Forward -115 -96 2.55606 0.0554
NP_442002.1_9 Forward -106 -99 14.1004 0.074
NP_442002.1_9 Reverse -95 -102 10.7572 0.185
NP_442032.1_5 Forward -120 -110 16.2041 0.279
NP_440475.1_1 Forward -205 -186 10.3899 0.278
NP_441712.1_3 Reverse -73 -86 13.0973 0.288
NP_441294.1_7 Reverse -366 -380 11.0744 0.157
NP_442438.1_10 Reverse -91 -105 19.0758 0.0137
NP_441292.1_2 Reverse -78 -97 -11.2103 0.292
NP_441752.1_6 Reverse -62 -81 -1.08219 0.282
NP_441000.1_6 Reverse -95 -109 3.44117 0.111
NP_441000.1_6 Forward -106 -92 -3.04867 0.221
NP_442771.1_1 Forward -107 -89 18.6037 0.00728
NP_440147.1_4 Reverse -94 -107 3.65753 0.183
NP_440147.1_4 Forward -107 -94 2.67422 0.203
NP_441550.1_8 Forward -107 -97 15.4175 0.0132
NP_441550.1_8 Reverse -94 -104 6.0761 0.214
NP_441550.1_8 Reverse -254 -264 5.58445 0.242
NP_441550.1_8 Forward -370 -360 4.69947 0.291
NP_441916.1_7 Forward -105 -95 18.4663 0.00144
NP_441916.1_7 Reverse -96 -106 16.893 0.00407
NP_441916.1_7 Forward -265 -255 5.28991 0.138
NP_440206.1_4 Reverse -375 -394 8.25844 0.209
NP_441041.1_4 Forward -105 -86 -6.1954 0.164
NP_441041.1_7 Forward -108 -96 13.2483 0.049
NP_441041.1_7 Reverse -93 -105 7.61196 0.162
NP_441725.1_5 Reverse -97 -107 21.0229 0.00533
NP_441725.1_5 Forward -104 -94 11.2881 0.0247
NP_439966.1_7 Reverse -94 -104 18.4657 0.00473
NP_439966.1_7 Forward -107 -97 9.12434 0.119
NP_439966.1_9 Reverse -94 -103 0.983037 0.253
NP_440202.1_8 Reverse -81 -100 9.51453 0.297
NP_442941.1_3 Forward -104 -94 11.4848 0.0116
NP_442941.1_3 Reverse -97 -107 11.3864 0.0116
NP_440289.1_2 Forward -108 -95 15.9489 0.00946
NP_440289.1_2 Reverse -93 -106 14.6706 0.0107
NP_440983.1_9 Reverse -87 -106 -0.000545616 0.295
NP_442281.1_1 Reverse -91 -105 19.7634 0.00247
NP_442281.1_1 Forward -110 -96 12.5853 0.0358
NP_441079.1_7 Reverse -331 -350 -5.80282 0.268
NP_440437.1_1 Reverse -90 -109 19.3707 0.0125
NP_440437.1_1 Forward -111 -92 -5.80207 0.292
NP_442012.1_1 Forward -395 -376 4.03102 0.177
NP_440498.1_1 Reverse -87 -105 11.4255 0.077
NP_442982.1_4 Reverse -328 -347 13.2733 0.231
NP_442982.1_5 Reverse -86 -105 -0.295539 0.254
NP_441644.1_6 Reverse -96 -106 15.7125 0.0048
NP_441644.1_6 Forward -105 -95 10.1076 0.0628
NP_442215.1_2 Forward -107 -91 -1.41643 0.185
NP_442215.1_2 Reverse -94 -110 -1.51476 0.186
NP_442215.1_2 Reverse -87 -103 -7.31629 0.291
NP_442215.1_2 Reverse -350 -366 -7.41462 0.294
NP_440253.1_2 Reverse -96 -114 6.60732 0.0778
NP_440929.1_8 Forward -105 -96 19.2726 0.000701
NP_440929.1_8 Reverse -96 -105 19.2726 0.000701
NP_442933.1_10 Forward -105 -96 17.601 0.00325
NP_442933.1_10 Reverse -96 -105 17.601 0.00325
NP_442933.1_10 Forward -265 -256 5.01461 0.204
NP_441310.1_10 Reverse -142 -152 16.6663 0.0807
NP_441751.2_8 Reverse -97 -111 3.24451 0.0692
NP_441751.2_8 Forward -104 -90 0.786239 0.112
NP_442926.1_5 Reverse -91 -110 9.979 0.264
NP_442554.1_4 Reverse -174 -193 11.0125 0.252
NP_442554.1_8 Reverse -97 -107 14.828 0.0108
NP_442554.1_8 Forward -104 -94 13.8447 0.0145
NP_442554.1_8 Forward -264 -254 4.50326 0.184
NP_442554.1_8 Reverse -80 -90 2.53664 0.268
NP_442554.1_8 Reverse -360 -370 1.94665 0.288
NP_441762.1_7 Forward -106 -94 11.4454 0.0142
NP_441762.1_7 Reverse -95 -107 2.20226 0.0676
NP_442142.1_4 Forward -108 -95 16.4399 0.0264
NP_442142.1_4 Reverse -93 -106 10.4418 0.0724
NP_442292.1_1 Forward -104 -95 9.63616 0.0183
NP_442292.1_1 Reverse -97 -106 9.53783 0.0183
NP_442292.1_5 Forward -109 -90 -0.787193 0.257
NP_440919.1_7 Forward -286 -268 5.74015 0.285
NP_441525.1_1 Forward -372 -359 15.7522 0.206
NP_442476.1_6 Forward -264 -250 0.294584 0.267
NP_443009.1_5 Forward -106 -95 20.6093 0.001
NP_443009.1_5 Reverse -95 -106 9.10461 0.0965
NP_441715.1_4 Forward -104 -94 16.303 0.0117
NP_441715.1_4 Reverse -97 -107 7.25653 0.108
