Your browser is old and dusty. Try Google Chrome!

Details for ssr2333

ORF ssr2333
Accession NP_440527.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442291.1_5 Forward -179 -163 -4.46469 0.276
NP_442291.1_7 Reverse -384 -398 12.8809 0.211
NP_442151.1_6 Forward -364 -350 14.6509 0.0321
NP_442173.1_1 Reverse -327 -335 8.18089 0.111
NP_440784.1_7 Reverse -356 -363 5.84064 0.248
NP_441250.1_3 Reverse -15 -34 4.03102 0.252
NP_440061.1_9 Reverse -336 -350 12.9786 0.0878
NP_442062.1_8 Forward -178 -168 5.09324 0.184
NP_441859.1_3 Reverse -325 -344 4.81688 0.213
NP_442242.1_4 Reverse -170 -177 9.77388 0.213
NP_442602.1_3 Reverse -121 -140 1.47442 0.191
NP_439918.1_3 Forward -193 -174 4.32602 0.264
NP_441200.1_4 Reverse -362 -381 13.5691 0.156
NP_440764.1_10 Forward -395 -376 16.4199 0.141
NP_442196.1_10 Forward -366 -347 10.0292 0.275
NP_441925.1_2 Reverse -279 -298 2.85105 0.262
NP_440856.1_4 Forward -371 -352 -3.73712 0.238
NP_441083.1_5 Reverse -169 -179 8.1415 0.0443
NP_441083.1_5 Forward -178 -168 1.455 0.205
NP_439957.1_9 Reverse -56 -75 4.63094 0.3
NP_441149.1_9 Reverse -375 -394 0.490334 0.234
NP_441738.1_2 Reverse -171 -178 13.3134 0.0335
NP_441558.1_5 Reverse -167 -186 12.6841 0.0675
NP_440209.1_1 Reverse -169 -177 5.13263 0.17
NP_442889.1_1 Reverse -381 -400 -10.9153 0.217
NP_442570.1_3 Forward -399 -380 -1.67217 0.212
NP_441716.1_1 Reverse -338 -352 4.22782 0.256
NP_441533.1_4 Reverse -13 -30 18.3866 0.148
NP_440747.1_10 Reverse -166 -178 -2.71429 0.0639
NP_440747.1_10 Forward -181 -169 -4.68091 0.115
NP_440747.1_10 Forward -367 -355 -12.1541 0.227
NP_441854.1_10 Reverse -353 -372 8.45592 0.176
NP_441486.1_1 Reverse -166 -180 -4.52363 0.201
NP_443018.1_3 Reverse -327 -334 8.8889 0.136
NP_441634.1_8 Forward -277 -263 -3.54032 0.295
NP_440376.1_1 Reverse -169 -178 0.0980582 0.285
NP_440376.1_1 Forward -178 -169 -0.000272808 0.285
NP_441588.1_4 Reverse -171 -181 6.17489 0.206
NP_440266.1_6 Reverse -90 -109 8.65176 0.27
NP_442687.1_7 Reverse -354 -364 6.27322 0.175
NP_442583.1_1 Forward -191 -172 11.5042 0.298
NP_442530.1_2 Reverse -15 -25 12.8614 0.269
NP_441422.1_7 Reverse -324 -341 -0.649475 0.168
NP_440533.1_6 Reverse -350 -369 9.14423 0.276
NP_441763.1_5 Reverse -357 -376 -1.67217 0.234
NP_440141.1_8 Forward -306 -287 5.50599 0.273
NP_440528.1_1 Forward -116 -103 16.557 0.257
NP_442782.1_2 Forward -190 -176 2.85119 0.271
NP_442782.1_2 Forward -380 -366 -0.000409212 0.297
