Your browser is old and dusty. Try Google Chrome!

Details for ssr2201

ORF ssr2201
Accession NP_441400.1
Symbol
Category
Definition
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -208 -222 4.32615 0.151
NP_441061.1_2 Reverse -330 -344 0.392915 0.211
NP_441061.1_2 Forward -215 -201 -0.393733 0.228
NP_441061.1_2 Reverse -349 -363 -2.55701 0.296
NP_440795.1_7 Forward -215 -208 14.6904 0.0123
NP_440795.1_7 Reverse -208 -215 14.6904 0.0123
NP_441418.1_6 Forward -216 -197 -12.3902 0.0643
NP_441418.1_6 Reverse -207 -226 -29.3032 0.221
NP_442291.1_5 Reverse -206 -222 -3.48138 0.242
NP_442291.1_5 Forward -217 -201 -3.77637 0.252
NP_442291.1_7 Forward -94 -80 11.406 0.217
NP_441453.1_4 Reverse -207 -215 16.539 0.00633
NP_441453.1_4 Forward -216 -208 16.539 0.00633
NP_441453.1_7 Forward -66 -59 12.9205 0.23
NP_442151.1_6 Forward -216 -202 7.27608 0.205
NP_442151.1_6 Reverse -207 -221 7.07942 0.211
NP_440561.1_4 Reverse -205 -224 12.1406 0.262
NP_441818.1_1 Reverse -208 -219 18.8393 0.00301
NP_441818.1_1 Forward -215 -204 14.4145 0.0502
NP_440226.1_1 Reverse -207 -226 7.86593 0.0975
NP_440226.1_1 Forward -216 -197 3.53937 0.221
NP_441630.1_3 Reverse -199 -218 -0.197208 0.285
NP_442173.1_1 Forward -215 -207 15.4574 0.00633
NP_442173.1_1 Reverse -208 -216 15.4574 0.00633
NP_442173.1_6 Reverse -124 -138 13.9626 0.118
NP_442752.1_4 Forward -216 -209 13.8055 0.0199
NP_442752.1_4 Reverse -207 -214 13.8055 0.0199
NP_442752.1_4 Forward -338 -331 12.4288 0.0388
NP_442752.1_4 Reverse -100 -107 5.54565 0.194
NP_443027.1_4 Forward -218 -208 14.0414 0.0452
NP_443027.1_4 Reverse -205 -215 6.46988 0.275
NP_441812.1_3 Forward -217 -203 8.45605 0.252
NP_442975.1_10 Reverse -203 -217 12.2903 0.0477
NP_440784.1_7 Forward -215 -208 15.9687 0.0123
NP_440784.1_7 Reverse -208 -215 15.9687 0.0123
NP_440784.1_7 Reverse -345 -352 7.51227 0.138
NP_442861.1_3 Forward -135 -116 13.4708 0.251
NP_440061.1_9 Forward -218 -204 12.8803 0.0903
NP_441476.1_5 Forward -227 -208 -5.31042 0.262
NP_442062.1_8 Forward -216 -206 17.6796 0.00193
NP_442062.1_8 Reverse -207 -217 17.3846 0.00193
NP_440761.1_9 Reverse -128 -147 9.73422 0.212
NP_441859.1_3 Forward -217 -198 10.3234 0.121
NP_440304.1_4 Reverse -205 -215 17.9746 0.00654
NP_440304.1_4 Forward -218 -208 10.8948 0.051
NP_442242.1_4 Forward -215 -208 14.3954 0.0124
NP_442242.1_4 Reverse -208 -215 14.3954 0.0124
NP_440044.1_8 Reverse -208 -227 22.9106 0.00763
NP_440044.1_8 Forward -215 -196 1.0811 0.183
NP_441781.1_7 Reverse -207 -226 4.52268 0.186
NP_441208.1_9 Reverse -204 -218 4.91614 0.282
NP_442742.1_9 Forward -150 -131 -5.99873 0.222
NP_442276.1_2 Forward -101 -82 3.44104 0.299