NP_441448.1_1 Forward -397 -378 5.80098 0.261
NP_441198.1_8 Forward -107 -97 13.076 0.108
NP_440379.1_5 Reverse -70 -89 -8.26035 0.25
NP_440379.1_6 Forward -373 -354 3.73603 0.274
NP_441468.1_1 Forward -104 -97 15.8704 0.0124
NP_441468.1_1 Reverse -97 -104 15.8704 0.0124
NP_441468.1_1 Forward -264 -257 4.36568 0.237
NP_439939.1_1 Reverse -69 -88 13.5683 0.275
NP_441020.2_6 Reverse -94 -111 10.5603 0.141
NP_441020.2_6 Forward -107 -90 9.87194 0.159
NP_441015.1_1 Reverse -180 -198 8.47561 0.277
NP_441015.1_10 Forward -104 -85 -11.5053 0.298
NP_441673.1_1 Forward -105 -96 20.8459 0.000698
NP_441673.1_1 Reverse -96 -105 20.8459 0.000698
NP_441731.1_3 Forward -388 -369 -4.52377 0.284
NP_441826.1_1 Forward -384 -368 19.0364 0.153
NP_441826.1_2 Reverse -90 -104 23.009 0.00229
NP_441826.1_2 Forward -111 -97 -4.32697 0.295
NP_441826.1_5 Forward -202 -183 2.3594 0.276
NP_441637.1_9 Forward -165 -147 -1.45582 0.292
NP_441764.1_7 Forward -169 -150 17.3048 0.225
NP_442868.1_6 Forward -107 -97 9.22315 0.0527
NP_442868.1_6 Reverse -94 -104 0.963343 0.205
NP_442868.1_6 Reverse -254 -264 0.668351 0.213
NP_441056.1_1 Reverse -96 -115 -4.42544 0.249
NP_440806.1_1 Forward -353 -335 17.3254 0.1
NP_442361.1_3 Reverse -90 -103 9.36073 0.276
NP_442808.1_1 Reverse -95 -105 18.4657 0.00201
NP_442808.1_1 Forward -106 -96 8.73102 0.0481
NP_442808.1_1 Reverse -369 -379 5.68278 0.144
NP_442808.1_1 Reverse -232 -242 1.74956 0.281
NP_442542.1_2 Reverse -94 -107 11.229 0.114
NP_442542.1_9 Reverse -89 -103 8.45543 0.161
NP_442050.1_1 Forward -106 -87 6.29264 0.292
NP_442050.1_5 Forward -107 -97 15.8108 0.0091
NP_442050.1_5 Reverse -94 -104 9.12434 0.193
NP_440558.1_2 Reverse -376 -395 -0.787193 0.204
NP_440558.1_2 Reverse -247 -266 -4.6221 0.247
NP_440558.1_2 Reverse -361 -380 -7.57203 0.296
NP_441518.1_3 Forward -115 -96 -3.24547 0.114
NP_441878.1_6 Forward -106 -96 20.2362 0.0046
NP_441878.1_6 Reverse -95 -105 10.4031 0.0176
NP_441878.1_6 Reverse -255 -265 -0.0199663 0.163
NP_441878.1_6 Forward -266 -256 -7.29646 0.217
NP_441036.1_8 Reverse -95 -105 17.7779 0.000554
NP_441036.1_8 Forward -106 -96 8.4365 0.174
NP_441557.1_5 Forward -105 -96 19.9609 0.000699
NP_441557.1_5 Reverse -96 -105 19.9609 0.000699
NP_441557.1_5 Reverse -256 -265 -0.590259 0.219
NP_441445.1_1 Forward -114 -95 14.0608 0.0527
NP_442066.2_4 Forward -105 -86 -5.60541 0.243
NP_442066.2_4 Forward -196 -177 -8.06369 0.293
NP_442066.2_7 Reverse -180 -199 7.27595 0.246
NP_442066.2_9 Reverse -20 -33 7.59077 0.218
NP_441739.1_2 Reverse -225 -241 6.2527 0.227
NP_441308.1_8 Reverse -94 -104 10.1081 0.22
NP_442183.1_1 Forward -105 -91 9.93102 0.0903
NP_442183.1_1 Reverse -96 -110 9.14437 0.101
NP_442397.1_9 Forward -105 -86 8.06259 0.246
NP_441574.1_1 Forward -211 -192 -5.9004 0.27
NP_440058.1_6 Forward -244 -225 3.73603 0.291
NP_441549.1_9 Forward -109 -91 -7.65067 0.209
NP_442347.1_2 Forward -104 -95 11.1111 0.056
NP_442347.1_2 Reverse -97 -106 3.34298 0.284
NP_442645.1_2 Forward -376 -357 -12.8819 0.144
NP_442645.1_2 Reverse -362 -381 -22.42 0.291
NP_441037.1_3 Forward -92 -74 20.0787 0.0475
NP_441037.1_4 Forward -107 -97 9.65667 0.21
NP_441037.1_4 Reverse -94 -104 7.02532 0.237
NP_440151.1_5 Forward -100 -81 6.39097 0.24
NP_441633.1_3 Reverse -94 -107 5.62415 0.0481
NP_441633.1_3 Forward -107 -94 -5.88057 0.236
NP_440136.1_2 Forward -104 -97 15.9687 0.0123
NP_440136.1_2 Reverse -97 -104 15.9687 0.0123
NP_442590.1_10 Forward -105 -86 6.58763 0.241
NP_442590.1_10 Forward -112 -93 4.12936 0.281
NP_442998.1_5 Forward -185 -175 12.6647 0.162
NP_442998.1_5 Reverse -145 -155 11.1898 0.191
NP_442998.1_10 Forward -103 -96 15.5754 0.0102
NP_442998.1_10 Reverse -98 -105 15.5754 0.0102
NP_440899.1_2 Forward -116 -97 9.83173 0.172
