Your browser is old and dusty. Try Google Chrome!

Details for ssr2318

ORF ssr2318
Accession NP_440515.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Forward -64 -57 12.1338 0.295
NP_441098.1_3 Forward -388 -369 -3.24792 0.28
NP_441098.1_3 Reverse -363 -382 -5.2577 0.28
NP_440774.1_4 Reverse -285 -304 11.0125 0.294
NP_442062.1_8 Reverse -322 -332 3.22496 0.279
NP_442974.1_1 Forward -343 -324 17.4032 0.0805
NP_441935.1_1 Reverse -323 -342 9.73422 0.217
NP_441594.1_6 Reverse -214 -233 0.491109 0.285
NP_442742.1_9 Reverse -10 -29 -9.047 0.269
NP_442110.1_2 Forward -250 -237 14.4165 0.256
NP_441083.1_5 Reverse -50 -60 3.12662 0.182
NP_441558.1_5 Reverse -263 -282 4.52268 0.28
NP_442889.1_10 Reverse -128 -147 18.9687 0.137
NP_441713.1_1 Reverse -265 -284 -12.5869 0.247
NP_442570.1_3 Reverse -49 -68 -9.24366 0.296
NP_441792.1_5 Forward -331 -315 10.9733 0.205
NP_441716.1_1 Reverse -217 -231 8.06273 0.152
NP_441327.1_1 Forward -41 -22 3.63672 0.277
NP_441327.1_5 Forward -34 -25 14.651 0.192
NP_441012.1_4 Forward -224 -211 6.50913 0.278
NP_441012.1_4 Reverse -261 -274 6.21414 0.284
NP_442485.1_3 Forward -337 -318 2.16274 0.215
NP_442946.1_6 Forward -88 -69 15.326 0.291
NP_440642.1_10 Reverse -75 -89 7.66879 0.221
NP_442937.1_5 Reverse -212 -231 6.98095 0.265
NP_442690.1_1 Forward -137 -118 -11.4069 0.229
NP_442690.1_1 Forward -126 -107 -16.3235 0.287
NP_443055.1_3 Forward -340 -321 10.9316 0.273
NP_441654.1_5 Forward -40 -21 14.3296 0.252
NP_439966.1_9 Reverse -266 -275 0.589713 0.272
NP_440202.1_8 Forward -339 -320 15.5448 0.23
NP_441556.1_7 Forward -342 -323 8.25844 0.171
NP_441644.1_6 Forward -331 -321 3.61784 0.272
NP_442215.1_2 Forward -276 -260 -4.1697 0.228
NP_442933.1_1 Forward -149 -130 11.2199 0.249
NP_442933.1_2 Reverse -114 -132 16.9996 0.227
NP_441751.2_8 Reverse -282 -296 -5.90027 0.244
NP_442554.1_8 Forward -330 -320 4.40493 0.188
NP_442554.1_8 Forward -225 -215 4.3066 0.189
NP_442313.1_6 Forward -203 -184 7.17762 0.251
NP_440775.1_4 Reverse -147 -166 12.5759 0.216
NP_443009.1_5 Reverse -321 -332 5.07306 0.218
NP_441198.1_8 Reverse -320 -330 10.1462 0.296
NP_441251.1_8 Reverse -138 -151 10.7569 0.278
NP_441612.1_2 Reverse -237 -247 16.7784 0.189
NP_441612.1_2 Forward -52 -42 10.8728 0.21
NP_441612.1_2 Forward -20 -10 8.83972 0.21
NP_442820.1_7 Reverse -55 -68 20.3738 0.151
NP_440558.1_2 Forward -335 -316 -2.55715 0.229
NP_441557.1_8 Reverse -49 -59 12.8609 0.235
NP_442777.1_1 Reverse -49 -68 4.42355 0.3
NP_441381.1_1 Forward -383 -364 10.815 0.199
NP_442830.1_5 Forward -332 -318 7.76712 0.215