NP_440132.1_1 Reverse -205 -223 7.78729 0.288
NP_442110.1_7 Reverse -207 -221 8.84938 0.0807
NP_441082.1_10 Forward -102 -89 15.2606 0.219
NP_441083.1_5 Reverse -207 -217 20.3345 0.00053
NP_441083.1_5 Forward -216 -206 19.3512 0.000718
NP_441738.1_2 Forward -214 -207 15.28 0.0102
NP_441738.1_2 Reverse -209 -216 15.28 0.0102
NP_441738.1_2 Forward -26 -19 8.29857 0.176
NP_440209.1_1 Reverse -207 -215 18.1123 0.00295
NP_440209.1_1 Forward -216 -208 18.1123 0.00295
NP_442889.1_8 Reverse -204 -218 18.3868 0.0109
NP_441713.1_2 Forward -130 -111 14.5524 0.291
NP_440178.1_7 Forward -217 -198 -11.9969 0.111
NP_440178.1_7 Reverse -206 -225 -14.3569 0.153
NP_442570.1_3 Forward -99 -80 -9.44032 0.299
NP_441792.1_1 Reverse -322 -341 5.60432 0.267
NP_441716.1_1 Reverse -207 -221 6.3911 0.198
NP_441716.1_1 Forward -216 -202 5.99778 0.208
NP_441327.1_1 Reverse -144 -163 11.3255 0.184
NP_441327.1_1 Reverse -28 -47 3.15617 0.277
NP_442111.1_4 Forward -217 -203 3.73617 0.233
NP_441624.1_7 Forward -142 -128 14.1593 0.158
NP_441163.1_1 Reverse -363 -380 4.46302 0.287
NP_440343.1_3 Forward -377 -359 5.22993 0.257
NP_440906.1_5 Forward -215 -208 15.8704 0.0124
NP_440906.1_5 Reverse -208 -215 15.8704 0.0124
NP_440747.1_10 Forward -219 -207 7.51213 0.00286
NP_440747.1_10 Reverse -204 -216 -1.92764 0.0192
NP_441130.1_10 Forward -218 -204 17.3058 0.0167
NP_441130.1_10 Reverse -205 -219 7.57108 0.155
NP_441486.1_1 Forward -219 -205 14.4542 0.00637
NP_441486.1_1 Reverse -204 -218 3.73617 0.0553
NP_441880.2_10 Forward -215 -197 15.2604 0.111
NP_442634.1_4 Reverse -205 -219 4.22782 0.0819
NP_441265.1_3 Reverse -201 -215 3.93283 0.181
NP_440403.1_10 Forward -216 -197 3.93269 0.268
NP_440842.1_10 Forward -92 -78 3.24451 0.264
NP_441014.1_5 Forward -100 -82 13.8838 0.2
NP_441014.1_10 Forward -217 -198 3.44025 0.214
NP_442848.1_1 Forward -222 -208 13.4709 0.0272
NP_442848.1_1 Reverse -201 -215 -3.54032 0.268
NP_443018.1_3 Forward -215 -208 14.8871 0.0123
NP_443018.1_3 Reverse -208 -215 14.8871 0.0123
NP_441316.1_7 Reverse -342 -357 -2.57671 0.26
NP_441634.1_8 Forward -218 -204 11.8976 0.0529
NP_441634.1_8 Forward -340 -326 0.0979218 0.241
NP_440376.1_1 Forward -216 -207 19.4693 0.000692
NP_440376.1_1 Reverse -207 -216 19.4693 0.000692
NP_440376.1_1 Reverse -100 -109 1.47469 0.251
NP_441588.1_4 Reverse -209 -219 8.63316 0.14
NP_442687.1_7 Reverse -206 -216 18.5646 0.0028
NP_442687.1_7 Forward -217 -207 8.92815 0.0994
NP_441077.1_6 Reverse -228 -244 11.2857 0.152
NP_440066.1_5 Reverse -363 -382 9.04509 0.256
NP_442485.1_3 Reverse -359 -378 -3.63879 0.277
NP_442485.1_3 Forward -227 -208 -5.80207 0.296