NP_440299.1_1 Reverse -92 -105 20.1765 0.00128
NP_441799.1_1 Forward -109 -95 13.5686 0.0311
NP_441799.1_1 Reverse -252 -266 8.25877 0.12
NP_441799.1_1 Forward -372 -358 4.62054 0.242
NP_442201.1_10 Reverse -85 -104 -0.983855 0.132
NP_442201.1_10 Forward -389 -370 -14.6519 0.285
NP_442333.2_5 Reverse -85 -104 -10.1286 0.246
NP_442333.2_5 Forward -116 -97 -15.0452 0.288
NP_440256.1_1 Reverse -93 -112 -1.18052 0.101
NP_440256.1_1 Forward -108 -89 -6.78538 0.22
NP_442961.1_4 Reverse -347 -366 3.53937 0.288
NP_440087.1_1 Reverse -247 -266 -7.96535 0.276
NP_441362.1_5 Reverse -148 -166 11.5237 0.231
NP_441362.1_5 Reverse -280 -298 10.9495 0.247
NP_441090.1_6 Reverse -126 -140 15.8309 0.111
NP_440456.1_7 Forward -187 -173 13.3726 0.281
NP_441559.1_8 Reverse -91 -105 2.45787 0.143
NP_440915.1_6 Reverse -92 -106 13.4709 0.0187
NP_440915.1_6 Forward -109 -95 -3.147 0.29
NP_442866.1_1 Forward -94 -75 -9.24366 0.292
NP_441464.1_8 Reverse -96 -110 9.04604 0.192
NP_441199.1_6 Reverse -92 -111 10.2259 0.0781
NP_442993.1_1 Forward -105 -89 2.8118 0.0502
NP_442993.1_1 Reverse -96 -112 1.43517 0.0542
NP_442386.1_9 Reverse -95 -104 15.7322 0.0144
NP_442386.1_9 Forward -106 -97 6.39082 0.219
NP_442386.1_9 Reverse -233 -242 5.30919 0.257
NP_440570.1_5 Forward -281 -262 -2.75381 0.28
NP_441750.1_4 Reverse -92 -111 14.6508 0.0872
NP_441340.1_5 Forward -104 -97 15.6737 0.0124
NP_441340.1_5 Reverse -97 -104 15.6737 0.0124
NP_441340.1_5 Reverse -257 -264 4.07068 0.239
NP_441340.1_9 Forward -169 -159 8.93007 0.256
NP_441947.1_4 Forward -116 -97 19.2723 0.0467
NP_442791.1_4 Reverse -122 -141 14.5524 0.216
NP_440168.1_4 Forward -390 -371 -6.68705 0.26
NP_442240.1_2 Forward -104 -85 -4.13045 0.0842
NP_442240.1_2 Forward -93 -74 -13.2752 0.167
NP_440161.1_3 Reverse -94 -113 16.2241 0.084
NP_440586.1_8 Forward -104 -97 13.2151 0.026
NP_440586.1_8 Reverse -97 -104 13.2151 0.026
NP_440586.1_8 Reverse -257 -264 7.70858 0.227
NP_440586.1_8 Forward -367 -360 5.8403 0.283
NP_442251.1_6 Forward -104 -97 15.2804 0.0124
NP_442251.1_6 Reverse -97 -104 15.2804 0.0124
NP_440192.1_4 Reverse -185 -204 8.9125 0.289
NP_442959.1_5 Reverse -147 -166 7.66927 0.23
NP_441262.1_3 Reverse -96 -103 14.7888 0.0223
NP_441262.1_3 Forward -105 -98 14.7888 0.0223
NP_440027.1_3 Reverse -79 -97 12.8014 0.156
NP_440027.1_3 Reverse -370 -388 7.3932 0.211
NP_440027.1_3 Reverse -86 -104 6.01657 0.23
NP_440027.1_3 Reverse -80 -98 4.83661 0.25
NP_443051.1_1 Forward -106 -97 18.0926 0.00402
NP_443051.1_1 Reverse -95 -104 10.4228 0.00754
NP_443051.1_1 Reverse -255 -264 -1.18024 0.297
NP_439937.1_8 Reverse -191 -210 -4.91709 0.286
NP_439937.1_9 Reverse -255 -272 -16.2847 0.287
NP_439937.1_9 Reverse -95 -112 -16.5797 0.287
NP_441595.1_2 Reverse -283 -296 9.89744 0.277
NP_440439.1_1 Reverse -93 -106 17.5222 0.0105
NP_440439.1_1 Forward -108 -95 0.215946 0.199
NP_440372.1_2 Forward -104 -97 16.3621 0.0124
NP_440372.1_2 Reverse -97 -104 16.3621 0.0124
NP_440819.1_5 Reverse -299 -307 8.08256 0.185
NP_441803.1_2 Reverse -91 -110 7.57094 0.134
NP_440139.1_1 Forward -111 -92 14.7483 0.0474
NP_440210.1_10 Forward -320 -301 5.11187 0.296
NP_441572.1_7 Reverse -90 -109 7.86593 0.0744
NP_441572.1_7 Reverse -353 -372 -4.32711 0.232
NP_440267.1_2 Forward -110 -96 7.47213 0.196
NP_442384.1_10 Forward -105 -92 15.7522 0.00946
NP_442384.1_10 Forward -265 -252 10.344 0.0461
NP_442384.1_10 Reverse -79 -92 5.32916 0.131
NP_442384.1_10 Reverse -96 -109 1.69091 0.249
NP_441018.1_7 Forward -345 -326 10.3242 0.209
NP_441018.1_7 Reverse -44 -63 8.84924 0.239
NP_442790.1_4 Reverse -87 -106 -14.8485 0.282
NP_442262.1_10 Forward -104 -97 14.1988 0.0123
NP_442262.1_10 Reverse -97 -104 14.1988 0.0123
NP_441689.1_5 Forward -107 -97 8.63269 0.132
NP_441689.1_5 Reverse -94 -104 8.53436 0.132