NP_441414.1_9 Forward -335 -316 -10.3253 0.28
NP_441338.2_9 Reverse -130 -149 5.40766 0.252
NP_442911.1_2 Reverse -159 -178 -7.86702 0.221
NP_440993.1_4 Reverse -382 -399 1.90713 0.3
NP_441913.1_2 Reverse -11 -30 16.7157 0.153
NP_441099.1_5 Reverse -345 -364 -11.9969 0.294
NP_442002.1_9 Forward -381 -374 11.1505 0.185
NP_440809.1_9 Reverse -194 -212 -8.63398 0.263
NP_442440.1_7 Reverse -350 -369 8.55425 0.239
NP_441292.1_2 Reverse -250 -269 -12.0953 0.296
NP_440377.1_1 Forward -197 -180 11.5636 0.278
NP_440377.1_1 Forward -35 -18 10.0175 0.299
NP_440147.1_4 Forward -180 -167 6.60746 0.0881
NP_441550.1_8 Reverse -353 -363 9.02601 0.11
NP_441550.1_8 Forward -337 -327 5.78111 0.23
NP_440206.1_4 Reverse -345 -364 -1.27961 0.29
NP_441041.1_4 Forward -346 -327 -13.4719 0.288
NP_441041.1_7 Forward -338 -326 8.2922 0.139
NP_442396.1_5 Forward -182 -169 11.524 0.0955
NP_441725.1_5 Reverse -327 -337 6.07655 0.115
NP_439966.1_7 Reverse -324 -334 7.35439 0.15
NP_439966.1_9 Reverse -324 -333 6.98123 0.253
NP_442941.1_3 Forward -177 -167 -0.0199663 0.244
NP_440260.1_8 Reverse -288 -306 -6.27403 0.289
NP_441514.1_5 Forward -284 -270 18.2506 0.28
NP_441678.1_9 Forward -144 -125 -4.72043 0.296
NP_441079.1_1 Forward -380 -361 16.4207 0.211
NP_441079.1_7 Reverse -57 -76 8.06178 0.107
NP_440018.1_3 Reverse -332 -351 5.60432 0.28
NP_001035871.2_2 Reverse -5 -24 14.9589 0.296
NP_440437.1_1 Reverse -325 -344 -1.96717 0.207
NP_442500.1_8 Reverse -56 -70 10.4676 0.272
NP_442012.1_2 Forward -393 -374 6.09597 0.211
NP_443030.1_4 Forward -175 -156 -7.17871 0.294
NP_441644.1_6 Reverse -326 -336 6.37109 0.161
NP_441644.1_6 Reverse -355 -365 4.20782 0.245
NP_442215.1_2 Forward -240 -224 1.04184 0.142
NP_442933.1_10 Reverse -169 -178 5.50626 0.181
NP_439922.1_2 Reverse -184 -203 15.8307 0.273
NP_439922.1_3 Forward -32 -13 15.326 0.124
NP_439922.1_3 Reverse -12 -31 13.8937 0.144
NP_442554.1_8 Reverse -170 -180 2.83163 0.253
NP_441762.1_7 Forward -336 -324 -3.89426 0.14
NP_442292.1_1 Reverse -170 -179 6.5879 0.101
NP_443009.1_2 Reverse -171 -190 -0.0988766 0.216
NP_443009.1_5 Reverse -158 -169 8.71129 0.102
NP_443009.1_5 Reverse -246 -257 3.99143 0.268
NP_441715.1_4 Forward -177 -167 5.09324 0.233
NP_441468.1_10 Forward -72 -53 22.0256 0.0459
NP_441015.1_10 Forward -369 -350 -6.09707 0.241
NP_441673.1_1 Forward -178 -169 1.27803 0.155
NP_441673.1_1 Reverse -169 -178 1.27803 0.155
NP_441244.1_1 Forward -120 -102 19.1937 0.0745
NP_441426.1_8 Reverse -233 -251 11.6222 0.204