NP_441682.1_2 Forward -135 -116 2.3594 0.241
NP_442658.1_1 Reverse -205 -215 17.6791 0.00565
NP_442658.1_1 Forward -218 -208 6.76441 0.214
NP_442782.1_2 Reverse -159 -173 0.982901 0.282
NP_442496.1_5 Forward -97 -79 19.587 0.0892
NP_440656.1_8 Forward -227 -208 -1.7705 0.184
NP_440656.1_8 Reverse -196 -215 -8.94866 0.273
NP_442544.1_2 Forward -57 -43 -1.27871 0.272
NP_441414.1_9 Forward -21 -2 -8.16202 0.23
NP_441487.1_9 Forward -217 -198 11.8975 0.0625
NP_442937.1_5 Reverse -202 -221 9.83255 0.179
NP_442321.1_4 Forward -388 -369 2.55606 0.255
NP_441958.1_5 Reverse -206 -216 20.5312 0.000966
NP_441958.1_5 Forward -217 -207 12.2714 0.00183
NP_441958.1_5 Reverse -99 -109 -2.47824 0.273
NP_442836.1_5 Reverse -201 -220 9.3409 0.132
NP_442836.1_10 Forward -97 -87 17.9746 0.154
NP_439905.1_1 Reverse -81 -94 10.639 0.216
NP_439905.1_1 Forward -182 -169 7.78743 0.244
NP_440984.1_7 Reverse -202 -216 6.29277 0.219
NP_441162.1_3 Forward -108 -89 20.944 0.0467
NP_441162.1_3 Reverse -82 -101 13.4708 0.181
NP_441162.1_3 Reverse -81 -100 8.65258 0.254
NP_441097.1_2 Reverse -90 -107 2.98877 0.293
NP_442911.1_2 Forward -226 -207 -2.36049 0.0974
NP_442911.1_2 Reverse -197 -216 -9.047 0.249
NP_441580.1_6 Forward -227 -208 -7.76869 0.246
NP_441591.1_10 Forward -100 -81 5.70265 0.295
NP_443055.1_3 Reverse -198 -217 16.0881 0.0801
NP_443055.1_6 Reverse -199 -217 18.6029 0.0484
NP_440993.1_2 Forward -221 -205 1.5335 0.279
NP_441099.1_5 Reverse -197 -216 -3.3438 0.133
NP_442002.1_1 Reverse -91 -109 -1.94747 0.2
NP_442002.1_1 Forward -99 -81 -7.65067 0.251
NP_442002.1_9 Reverse -206 -213 14.1004 0.074
NP_440809.1_9 Forward -118 -100 -7.749 0.225
NP_441294.1_7 Reverse -203 -217 17.4097 0.00899
NP_441294.1_7 Forward -220 -206 13.1862 0.0727
NP_441646.1_1 Reverse -200 -219 -0.885524 0.273
NP_442438.1_10 Forward -221 -207 18.3875 0.0168
NP_441398.1_5 Reverse -334 -353 9.43923 0.258
NP_440377.1_1 Reverse -267 -284 13.0131 0.249
NP_441000.1_6 Reverse -206 -220 4.81781 0.0933
NP_441000.1_6 Forward -217 -203 -4.81863 0.252
NP_442771.1_1 Reverse -205 -223 -2.93078 0.166
NP_440147.1_4 Forward -218 -205 11.819 0.0326
NP_440147.1_4 Reverse -205 -218 3.95252 0.175
NP_441550.1_8 Reverse -205 -215 19.8424 0.00352
NP_441550.1_8 Forward -218 -208 12.3692 0.0336
NP_441916.1_7 Forward -216 -206 16.893 0.00407
NP_441916.1_7 Reverse -207 -217 10.3048 0.0261
NP_441041.1_4 Forward -216 -197 -11.7019 0.251
NP_441041.1_4 Reverse -207 -226 -13.3736 0.285
NP_441041.1_7 Reverse -204 -216 21.8971 0.000853
NP_442396.1_5 Forward -220 -207 8.18076 0.16
NP_441547.1_1 Forward -342 -323 6.19431 0.226
NP_442004.1_6 Reverse -207 -221 11.2093 0.125