NP_442244.1_3 Forward -102 -83 17.5024 0.0927
NP_442244.1_3 Reverse -355 -374 15.7324 0.0969
NP_440163.1_10 Reverse -93 -103 16.303 0.0762
NP_440344.1_10 Forward -112 -95 14.1002 0.00588
NP_440531.1_6 Forward -113 -94 8.45592 0.0844
NP_440531.1_6 Forward -273 -254 5.30933 0.115
NP_440562.1_1 Forward -54 -35 11.7983 0.276
NP_441965.1_10 Forward -108 -92 5.46674 0.204
NP_441965.1_10 Reverse -253 -269 3.30346 0.266
NP_440297.1_9 Reverse -97 -107 19.0562 0.0359
NP_440297.1_9 Forward -104 -94 9.32148 0.0917
NP_440297.1_9 Forward -264 -254 -0.216628 0.282
NP_442280.1_10 Forward -82 -64 5.55182 0.283
NP_442280.1_10 Forward -92 -74 5.45442 0.284
NP_441896.1_5 Forward -191 -184 12.2322 0.273
NP_440894.1_10 Forward -110 -91 7.07928 0.209
NP_440894.1_10 Forward -85 -66 6.29264 0.217
NP_442067.1_4 Reverse -85 -104 7.86593 0.194
NP_440999.1_9 Reverse -92 -106 10.9143 0.0483
NP_440999.1_9 Reverse -379 -393 3.14618 0.135
NP_440888.1_2 Forward -105 -91 17.6002 0.00354
NP_440888.1_2 Reverse -96 -110 7.66879 0.186
NP_440491.1_1 Forward -108 -89 9.74328 0.206
NP_439969.1_3 Reverse -91 -110 2.55606 0.241
NP_441917.1_1 Forward -213 -194 7.07928 0.257
NP_441543.1_2 Forward -104 -95 18.486 0.00236
NP_441543.1_2 Reverse -97 -106 9.34117 0.0818
NP_442845.1_2 Forward -105 -91 7.47274 0.195
NP_442845.1_2 Reverse -90 -104 7.47274 0.195
NP_442845.1_2 Forward -271 -257 4.52282 0.258
NP_441551.1_5 Reverse -92 -108 7.03934 0.249
NP_441551.1_5 Forward -92 -76 5.95771 0.291
NP_441469.1_8 Reverse -95 -104 16.126 0.00797
NP_441469.1_8 Forward -106 -97 13.3727 0.073
NP_443064.1_6 Reverse -96 -106 13.8273 0.0796
NP_442337.1_8 Forward -276 -257 7.47261 0.191
NP_442578.1_7 Forward -104 -97 14.5921 0.026
NP_442578.1_7 Reverse -97 -104 14.5921 0.026
NP_441462.1_2 Reverse -96 -106 20.1379 0.000967
NP_441462.1_2 Forward -105 -95 11.5831 0.00406
NP_441621.1_7 Forward -107 -93 4.52282 0.0934
NP_443062.1_1 Forward -105 -87 11.8612 0.091
NP_443062.1_6 Forward -113 -94 4.916 0.213
NP_443062.1_6 Forward -273 -254 0.294447 0.299
NP_440519.1_8 Forward -394 -378 4.58176 0.221
NP_442204.1_1 Reverse -122 -133 15.3983 0.0565
NP_442204.1_1 Reverse -92 -103 9.69511 0.0736
NP_442204.1_5 Reverse -86 -105 16.7157 0.0372
NP_440516.1_2 Reverse -250 -268 -2.24246 0.299
NP_440516.1_8 Forward -105 -96 16.9127 0.00442
NP_440516.1_8 Reverse -96 -105 16.9127 0.00442
NP_440516.1_8 Forward -368 -359 5.80125 0.112
NP_442428.1_4 Forward -106 -87 4.81767 0.222
NP_442428.1_5 Forward -104 -97 15.8704 0.0124
NP_442428.1_5 Reverse -97 -104 15.8704 0.0124
NP_442428.1_5 Forward -264 -257 4.66067 0.244
NP_440673.1_2 Forward -115 -96 9.51162 0.243
NP_440673.1_3 Forward -103 -96 12.4288 0.0426
NP_440673.1_3 Reverse -98 -105 12.4288 0.0426
NP_440673.1_7 Reverse -85 -104 8.65258 0.123
NP_440865.1_9 Forward -111 -92 1.47442 0.118
NP_441052.1_2 Forward -105 -95 10.5014 0.0285
NP_441052.1_2 Reverse -96 -106 10.4031 0.0285
NP_442219.1_9 Forward -104 -95 8.35786 0.0681
NP_442219.1_9 Reverse -97 -106 8.25953 0.0681
NP_440436.1_4 Forward -104 -95 18.1905 0.00233
NP_440436.1_4 Reverse -97 -106 15.9289 0.00508
NP_441884.1_8 Forward -106 -87 -5.11376 0.172
NP_441884.1_9 Reverse -380 -399 -10.9153 0.0908
NP_441884.1_9 Forward -108 -89 -24.19 0.284
NP_441669.1_2 Forward -164 -150 15.3386 0.279
NP_441719.1_4 Forward -104 -97 16.3621 0.0124
NP_441719.1_4 Reverse -97 -104 16.3621 0.0124
NP_441733.1_10 Forward -108 -95 9.65572 0.112
NP_441733.1_10 Reverse -93 -106 6.01747 0.203
NP_442366.1_3 Forward -106 -88 12.9005 0.0272
NP_442366.1_3 Reverse -95 -113 -4.11075 0.264
NP_442366.1_3 Forward -369 -351 -4.8974 0.278
NP_441437.1_1 Forward -264 -245 7.07928 0.282
NP_440323.1_6 Forward -223 -205 16.5388 0.165
NP_442873.1_3 Forward -90 -71 4.71854 0.262