NP_441826.1_2 Reverse -349 -363 4.22782 0.104
NP_441826.1_5 Forward -346 -327 11.2092 0.16
NP_442868.1_6 Reverse -167 -177 -0.314959 0.284
NP_442559.1_3 Reverse -137 -156 21.6323 0.125
NP_440145.1_3 Forward -374 -355 -2.65548 0.176
NP_442050.1_5 Reverse -167 -177 7.74772 0.243
NP_442342.1_9 Reverse -353 -369 3.00846 0.274
NP_441114.1_3 Forward -167 -158 6.29291 0.285
NP_441878.1_6 Reverse -354 -364 -0.314959 0.174
NP_441557.1_5 Forward -178 -169 0.393051 0.166
NP_441557.1_5 Reverse -169 -178 0.393051 0.166
NP_442267.1_4 Forward -151 -132 3.44104 0.221
NP_442066.2_9 Forward -182 -169 7.98409 0.198
NP_440101.1_3 Reverse -350 -369 0.884433 0.289
NP_441458.1_8 Forward -37 -18 6.13652 0.251
NP_440058.1_6 Forward -400 -381 3.6377 0.291
NP_442347.1_2 Reverse -170 -179 5.3096 0.233
NP_442645.1_2 Reverse -161 -180 -22.2233 0.29
NP_441633.1_3 Forward -366 -353 1.19926 0.109
NP_442998.1_5 Forward -382 -372 10.8948 0.201
NP_442998.1_10 Reverse -171 -178 12.3305 0.0564
NP_440299.1_1 Forward -182 -169 6.31189 0.146
NP_441799.1_1 Reverse -165 -179 5.21053 0.218
NP_441559.1_8 Forward -369 -355 0.392915 0.167
NP_440915.1_6 Forward -368 -354 -1.47537 0.236
NP_442158.1_4 Forward -283 -273 11.1898 0.28
NP_440748.1_5 Reverse -373 -392 -3.3438 0.296
NP_441494.1_6 Reverse -154 -167 6.80412 0.272
NP_441340.1_5 Forward -334 -327 4.07068 0.239
NP_442484.1_2 Forward -155 -136 1.47442 0.233
NP_440586.1_9 Forward -354 -335 5.30933 0.288
NP_442251.1_6 Reverse -170 -177 9.77388 0.162
NP_442959.1_5 Reverse -179 -198 10.0292 0.224
NP_441262.1_3 Forward -335 -328 5.15232 0.265
NP_443051.1_1 Forward -336 -327 3.34298 0.118
NP_440372.1_2 Forward -334 -327 4.07068 0.262
NP_440755.1_1 Reverse -102 -120 14.945 0.224
NP_442384.1_10 Forward -364 -351 7.09911 0.0875
NP_442384.1_10 Reverse -355 -368 4.73917 0.148
NP_442384.1_10 Forward -178 -165 1.49425 0.257
NP_442262.1_10 Reverse -327 -334 11.4455 0.102
NP_440531.1_6 Reverse -379 -398 -1.37718 0.231
NP_440531.1_6 Reverse -161 -180 -3.14714 0.262
NP_441060.1_3 Forward -147 -128 10.3242 0.218
NP_441965.1_10 Reverse -132 -148 9.98996 0.111
NP_441896.1_3 Reverse -160 -179 3.14605 0.179
NP_440937.1_5 Reverse -153 -172 13.2741 0.275
NP_440888.1_2 Forward -139 -125 10.3237 0.0974
NP_441771.1_4 Reverse -62 -81 3.14605 0.192
NP_441268.1_1 Reverse -11 -30 12.6523 0.261
NP_442277.1_7 Reverse -54 -70 -0.375166 0.224
NP_442033.1_10 Reverse -353 -372 -13.5702 0.287