NP_441725.1_4 Reverse -365 -379 5.21053 0.278
NP_441725.1_5 Forward -215 -205 18.7612 0.0119
NP_441725.1_5 Reverse -208 -218 11.2881 0.0247
NP_439966.1_7 Forward -218 -208 15.8108 0.0124
NP_439966.1_7 Reverse -327 -337 9.91099 0.0968
NP_439966.1_7 Reverse -205 -215 8.14104 0.14
NP_439966.1_9 Reverse -205 -214 0.983037 0.253
NP_442941.1_3 Reverse -208 -218 19.9412 0.00262
NP_442941.1_3 Forward -215 -205 2.43831 0.14
NP_440289.1_2 Reverse -204 -217 20.9638 0.003
NP_440289.1_2 Forward -219 -206 16.1456 0.00946
NP_440289.1_2 Reverse -326 -339 -2.63565 0.261
NP_440260.1_8 Forward -382 -364 -2.63579 0.245
NP_442281.1_1 Reverse -202 -216 19.3701 0.00282
NP_442281.1_1 Forward -221 -207 7.57046 0.0969
NP_442256.1_2 Forward -218 -200 -7.94566 0.216
NP_440437.1_1 Forward -222 -203 -2.16383 0.212
NP_440647.1_9 Reverse -98 -116 2.67408 0.288
NP_441860.1_1 Reverse -75 -89 15.9372 0.276
NP_441644.1_6 Reverse -207 -217 17.3841 0.00127
NP_441644.1_6 Forward -216 -206 15.7125 0.0048
NP_442215.1_2 Reverse -205 -221 0.255197 0.154
NP_440253.1_2 Forward -216 -198 10.6389 0.0381
NP_440929.1_8 Forward -216 -207 19.2726 0.000701
NP_440929.1_8 Reverse -207 -216 19.2726 0.000701
NP_442933.1_10 Forward -216 -207 17.601 0.00325
NP_442933.1_10 Reverse -207 -216 17.601 0.00325
NP_440382.1_2 Forward -161 -142 2.45694 0.284
NP_441751.2_8 Reverse -208 -222 13.7659 0.015
NP_441751.2_8 Forward -215 -201 3.44117 0.0661
NP_442554.1_8 Forward -215 -205 16.9913 0.0065
NP_442554.1_8 Reverse -208 -218 15.9097 0.00747
NP_442970.1_1 Reverse -66 -80 9.56081 0.269
NP_441762.1_7 Forward -217 -205 2.59558 0.0676
NP_441762.1_7 Reverse -206 -218 1.7106 0.0735
NP_442142.1_4 Reverse -204 -217 11.9167 0.0504
NP_442142.1_4 Forward -219 -206 7.49186 0.137
NP_442292.1_1 Reverse -208 -217 18.486 0.00229
NP_442292.1_1 Forward -215 -206 9.53783 0.0183
NP_440919.1_1 Forward -94 -75 -0.0988766 0.221
NP_442476.1_6 Reverse -208 -222 2.06454 0.195
NP_442381.1_8 Forward -219 -200 -13.7669 0.279
NP_443009.1_5 Forward -217 -206 15.7911 0.0107
NP_443009.1_5 Reverse -206 -217 11.1696 0.066
NP_443009.1_5 Forward -379 -368 4.67974 0.234
NP_441715.1_4 Reverse -208 -218 14.828 0.0268
NP_440015.1_9 Reverse -207 -225 0.412472 0.252
NP_440158.1_1 Forward -249 -230 13.4162 0.158
NP_440183.1_9 Reverse -356 -375 -21.24 0.299
NP_441198.1_8 Reverse -205 -215 15.2245 0.0427
NP_441468.1_1 Forward -215 -208 15.8704 0.0124
NP_441468.1_1 Reverse -208 -215 15.8704 0.0124
NP_441020.2_6 Forward -218 -201 15.9685 0.034
NP_441015.1_10 Forward -350 -331 -10.7186 0.287
NP_441673.1_1 Forward -216 -207 20.8459 0.000698
NP_441673.1_1 Reverse -207 -216 20.8459 0.000698
NP_441956.1_9 Forward -137 -118 12.8808 0.166