NP_441115.1_4 Forward -106 -88 8.96649 0.229
NP_443054.1_2 Reverse -94 -108 10.521 0.0761
NP_443054.1_2 Forward -107 -93 4.91614 0.24
NP_441851.1_10 Forward -106 -96 17.4829 0.0027
NP_441851.1_10 Reverse -95 -105 16.008 0.00552
NP_441851.1_10 Reverse -255 -265 6.27322 0.178
NP_442208.1_5 Forward -198 -179 -6.49039 0.266
NP_442622.1_8 Reverse -96 -114 -18.7621 0.268
NP_441542.1_4 Forward -187 -173 5.60446 0.264
NP_442856.1_7 Reverse -87 -106 -0.688862 0.209
NP_442515.1_1 Reverse -95 -109 3.53951 0.117
NP_442515.1_1 Forward -106 -92 -4.91696 0.298
NP_442709.1_4 Forward -350 -331 4.70179 0.253
NP_440940.1_7 Reverse -86 -104 5.42659 0.226
NP_441349.1_10 Reverse -86 -105 9.73422 0.0238
NP_441349.1_10 Forward -115 -96 -9.63698 0.297
NP_441409.1_6 Reverse -90 -109 -7.08038 0.142
NP_441409.1_6 Forward -111 -92 -14.3569 0.255
NP_440432.1_9 Reverse -97 -112 9.91133 0.0419
NP_440474.1_8 Reverse -97 -111 5.30886 0.251
NP_440726.1_2 Reverse -86 -105 4.32602 0.224
NP_441477.1_10 Reverse -89 -107 5.13236 0.199
NP_442450.1_5 Forward -107 -97 19.1546 0.0103
NP_442450.1_5 Reverse -94 -104 9.32148 0.115
NP_442168.1_5 Reverse -366 -385 -3.54046 0.287
NP_440588.1_2 Reverse -87 -106 17.5024 0.0107
NP_440588.1_2 Reverse -350 -369 -3.63879 0.191
NP_441003.1_9 Reverse -87 -106 12.8808 0.213
NP_441570.1_1 Forward -105 -87 1.78911 0.0286
NP_441570.1_1 Reverse -96 -114 1.69077 0.029
NP_440078.1_10 Forward -105 -86 11.1109 0.164
NP_441078.1_4 Forward -105 -96 19.6659 0.0007
NP_441078.1_4 Reverse -96 -105 19.6659 0.0007
NP_441078.1_4 Forward -265 -256 -1.86856 0.272
NP_442729.1_8 Reverse -92 -105 8.08242 0.125
NP_442388.1_3 Forward -392 -373 6.39097 0.282
NP_441663.1_8 Reverse -90 -109 1.0811 0.212
NP_442348.1_2 Forward -89 -80 6.68623 0.299
NP_440707.1_6 Reverse -88 -107 10.4217 0.283
NP_442443.1_1 Reverse -353 -372 3.53937 0.169
NP_440526.1_3 Reverse -97 -108 10.8746 0.0646
NP_441432.1_8 Forward -106 -97 8.35786 0.0755
NP_441432.1_8 Reverse -95 -104 8.25953 0.0755
NP_441333.1_1 Forward -217 -207 11.6853 0.241
NP_442320.1_8 Reverse -90 -104 5.01447 0.0442
NP_442320.1_8 Forward -111 -97 -3.24533 0.113
NP_441732.1_2 Reverse -92 -108 -7.70961 0.0885
NP_442003.1_4 Reverse -97 -116 9.53756 0.3
NP_442797.1_2 Reverse -251 -269 15.2837 0.204
NP_442797.1_7 Reverse -358 -376 2.18243 0.245
NP_442797.1_7 Reverse -89 -107 0.904127 0.271
NP_442274.1_8 Forward -149 -131 14.1424 0.286
NP_440199.1_10 Forward -108 -98 7.74818 0.231
NP_441057.1_4 Forward -395 -377 -1.75081 0.272
NP_442353.1_4 Forward -367 -348 11.6017 0.0922
NP_442751.1_2 Reverse -369 -388 5.89851 0.239
NP_442489.1_7 Forward -105 -96 20.1576 0.000695
NP_442489.1_7 Reverse -96 -105 20.1576 0.000695
NP_442489.1_7 Forward -265 -256 -1.37691 0.195
NP_440941.1_1 Forward -244 -234 17.9746 0.127
NP_442079.1_7 Reverse -97 -116 4.32602 0.192
NP_440559.1_1 Reverse -97 -106 17.306 0.00658
NP_440559.1_1 Forward -104 -95 8.75118 0.0586
NP_441659.2_8 Reverse -96 -106 19.3512 0.000966
NP_441659.2_8 Forward -105 -95 11.9764 0.0147
NP_442749.1_5 Reverse -308 -325 10.9231 0.183
NP_441022.1_1 Reverse -340 -349 12.3136 0.238
NP_441040.1_2 Forward -107 -88 -12.1936 0.255
NP_441968.1_1 Reverse -299 -307 14.1787 0.286
NP_440779.1_5 Reverse -96 -113 -4.58271 0.116
NP_442346.1_5 Forward -106 -96 17.9746 0.00128
NP_442346.1_5 Reverse -95 -105 9.02648 0.118
NP_442346.1_5 Reverse -255 -265 6.96153 0.187
NP_442346.1_5 Forward -266 -256 4.20827 0.296
NP_440545.1_3 Forward -109 -92 4.6604 0.0679
NP_441856.1_3 Reverse -35 -54 2.75272 0.19
NP_440831.1_3 Reverse -87 -106 19.3955 0.0431
NP_440459.1_2 Forward -107 -90 12.1336 0.158
NP_440459.1_2 Forward -97 -80 9.38028 0.229
NP_442603.1_7 Forward -105 -91 11.602 0.114
NP_441888.1_7 Reverse -91 -105 3.8345 0.225
NP_441948.1_4 Forward -112 -94 16.7354 0.0174