NP_442347.1_2 Reverse -44 -53 4.22796 0.284
NP_440136.1_1 Forward -162 -146 20.4123 0.113
NP_442590.1_10 Forward -338 -319 4.52268 0.274
NP_442998.1_5 Forward -33 -23 7.84651 0.28
NP_440256.1_1 Reverse -319 -338 -4.13045 0.147
NP_441957.1_7 Reverse -306 -325 16.6174 0.193
NP_441559.1_8 Forward -336 -322 -6.58858 0.279
NP_440915.1_6 Forward -335 -321 4.32615 0.097
NP_441179.1_9 Forward -333 -323 12.6642 0.272
NP_441866.1_3 Forward -179 -166 10.934 0.273
NP_442386.1_9 Forward -332 -323 10.4224 0.129
NP_441340.1_9 Forward -82 -72 8.93007 0.256
NP_441340.1_9 Forward -34 -24 8.15881 0.256
NP_440586.1_8 Reverse -218 -225 5.8403 0.283
NP_440027.1_3 Forward -341 -323 2.87 0.284
NP_439943.1_1 Reverse -377 -396 -6.39206 0.237
NP_442384.1_10 Forward -331 -318 1.39592 0.26
NP_442262.1_10 Forward -289 -282 7.21728 0.281
NP_441060.1_3 Reverse -319 -338 11.0125 0.204
NP_441060.1_3 Reverse -214 -233 9.83255 0.218
NP_441965.1_10 Forward -334 -318 4.48343 0.238
NP_440297.1_9 Forward -355 -345 1.65166 0.275
NP_440297.1_9 Forward -273 -263 0.176696 0.282
NP_440350.1_5 Reverse -26 -45 -6.68705 0.297
NP_440894.1_4 Forward -70 -51 10.7175 0.219
NP_440894.1_4 Reverse -49 -68 2.75272 0.219
NP_442277.1_7 Reverse -128 -144 -1.52107 0.278
NP_442845.1_2 Reverse -316 -330 9.34103 0.177
NP_442710.1_7 Reverse -363 -382 -4.62778 0.272
NP_441469.1_8 Forward -332 -323 5.40793 0.272
NP_442337.1_8 Reverse -169 -188 1.27776 0.241
NP_442286.1_8 Forward -249 -231 16.7305 0.294
NP_441621.1_7 Reverse -266 -280 -5.21195 0.248
NP_443062.1_1 Forward -331 -313 4.15809 0.272
NP_440544.1_5 Forward -244 -237 14.5681 0.264
NP_440454.1_2 Reverse -96 -110 16.1498 0.163
NP_440673.1_2 Forward -269 -250 8.341 0.273
NP_440296.1_10 Forward -60 -41 -7.96535 0.246
NP_441668.1_4 Forward -394 -375 1.96607 0.207
NP_442689.1_8 Forward -122 -105 -3.79607 0.252
NP_442689.1_8 Forward -133 -116 -5.07437 0.268
NP_440431.1_3 Forward -393 -374 -4.81876 0.18
NP_442729.1_5 Reverse -216 -226 7.84651 0.261
NP_440335.1_9 Reverse -104 -122 11.2289 0.28
NP_442346.1_2 Forward -292 -273 4.71934 0.289
NP_442346.1_5 Reverse -216 -226 12.8614 0.0349
NP_442346.1_5 Reverse -321 -331 4.20827 0.296
NP_442346.1_10 Reverse -320 -339 -3.14714 0.294
NP_440250.1_4 Forward -147 -128 2.55527 0.288
NP_441585.1_5 Forward -341 -322 1.76863 0.284
NP_441329.1_6 Forward -31 -12 10.5514 0.109
NP_440224.1_4 Reverse -376 -395 1.47442 0.244
NP_441239.1_9 Reverse -320 -332 5.84051 0.206
NP_440833.1_6 Reverse -68 -82 6.58715 0.299
NP_441617.1_6 Forward -167 -148 -7.37537 0.292