NP_440575.1_1 Reverse -310 -329 -1.8696 0.29
NP_441543.1_2 Forward -177 -168 5.40793 0.2
NP_442578.1_7 Reverse -304 -311 6.72562 0.18
NP_442578.1_7 Forward -177 -170 5.25066 0.251
NP_440148.1_1 Forward -323 -304 -6.58872 0.265
NP_441621.1_7 Forward -337 -323 -2.45868 0.188
NP_442204.1_1 Forward -368 -357 10.4818 0.0736
NP_440516.1_8 Forward -335 -326 -0.590259 0.283
NP_441052.1_2 Forward -178 -168 7.25653 0.0765
NP_441052.1_2 Reverse -355 -365 2.04498 0.22
NP_441052.1_2 Forward -364 -354 1.94665 0.221
NP_441052.1_2 Reverse -169 -179 0.668351 0.256
NP_440436.1_4 Reverse -378 -387 5.11253 0.222
NP_441884.1_9 Reverse -335 -354 -23.01 0.284
NP_440314.1_9 Reverse -170 -189 -3.04881 0.173
NP_441733.1_10 Forward -338 -325 7.98409 0.147
NP_441733.1_10 Reverse -256 -269 4.73917 0.244
NP_441004.1_1 Reverse -349 -368 -7.08038 0.194
NP_441851.1_2 Forward -196 -177 12.4875 0.181
NP_442856.1_7 Forward -373 -354 1.67108 0.169
NP_442515.1_1 Forward -179 -165 -0.688726 0.231
NP_442515.1_1 Reverse -302 -316 -5.01529 0.298
NP_441982.1_6 Reverse -174 -183 12.5809 0.274
NP_442689.1_8 Forward -72 -55 -7.63097 0.292
NP_441477.1_10 Reverse -348 -366 2.96908 0.23
NP_440588.1_2 Forward -373 -354 0.196116 0.148
NP_440195.1_4 Forward -190 -171 5.11266 0.29
NP_441570.1_1 Reverse -338 -356 -17.7788 0.291
NP_441078.1_4 Forward -178 -169 0.29472 0.205
NP_441078.1_4 Reverse -169 -178 0.0980582 0.205
NP_441078.1_4 Forward -364 -355 -1.96689 0.282
NP_442348.1_2 Forward -188 -179 7.27622 0.28
NP_441432.1_9 Reverse -308 -321 11.701 0.221
NP_441432.1_9 Forward -92 -79 9.85881 0.263
NP_441432.1_9 Forward -70 -57 8.69532 0.287
NP_440760.1_1 Forward -364 -345 -22.715 0.267
NP_441945.1_10 Forward -377 -358 8.25926 0.273
NP_442353.1_4 Reverse -163 -182 -0.39464 0.29
NP_442727.1_10 Forward -32 -13 12.2908 0.072
NP_442489.1_7 Reverse -169 -178 7.57121 0.057
NP_442489.1_7 Forward -178 -169 0.589713 0.17
NP_442489.1_7 Forward -364 -355 -1.6719 0.235
NP_440559.1_1 Forward -177 -168 4.52295 0.26
NP_440335.1_9 Reverse -234 -252 10.8356 0.28
NP_442346.1_5 Reverse -354 -364 9.02648 0.118
NP_442346.1_5 Forward -365 -355 7.74818 0.159
NP_440545.1_3 Reverse -351 -368 -5.1727 0.242
NP_441856.1_5 Reverse -197 -216 20.2548 0.19
NP_440459.1_2 Forward -366 -349 7.80699 0.278
NP_440010.1_10 Reverse -195 -214 1.37609 0.3
NP_440847.1_8 Reverse -372 -391 12.3892 0.277
NP_442603.1_7 Forward -178 -164 7.47213 0.205
NP_442603.1_7 Forward -364 -350 6.48882 0.24
NP_440449.1_6 Reverse -347 -365 12.2436 0.115