NP_441833.1_4 Forward -104 -97 15.9687 0.0124
NP_441833.1_4 Reverse -97 -104 15.9687 0.0124
NP_441329.1_6 Reverse -287 -306 -2.24448 0.294
NP_441112.1_6 Forward -115 -96 -1.47551 0.296
NP_442162.1_9 Forward -104 -97 16.2637 0.0124
NP_442162.1_9 Reverse -97 -104 16.2637 0.0124
NP_442796.1_10 Reverse -190 -209 11.7992 0.234
NP_440671.1_2 Forward -77 -63 18.1908 0.0965
NP_440671.1_4 Reverse -90 -104 21.6324 0.00303
NP_440671.1_4 Reverse -187 -201 8.75105 0.191
NP_440671.1_4 Forward -111 -97 5.50613 0.281
NP_441915.1_4 Reverse -231 -250 9.14342 0.28
NP_441915.1_4 Reverse -180 -199 6.58682 0.293
NP_442140.1_3 Forward -367 -357 10.5998 0.0902
NP_442140.1_3 Forward -104 -94 8.33817 0.119
NP_442140.1_3 Reverse -97 -107 5.68323 0.198
NP_440875.1_9 Forward -103 -93 9.05339 0.233
NP_440875.1_9 Forward -96 -86 9.05339 0.233
NP_441813.1_5 Reverse -94 -104 17.188 0.00979
NP_441813.1_5 Forward -107 -97 16.1063 0.01
NP_442886.1_1 Reverse -8 -22 17.1092 0.259
NP_440590.1_4 Forward -104 -91 4.8375 0.0585
NP_440590.1_4 Reverse -97 -110 -3.81562 0.255
NP_440567.1_1 Forward -104 -90 13.2743 0.0213
NP_442497.1_10 Reverse -97 -106 19.8626 0.00532
NP_442497.1_10 Forward -104 -95 10.4228 0.0087
NP_442497.1_10 Forward -264 -255 0.589713 0.153
NP_440821.1_4 Forward -107 -97 19.8429 0.00399
NP_440821.1_4 Reverse -94 -104 19.0562 0.00399
NP_441239.1_9 Reverse -94 -106 16.8536 0.0155
NP_441239.1_9 Forward -107 -95 14.297 0.0288
NP_441239.1_9 Reverse -77 -89 4.66053 0.248
NP_441892.1_1 Forward -114 -97 11.2486 0.0574
NP_441892.1_1 Reverse -87 -104 2.30045 0.141
NP_441892.1_1 Reverse -367 -384 1.71047 0.148
NP_440604.1_6 Forward -105 -86 -2.95047 0.225
NP_442138.1_10 Reverse -96 -115 -7.08038 0.286
NP_442138.1_10 Forward -105 -86 -7.4737 0.29
NP_440500.1_1 Forward -388 -369 13.6675 0.181
NP_441782.1_5 Forward -113 -94 6.88262 0.287
NP_442809.1_6 Reverse -84 -103 9.53756 0.256
NP_440546.1_4 Reverse -96 -106 12.8578 0.0572
NP_440546.1_4 Forward -105 -95 11.8882 0.0679
NP_440546.1_4 Forward -368 -358 6.74945 0.282
NP_440546.1_7 Forward -368 -358 14.9263 0.279
NP_440675.1_1 Forward -395 -376 1.17943 0.299
NP_441656.1_6 Forward -106 -87 14.0608 0.151
NP_441656.1_6 Forward -203 -184 7.27595 0.248
NP_440462.1_6 Reverse -94 -104 15.418 0.0142
NP_440462.1_6 Forward -107 -97 7.84651 0.0699
NP_442611.1_1 Forward -197 -178 4.42435 0.194
NP_442611.1_1 Forward -105 -86 -1.67217 0.282
NP_440868.1_4 Reverse -92 -104 8.6921 0.0582
NP_440868.1_4 Forward -109 -97 -0.74767 0.282
NP_442479.1_5 Forward -347 -328 6.13556 0.26
NP_441672.1_10 Reverse -361 -380 13.7658 0.244
NP_440812.1_4 Reverse -142 -161 13.2796 0.25
NP_442258.1_3 Reverse -60 -79 2.85105 0.224
NP_441084.1_6 Reverse -77 -91 12.4467 0.16
NP_441084.1_6 Reverse -254 -268 9.8289 0.263
NP_440653.1_10 Reverse -296 -315 8.65258 0.197
NP_440696.1_3 Forward -98 -80 16.5388 0.0614
NP_440696.1_3 Forward -389 -371 8.18062 0.16
NP_440696.1_3 Forward -83 -65 1.19912 0.22
NP_442039.1_4 Forward -104 -97 15.1821 0.0124
NP_442039.1_4 Reverse -97 -104 15.1821 0.0124
NP_442039.1_10 Reverse -167 -185 10.0481 0.293
NP_442380.1_10 Forward -206 -188 7.09898 0.294
NP_440008.1_9 Reverse -90 -109 8.45592 0.283
NP_441926.1_3 Forward -317 -301 2.51681 0.269
NP_442837.1_3 Forward -104 -97 15.7721 0.0124
NP_442837.1_3 Reverse -97 -104 15.7721 0.0124
NP_440160.1_2 Reverse -78 -97 -7.17871 0.283
NP_442053.1_1 Forward -105 -96 18.3876 0.0007
NP_442053.1_1 Reverse -96 -105 18.3876 0.0007
NP_440505.1_3 Reverse -94 -104 13.8447 0.0247
NP_440505.1_3 Forward -107 -97 7.55152 0.151
NP_441252.1_6 Forward -237 -230 11.9372 0.25
NP_441203.1_1 Forward -104 -85 9.53756 0.0238
NP_442255.1_2 Reverse -377 -396 14.0608 0.125
NP_440914.1_1 Forward -105 -95 8.6151 0.186
NP_440914.1_1 Reverse -96 -106 8.51751 0.186