NP_441826.1_2 Forward -222 -208 4.52282 0.102
NP_441826.1_2 Reverse -201 -215 2.5562 0.125
NP_441826.1_2 Reverse -207 -221 -0.590395 0.215
NP_441764.1_8 Forward -14 -4 14.6604 0.284
NP_442868.1_6 Reverse -205 -215 16.7946 0.0131
NP_442868.1_6 Forward -218 -208 9.91146 0.038
NP_442868.1_6 Forward -132 -122 3.81494 0.192
NP_442719.1_2 Reverse -260 -278 -10.1096 0.269
NP_441612.1_2 Reverse -207 -217 8.54929 0.21
NP_442427.1_3 Reverse -202 -220 1.98577 0.188
NP_442808.1_1 Reverse -206 -216 8.73102 0.0481
NP_442808.1_1 Forward -217 -207 8.63269 0.0481
NP_442808.1_1 Reverse -328 -338 5.48612 0.151
NP_440145.1_3 Reverse -197 -216 9.43923 0.0446
NP_442542.1_2 Reverse -205 -218 22.6354 0.00161
NP_442050.1_5 Forward -218 -208 16.4991 0.00812
NP_442050.1_5 Reverse -205 -215 14.9258 0.0175
NP_442050.1_5 Forward -111 -101 8.04271 0.243
NP_442342.1_9 Reverse -205 -221 6.45005 0.218
NP_440558.1_2 Forward -382 -363 -4.72043 0.248
NP_440558.1_2 Reverse -282 -301 -5.60541 0.262
NP_440558.1_2 Forward -225 -206 -6.29373 0.273
NP_440558.1_2 Reverse -204 -223 -6.88371 0.283
NP_440558.1_2 Reverse -366 -385 -7.27704 0.291
NP_442789.1_4 Forward -352 -333 -7.27704 0.292
NP_440093.1_8 Forward -370 -351 15.4374 0.28
NP_441518.1_3 Reverse -197 -216 -4.13045 0.119
NP_441518.1_3 Forward -226 -207 -15.1435 0.287
NP_441878.1_6 Reverse -206 -216 20.2362 0.0046
NP_441878.1_6 Forward -217 -207 10.4031 0.0176
NP_441878.1_6 Reverse -79 -89 -0.118297 0.167
NP_441878.1_6 Reverse -369 -379 -7.49312 0.231
NP_441036.1_8 Reverse -206 -216 8.4365 0.174
NP_441036.1_8 Forward -217 -207 8.33817 0.174
NP_441557.1_5 Forward -216 -207 19.9609 0.000699
NP_441557.1_5 Reverse -207 -216 19.9609 0.000699
NP_441557.1_8 Reverse -328 -338 10.3043 0.289
NP_441445.1_1 Forward -225 -206 17.994 0.0287
NP_441445.1_1 Reverse -198 -217 11.3075 0.0863
NP_441445.1_4 Forward -358 -339 16.9686 0.244
NP_442183.1_1 Forward -216 -202 17.7975 0.00938
NP_442183.1_1 Reverse -207 -221 8.55439 0.113
NP_441407.1_5 Reverse -197 -216 2.85105 0.29
NP_442166.1_7 Reverse -350 -364 8.25939 0.245
NP_442397.1_9 Reverse -207 -226 7.27595 0.246
NP_441549.1_9 Reverse -203 -221 -6.66736 0.203
NP_440540.1_2 Forward -228 -209 8.35759 0.252
NP_442170.1_5 Forward -216 -197 4.42435 0.162
NP_442347.1_2 Reverse -208 -217 12.4878 0.056
NP_442347.1_2 Reverse -330 -339 5.99792 0.201
NP_442347.1_2 Forward -159 -150 3.63797 0.284
NP_442347.1_2 Forward -215 -206 3.34298 0.284
NP_442645.1_2 Reverse -205 -224 -11.6036 0.144
NP_442645.1_2 Forward -224 -205 -13.9635 0.168
NP_441037.1_4 Reverse -205 -215 18.9151 0.00351
NP_440932.1_7 Forward -135 -116 17.436 0.177