NP_442162.1_9 Reverse -327 -334 9.28223 0.0694
NP_441973.1_1 Reverse -375 -390 0.176559 0.236
NP_442140.1_3 Reverse -327 -337 4.60159 0.242
NP_440594.1_5 Reverse -180 -199 5.2102 0.293
NP_440590.1_4 Forward -177 -164 -5.19226 0.277
NP_440821.1_4 Forward -337 -327 -0.511621 0.269
NP_441239.1_9 Reverse -324 -336 4.8572 0.239
NP_440400.1_1 Forward -307 -288 -1.18128 0.285
NP_442052.1_8 Reverse -386 -396 12.2714 0.282
NP_440546.1_6 Forward -195 -176 7.07928 0.278
NP_440675.1_1 Reverse -294 -313 1.86774 0.283
NP_440462.1_6 Reverse -324 -334 4.20827 0.213
NP_440868.1_4 Reverse -165 -177 8.29878 0.0602
NP_442479.1_5 Forward -35 -16 5.75112 0.273
NP_442402.1_1 Forward -145 -126 7.57094 0.289
NP_442402.1_4 Reverse -310 -329 -9.53937 0.291
NP_442402.1_10 Reverse -1 -11 11.7793 0.237
NP_441848.1_4 Reverse -239 -255 7.83714 0.288
NP_441848.1_7 Reverse -312 -331 15.2399 0.102
NP_442053.1_1 Reverse -169 -178 6.68623 0.12
NP_442053.1_1 Forward -178 -169 5.01461 0.213
NP_440505.1_7 Forward -368 -349 3.83436 0.207
NP_442456.1_5 Forward -114 -96 9.16393 0.26
NP_440013.1_1 Reverse -306 -325 18.7798 0.053
NP_442533.1_6 Reverse -355 -364 5.11294 0.155
NP_442533.1_6 Forward -364 -355 3.83464 0.202
NP_442541.1_10 Reverse -338 -352 2.35894 0.262
NP_443050.1_2 Forward -400 -381 15.4374 0.144
NP_441697.1_5 Reverse -179 -198 -8.35597 0.258
NP_440816.1_2 Reverse -233 -252 6.14452 0.289
NP_440116.1_4 Forward -147 -128 9.63589 0.251
NP_440116.1_8 Reverse -170 -189 -5.21209 0.188
NP_440115.1_6 Forward -338 -328 7.94484 0.146
NP_441972.1_5 Forward -305 -286 -9.83364 0.293
NP_441825.1_4 Forward -256 -246 14.828 0.226
NP_441286.1_1 Forward -179 -167 -6.35254 0.26
NP_441286.1_1 Reverse -168 -180 -6.64753 0.271
NP_442674.1_9 Reverse -18 -37 16.7536 0.265
NP_440670.1_8 Forward -178 -169 6.29291 0.124
NP_442382.1_9 Reverse -312 -331 12.88 0.259
NP_440907.2_8 Reverse -327 -337 5.97777 0.182
NP_441021.1_1 Reverse -327 -346 -8.45701 0.195
NP_440326.1_9 Forward -74 -55 14.1583 0.274
NP_442615.1_1 Forward -187 -169 1.39578 0.0853
NP_441993.1_1 Reverse -349 -368 9.64582 0.135
NP_442084.1_6 Reverse -232 -250 5.62401 0.249
NP_440358.1_8 Forward -144 -125 7.07928 0.174
NP_441425.1_3 Reverse -278 -288 15.2213 0.273
NP_441500.1_8 Reverse -235 -249 15.2096 0.264
NP_440293.1_3 Forward -398 -379 -3.04881 0.243
NP_440766.1_4 Forward -339 -325 4.32615 0.131
NP_440766.1_5 Forward -146 -134 7.75128 0.288
NP_441237.1_6 Forward -397 -380 11.7402 0.127