NP_441011.1_8 Forward -104 -95 16.9127 0.00602
NP_441011.1_8 Reverse -97 -106 14.356 0.0249
NP_441011.1_8 Forward -229 -220 5.60459 0.247
NP_442101.1_10 Reverse -88 -107 13.4708 0.0272
NP_442533.1_1 Forward -108 -89 -15.7335 0.257
NP_442533.1_6 Forward -105 -96 17.2076 0.00137
NP_442533.1_6 Reverse -96 -105 17.2076 0.00137
NP_442533.1_6 Reverse -256 -265 6.19458 0.115
NP_442533.1_6 Forward -88 -79 5.11294 0.155
NP_442533.1_6 Reverse -85 -94 2.16301 0.27
NP_442541.1_10 Reverse -79 -93 5.80051 0.248
NP_440263.1_5 Forward -323 -309 10.9143 0.294
NP_442232.1_3 Forward -376 -357 -14.6519 0.288
NP_442322.1_4 Reverse -77 -94 -9.99156 0.297
NP_441482.1_7 Reverse -90 -104 0.687908 0.0554
NP_441482.1_7 Forward -111 -97 -9.04686 0.193
NP_441482.1_7 Reverse -79 -93 -11.4068 0.262
NP_439944.1_9 Reverse -97 -107 17.3846 0.00516
NP_439944.1_9 Forward -104 -94 10.3048 0.0887
NP_441028.1_6 Forward -153 -143 7.74772 0.218
NP_440116.1_8 Forward -104 -85 -9.14533 0.268
NP_441347.1_5 Forward -380 -366 8.55376 0.285
NP_441961.1_4 Forward -81 -62 3.44104 0.277
NP_441972.1_5 Forward -104 -85 -9.83364 0.293
NP_441106.1_1 Reverse -95 -104 18.191 0.0028
NP_441106.1_1 Forward -106 -97 9.73449 0.0311
NP_440429.1_4 Reverse -89 -108 9.93088 0.299
NP_441286.1_1 Reverse -95 -107 14.3953 0.00424
NP_441286.1_1 Forward -106 -94 5.05386 0.0259
NP_442674.1_2 Forward -160 -141 6.78429 0.296
NP_440670.1_8 Forward -105 -96 18.3876 0.000699
NP_440670.1_8 Reverse -96 -105 18.3876 0.000699
NP_441705.1_3 Forward -199 -180 -6.1954 0.291
NP_441930.1_3 Reverse -268 -287 10.942 0.217
NP_440886.1_7 Reverse -95 -105 17.7774 0.0011
NP_440886.1_7 Forward -106 -96 8.04271 0.0805
NP_442614.1_2 Reverse -256 -270 11.406 0.2
NP_442614.1_2 Reverse -96 -110 6.98109 0.276
NP_442072.1_9 Forward -106 -88 -3.91409 0.0388
NP_442401.1_2 Reverse -376 -395 7.86512 0.255
NP_440907.2_8 Reverse -97 -107 9.81266 0.103
NP_440907.2_8 Forward -104 -94 7.84605 0.117
NP_442264.1_2 Forward -109 -92 6.92201 0.25
NP_442264.1_4 Forward -372 -358 19.1741 0.22
NP_440666.1_6 Reverse -16 -35 9.63589 0.171
NP_441463.1_3 Forward -115 -96 -10.1286 0.289
NP_441463.1_6 Forward -107 -93 6.22266 0.279
NP_441626.1_2 Forward -104 -97 15.7721 0.0124
NP_441626.1_2 Reverse -97 -104 15.7721 0.0124
NP_442794.1_1 Reverse -92 -104 10.1671 0.0721
NP_442615.1_1 Forward -114 -96 -5.38906 0.212
NP_440387.1_1 Forward -105 -89 15.5948 0.00527
NP_441431.1_2 Reverse -253 -267 14.5519 0.0636
NP_441431.1_2 Reverse -86 -100 11.012 0.149
NP_441431.1_2 Forward -388 -374 6.0955 0.28
NP_441836.1_2 Forward -94 -75 -3.3438 0.237
NP_441993.1_1 Forward -105 -86 13.8365 0.0786
NP_440114.1_10 Reverse -96 -110 16.1259 0.02
NP_440114.1_10 Reverse -359 -373 11.3077 0.118
NP_441858.1_10 Forward -58 -39 3.14605 0.292
NP_442323.1_7 Reverse -91 -110 4.42355 0.217
NP_441510.2_7 Reverse -90 -104 10.717 0.28
NP_441552.1_3 Forward -112 -93 12.88 0.292
NP_440293.1_3 Forward -90 -71 3.53937 0.192
NP_440766.1_4 Reverse -92 -106 15.2409 0.0269
NP_440766.1_4 Forward -109 -95 8.35772 0.0871
NP_439988.1_3 Forward -195 -181 18.4858 0.144
NP_439988.1_3 Forward -103 -89 6.3911 0.278
NP_441979.1_5 Reverse -90 -109 -12.0953 0.228
NP_442743.1_4 Forward -104 -85 -7.08038 0.279
NP_439910.1_2 Forward -113 -96 -12.1542 0.0788
NP_440457.1_1 Forward -109 -97 9.87208 0.092
NP_440457.1_1 Reverse -92 -104 8.29878 0.101
NP_440987.1_4 Reverse -317 -336 3.34271 0.283
NP_440798.1_6 Forward -104 -91 3.85419 0.147
NP_441981.1_3 Reverse -145 -159 15.7693 0.268
NP_442680.1_5 Reverse -109 -128 6.81287 0.206
NP_442680.1_7 Forward -21 -2 -6.39206 0.265
NP_441332.1_6 Reverse -232 -242 10.8723 0.282
NP_441889.1_4 Reverse -87 -106 11.7008 0.0842
NP_441436.1_8 Forward -106 -87 13.0775 0.215
NP_442509.1_9 Reverse -96 -106 17.3841 0.00128