NP_441633.1_3 Forward -218 -205 13.1956 0.018
NP_441633.1_3 Reverse -176 -189 -6.76555 0.271
NP_440136.1_2 Forward -215 -208 15.9687 0.0123
NP_440136.1_2 Reverse -208 -215 15.9687 0.0123
NP_442998.1_10 Forward -214 -207 15.5754 0.0102
NP_442998.1_10 Reverse -209 -216 15.5754 0.0102
NP_440299.1_1 Forward -220 -207 10.3434 0.0573
NP_441799.1_1 Reverse -203 -217 11.307 0.0591
NP_441799.1_1 Forward -220 -206 4.71887 0.238
NP_440640.1_9 Reverse -192 -211 11.4058 0.298
NP_441007.1_10 Reverse -202 -215 10.5407 0.0656
NP_441007.1_10 Forward -221 -208 2.77255 0.183
NP_442334.1_2 Reverse -197 -214 -5.36936 0.2
NP_440256.1_1 Reverse -204 -223 -0.983855 0.0988
NP_440256.1_1 Forward -219 -200 -5.70374 0.189
NP_441229.1_1 Reverse -337 -352 21.8094 0.179
NP_441362.1_2 Reverse -144 -163 11.3948 0.243
NP_441559.1_8 Reverse -364 -378 -0.197071 0.174
NP_441559.1_8 Forward -383 -369 -2.55701 0.192
NP_441559.1_8 Reverse -365 -379 -4.22864 0.219
NP_441270.1_5 Reverse -115 -134 11.0424 0.294
NP_440915.1_6 Forward -220 -206 9.5377 0.0406
NP_440915.1_6 Reverse -203 -217 6.3911 0.0826
NP_440915.1_6 Forward -362 -348 -3.04867 0.29
NP_440717.1_1 Forward -294 -275 4.916 0.286
NP_441704.1_8 Forward -212 -193 6.29183 0.262
NP_442866.1_1 Reverse -122 -141 -6.09707 0.249
NP_441464.1_8 Forward -216 -202 17.6992 0.072
NP_440787.1_1 Forward -76 -57 10.1275 0.196
NP_441939.1_4 Forward -156 -137 12.9387 0.268
NP_442993.1_1 Reverse -207 -223 -8.88958 0.176
NP_442993.1_1 Reverse -286 -302 -13.1178 0.286
NP_442993.1_1 Reverse -171 -187 -13.1178 0.286
NP_442386.1_9 Forward -217 -208 13.8639 0.0289
NP_442386.1_9 Forward -223 -214 7.07914 0.219
NP_442386.1_9 Forward -132 -123 6.58748 0.219
NP_442386.1_9 Reverse -206 -215 6.39082 0.219
NP_440570.1_5 Forward -100 -81 -2.45882 0.279
NP_441750.1_4 Forward -220 -201 3.83436 0.23
NP_441340.1_5 Forward -215 -208 15.6737 0.0124
NP_441340.1_5 Reverse -208 -215 15.6737 0.0124
NP_441340.1_9 Reverse -141 -151 9.60492 0.236
NP_441271.1_1 Forward -222 -204 13.588 0.22
NP_440168.1_9 Forward -364 -345 -5.01543 0.296
NP_440586.1_8 Forward -215 -208 13.2151 0.026
NP_440586.1_8 Reverse -208 -215 13.2151 0.026
NP_442251.1_6 Forward -215 -208 15.2804 0.0124
NP_442251.1_6 Reverse -208 -215 15.2804 0.0124
NP_442959.1_5 Reverse -227 -246 9.14423 0.224
NP_441262.1_3 Reverse -207 -214 14.7888 0.0223
NP_441262.1_3 Forward -216 -209 14.7888 0.0223
NP_440027.1_3 Forward -363 -345 2.18168 0.292
NP_443051.1_1 Reverse -206 -215 18.0926 0.00402
NP_443051.1_1 Forward -217 -208 10.4228 0.00754
NP_440451.1_10 Reverse -208 -227 10.2251 0.264
NP_439937.1_9 Reverse -206 -223 -15.0064 0.287
NP_440439.1_1 Forward -219 -206 2.08423 0.138