NP_442930.1_1 Reverse -18 -28 14.0409 0.239
NP_442867.1_8 Forward -158 -139 11.3075 0.204
NP_440457.1_1 Forward -339 -327 -0.846001 0.278
NP_441332.1_10 Reverse -384 -399 18.5645 0.112
NP_440734.1_8 Forward -364 -345 14.7491 0.239
NP_442862.1_3 Forward -25 -8 10.8552 0.202
NP_441885.1_5 Forward -178 -168 1.94665 0.0935
NP_441885.1_5 Reverse -169 -179 1.35667 0.11
NP_442341.1_7 Reverse -168 -182 5.99778 0.139
NP_441756.1_5 Forward -400 -381 0.294447 0.238
NP_441173.1_9 Reverse -3 -11 14.3753 0.161
NP_441173.1_9 Forward -223 -215 10.6388 0.261
NP_441173.1_9 Reverse -4 -12 10.2454 0.261
NP_443000.1_7 Forward -366 -356 4.89658 0.158
NP_443000.1_7 Reverse -167 -177 0.57002 0.294
NP_440275.1_3 Forward -337 -327 7.35486 0.0755
NP_442275.1_1 Reverse -378 -397 4.52268 0.274
NP_441359.1_5 Forward -350 -331 6.58763 0.188
NP_442451.1_2 Reverse -161 -180 -7.08038 0.232
NP_442451.1_2 Forward -305 -286 -9.24366 0.259
NP_441207.1_7 Reverse -54 -68 9.35221 0.282
NP_442495.1_4 Reverse -359 -369 12.3697 0.229
NP_440149.1_10 Forward -364 -345 -1.86883 0.203
NP_441105.1_3 Reverse -327 -346 -7.86702 0.261
NP_440216.1_9 Reverse -126 -135 6.09625 0.289
NP_440172.1_1 Forward -178 -168 3.42162 0.228
NP_442015.1_10 Forward -368 -355 5.52582 0.14
NP_441766.1_2 Forward -178 -169 3.93297 0.2
NP_440416.1_9 Forward -398 -379 -21.3384 0.294
NP_442116.1_6 Reverse -94 -111 6.4501 0.278
NP_442116.1_6 Forward -35 -18 5.3042 0.299
NP_442154.1_1 Reverse -289 -307 -18.7621 0.285
NP_440261.1_5 Forward -177 -164 -6.76555 0.201
NP_440261.1_5 Forward -363 -350 -12.3704 0.284
NP_440261.1_7 Forward -151 -132 -6.58872 0.281
NP_440988.1_10 Forward -271 -257 4.89883 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCTCGGCTTGGCCCAGGAAGGGCAAATGTGTGCCCAGGTGATGACCCCAGGCTGGCAAGTGACGGTGCAATCGGGGCAAAAAAATTGGGTTTACCGCACTAACCAAAATGGCCGCACTATTTTATTGGAATCCTAGCTCCCAGCAGGGATTTTCTTTAACTCGGTCAACACTAATGATTTAACAAACCGGGGCTTAGGTCCCAAATAGTTGCGGAGATTTTTGGCGATCTACAGCAATGCTCCCAGCATCTGTCTTGGGCAGGACTTTTCCATAGGTTGCATGGAATTTAATCAATGGTAAGTGATTATACTCACAATTATTCCAGTGATTTTTGATATTTATTCTGAACAGATAATGCTAACTTAATAGTTGAGAATTATTTGCAGTTTTGGGAAAACC

CDS

ATGACGTTATTGGATTTATCGGTGGGTCAGTTGGCTTTTGTGGAGAAAATTTTACTAGGAAACCACGGTCAGGGGTTAGTTAATCGCCTAGAAGCAATGGGAATAATTCCTGATAAACCAATTCAATTGCTCCGCAAGGCTGGTTTGGGGGGACCACTCCACCTCCGCATTGGTAGCACCACCGAAGTGGCCATGCGCCGTAGTGAAGCCCAATTGGTGCAGATTACCTTAGGAGAGTAG

Protein

MTLLDLSVGQLAFVEKILLGNHGQGLVNRLEAMGIIPDKPIQLLRKAGLGGPLHLRIGSTTEVAMRRSEAQLVQITLGE