NP_442509.1_9 Forward -105 -95 16.2041 0.00739
NP_440554.1_4 Forward -104 -94 14.6313 0.02
NP_440554.1_4 Reverse -97 -107 6.96153 0.107
NP_441885.1_5 Forward -105 -95 11.4848 0.00668
NP_441885.1_5 Reverse -96 -106 11.3864 0.00668
NP_441885.1_5 Reverse -256 -266 0.963343 0.116
NP_442310.1_1 Forward -90 -71 11.7992 0.244
NP_442341.1_5 Reverse -56 -75 12.3892 0.249
NP_442341.1_7 Forward -106 -92 15.5359 0.0218
NP_442341.1_7 Reverse -95 -109 7.07942 0.111
NP_442341.1_9 Reverse -94 -108 15.0436 0.0564
NP_441756.1_5 Reverse -92 -111 1.67108 0.215
NP_442395.2_4 Forward -106 -87 15.0432 0.0507
NP_442534.1_7 Forward -96 -77 12.7825 0.181
NP_442534.1_7 Forward -106 -87 9.83255 0.221
NP_440423.1_6 Forward -113 -94 -4.81876 0.131
NP_443000.1_7 Forward -107 -97 8.82982 0.0437
NP_443000.1_7 Reverse -94 -104 8.73149 0.0437
NP_440507.2_3 Reverse -87 -106 9.93006 0.213
NP_440507.2_3 Forward -114 -95 6.88182 0.297
NP_442513.1_5 Forward -400 -381 6.1935 0.282
NP_440275.1_3 Forward -107 -97 10.0098 0.0454
NP_440275.1_3 Reverse -94 -104 8.4365 0.0602
NP_440091.1_1 Forward -109 -97 8.9871 0.0567
NP_440091.1_1 Reverse -92 -104 1.41561 0.197
NP_442275.1_1 Forward -389 -370 8.55425 0.245
NP_442275.1_1 Reverse -80 -99 1.86774 0.284
NP_441902.1_3 Reverse -108 -118 13.176 0.23
NP_443010.1_10 Reverse -93 -110 8.27892 0.161
NP_442451.1_2 Reverse -88 -107 -9.93197 0.26
NP_440866.1_1 Forward -148 -129 16.5182 0.233
NP_440866.1_2 Forward -268 -249 18.4848 0.176
NP_440866.1_3 Forward -341 -322 20.5506 0.227
NP_440866.1_5 Forward -399 -381 17.7187 0.267
NP_440149.1_8 Forward -105 -86 5.01433 0.0783
NP_440149.1_8 Reverse -96 -115 -4.81876 0.213
NP_440149.1_10 Forward -105 -86 -9.44032 0.263
NP_441105.1_3 Reverse -85 -104 -5.01543 0.211
NP_441105.1_3 Forward -99 -80 -9.93197 0.298
NP_440216.1_1 Forward -105 -91 7.57108 0.00935
NP_440216.1_1 Reverse -96 -110 6.3911 0.0156
NP_440172.1_1 Reverse -96 -106 16.303 0.00854
NP_440172.1_1 Forward -105 -95 8.73149 0.0586
NP_442015.1_10 Reverse -92 -105 19.1938 0.00444
NP_442015.1_10 Forward -109 -96 1.49425 0.204
NP_441226.1_7 Forward -104 -97 14.4934 0.0123
NP_441226.1_7 Reverse -97 -104 14.4934 0.0123
NP_441226.1_7 Reverse -257 -264 11.2485 0.0971
NP_441226.1_7 Reverse -377 -384 9.47853 0.147
NP_441485.1_9 Forward -85 -66 19.9606 0.11
NP_441111.1_7 Forward -104 -96 18.7023 0.00294
NP_441111.1_7 Reverse -97 -105 18.7023 0.00294
NP_441111.1_7 Forward -264 -256 -0.570565 0.233
NP_442379.1_10 Reverse -89 -106 0.92382 0.223
NP_441766.1_2 Forward -105 -96 17.5026 0.00297
NP_441766.1_2 Reverse -96 -105 17.5026 0.00297
NP_442417.1_5 Forward -105 -91 19.4691 0.0165
NP_440416.1_9 Reverse -89 -108 -4.81876 0.0783
NP_440416.1_9 Reverse -352 -371 -15.4385 0.191
NP_443052.1_8 Forward -115 -96 -12.1936 0.249
NP_440261.1_5 Forward -264 -251 3.85419 0.0582
NP_440261.1_5 Forward -104 -91 -1.06236 0.0655
NP_440261.1_5 Reverse -97 -110 -2.73398 0.0924
NP_440261.1_7 Forward -191 -172 3.93269 0.148
NP_440988.1_10 Forward -101 -87 5.57651 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCCATGTGGAGGGCACCGTTGGCGTAGGGCGGCCCATCGTGGAGCACAAACAAATCTTTGGGATTATTGTCGGCTAAATCTGCGTAAATTCCTTTTTCCTGCCAATATTGCTGAATTTCCGGCTCTCTTTTGTTAGCGTTGGCCCGCATATCAAAGCGGGTTTGGGGCAAGTTAACGGTGTCTTTATAACTTTTGGCTTCAGTCACAGTGGCTTGGGGCAGAATTGTGCATAGGAATACTTGCTGATTTTACCCCGTTTTCCTAGCCCATCTACTGCGGTTTTACTCCCTAAAGGGCGATCGCCGTGGGCCGGCCTTGGCTTGATCTGCTCTGGCAGGCCAGTATAATTCCAAGGGATAATCGTCTATCAACCTGCTGAATTTTCCGGAACAACGGACC

CDS

ATGAATGAACCAAAACAGACCGAAACCGTCCAGGTGGTGGAAAAAGTTAGCGCGATCCTTTCCCCCTATTTCATCGTCATTGTGGGTTTGTTTTTGGCCGATAGCAATTTTCTCATTGGCATTGCCCTGGTGTTTGTGGGGGTATTTTCCCTGCTGAAACTTTCCTGGCACGATGTGCAAACGGGGGTAGAAAAAGTTAAGGGCTTCTTTGCCGAAAAGCAGTGA

Protein

MNEPKQTETVQVVEKVSAILSPYFIVIVGLFLADSNFLIGIALVFVGVFSLLKLSWHDVQTGVEKVKGFFAEKQ