NP_440546.1_4 Reverse -322 -332 8.00989 0.209
NP_440546.1_4 Reverse -217 -227 7.42815 0.241
NP_442402.1_4 Reverse -380 -399 -2.45958 0.199
NP_441084.1_6 Forward -394 -380 9.15021 0.292
NP_442829.1_2 Reverse -104 -120 8.91416 0.287
NP_442533.1_6 Forward -331 -322 6.09625 0.118
NP_442533.1_6 Reverse -322 -331 4.71961 0.177
NP_442533.1_6 Reverse -217 -226 4.62128 0.179
NP_442203.1_3 Reverse -362 -381 23.261 0.0334
NP_441697.1_5 Forward -381 -362 0.715766 0.191
NP_440816.1_2 Reverse -123 -142 10.017 0.214
NP_441028.1_6 Forward -244 -234 6.76441 0.23
NP_441527.1_4 Reverse -104 -123 0.811258 0.134
NP_441527.1_4 Reverse -117 -136 -8.35597 0.243
NP_441527.1_4 Forward -45 -26 -9.88384 0.262
NP_441527.1_4 Reverse -189 -208 -11.3162 0.281
NP_441527.1_4 Forward -179 -160 -11.6027 0.284
NP_441420.1_1 Forward -340 -321 -4.42544 0.292
NP_442674.1_1 Forward -394 -375 12.503 0.219
NP_442674.1_3 Reverse -215 -234 5.40686 0.269
NP_442800.1_7 Reverse -381 -400 6.68596 0.219
NP_439999.1_8 Forward -337 -318 13.6666 0.269
NP_441463.1_2 Forward -216 -198 3.35006 0.207
NP_440387.1_1 Reverse -268 -284 -6.03799 0.262
NP_441431.1_2 Forward -334 -320 6.48882 0.269
NP_441431.1_3 Forward -302 -283 3.44104 0.268
NP_441836.1_2 Forward -232 -213 -1.47551 0.219
NP_440473.1_9 Forward -68 -49 -9.14533 0.26
NP_441496.1_1 Forward -376 -362 14.2399 0.271
NP_441159.1_8 Forward -377 -358 1.57197 0.236
NP_441173.1_9 Forward -192 -184 10.6388 0.261
NP_442932.1_9 Forward -63 -44 6.78429 0.249
NP_440216.1_9 Forward -224 -215 5.89959 0.289
NP_441064.1_4 Forward -325 -306 11.4058 0.246
NP_442969.1_4 Forward -54 -35 8.45592 0.274
NP_442116.1_6 Reverse -129 -146 6.54559 0.276
NP_442154.1_1 Reverse -323 -341 -13.2555 0.217
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCTAAGGAAAGCATTGGTAAATCAATTTATTATTTATTACCTGAGGCTAATGAACTAAAAAGCCTGACCAGCCATGCCCTAGCTAACAACATTATTGAGTCTGTGAGCGTGCAGATGGAACGAGTCGACCACGGCACTTGGTTCTATGATGCTTGGTTTTCTCCTATCCTAGATAACCATGGCCAGGTTTCTAATGTTGTTTGTATGCTTTTACCAGCCTAAAACAGGGAGTAAAGATCTAGAGTAATCTTTTTCATCATTGTCTATATTTTAGTTATACTTTTGCTGCGCTTTTCTTACCATTTACGTGTATGAAACAAGGTAAACTTTCACAGCTCATTGGGGAGCTGGGATAAATAGAATTACAAGGATAAATTCTAGGAGCAAAACAGTACACATC

CDS

ATGAAGAGTTACCGGCGCTTGAAACAATTACTTTTCTTTACCAATATTGGCGATAAGTCTAAGCAAATTAGACAAAAGACTGGGGCGGGAAAAACAAAAATTTATCTAAGCATGGCGGTGTTTCTCCTCTGTCCCCTCACCCTCTGGGGCACCACCCAGAATTTTAATTTAACTATGATGGCCCTGACTACTTTTACCATAGCTTATCTGGGCAAAGGTCTGCGTCGGACTAAGCCCGGTGCTGGGGAAAATTGGCCTCATTAA

Protein

MKSYRRLKQLLFFTNIGDKSKQIRQKTGAGKTKIYLSMAVFLLCPLTLWGTTQNFNLTMMALTTFTIAYLGKGLRRTKPGAGENWPH