NP_440372.1_2 Forward -215 -208 16.3621 0.0124
NP_440372.1_2 Reverse -208 -215 16.3621 0.0124
NP_441803.1_2 Forward -343 -324 4.916 0.171
NP_439977.1_5 Forward -222 -203 4.62101 0.152
NP_440139.1_1 Reverse -201 -220 9.24175 0.102
NP_440139.1_1 Forward -222 -203 5.01354 0.168
NP_440210.1_9 Forward -250 -231 14.7854 0.127
NP_440267.1_2 Reverse -202 -216 9.83206 0.156
NP_442384.1_10 Reverse -207 -220 9.06573 0.0574
NP_442384.1_10 Forward -109 -96 2.87088 0.21
NP_441877.1_9 Reverse -232 -249 2.00546 0.292
NP_442262.1_10 Forward -215 -208 14.1988 0.0123
NP_442262.1_10 Reverse -208 -215 14.1988 0.0123
NP_441689.1_5 Forward -218 -208 15.3192 0.0403
NP_441689.1_5 Reverse -386 -396 7.35439 0.197
NP_441689.1_5 Forward -111 -101 5.68278 0.215
NP_441814.1_8 Forward -76 -57 18.5715 0.296
NP_440163.1_10 Forward -298 -288 12.2714 0.163
NP_440163.1_10 Forward -219 -209 11.3864 0.169
NP_440344.1_10 Reverse -200 -217 6.13536 0.0188
NP_440344.1_10 Forward -223 -206 1.21881 0.0311
NP_440344.1_10 Reverse -322 -339 -9.99092 0.163
NP_442910.1_1 Forward -223 -204 -5.99873 0.254
NP_441965.1_3 Forward -226 -207 3.6377 0.181
NP_441965.1_3 Forward -357 -338 1.27776 0.223
NP_442529.1_4 Reverse -198 -217 7.86593 0.283
NP_440297.1_9 Forward -215 -205 9.51814 0.0917
NP_440297.1_9 Reverse -208 -218 9.32148 0.0917
NP_440297.1_9 Forward -88 -78 0.275027 0.282
NP_442280.1_10 Forward -400 -382 5.45442 0.284
NP_440894.1_10 Reverse -324 -343 12.8808 0.122
NP_441778.1_8 Reverse -58 -72 16.9119 0.273
NP_440999.1_9 Reverse -203 -217 4.42448 0.116
NP_440888.1_2 Reverse -207 -221 18.1901 0.00261
NP_440888.1_2 Forward -216 -202 7.76712 0.184
NP_441949.1_5 Reverse -232 -251 13.5722 0.191
NP_441543.1_2 Reverse -208 -217 16.9127 0.00359
NP_441543.1_2 Forward -215 -206 9.34117 0.0818
NP_442845.1_2 Forward -222 -208 16.3225 0.0636
NP_442845.1_2 Reverse -207 -221 5.01447 0.247
NP_442845.1_4 Reverse -205 -224 7.57094 0.189
NP_440739.1_7 Reverse -100 -119 9.63589 0.29
NP_441551.1_5 Reverse -123 -139 10.5792 0.193
NP_441469.1_8 Reverse -206 -215 13.3727 0.073
NP_441469.1_8 Reverse -369 -378 7.57121 0.227
NP_441469.1_8 Forward -217 -208 6.48957 0.227
NP_443064.1_6 Forward -216 -206 13.8273 0.0796
NP_443064.1_6 Reverse -207 -217 12.5669 0.0796
NP_443064.1_6 Reverse -329 -339 8.78555 0.271
NP_442578.1_7 Forward -215 -208 14.5921 0.026
NP_442578.1_7 Reverse -208 -215 14.5921 0.026
NP_440071.1_5 Forward -362 -343 11.5042 0.224
NP_441462.1_2 Forward -216 -206 20.1379 0.000967
NP_441462.1_2 Reverse -207 -217 11.5831 0.00406
NP_441462.1_5 Forward -62 -43 3.83436 0.285
NP_441621.1_7 Reverse -205 -219 -4.91696 0.248
NP_443062.1_1 Forward -216 -198 9.71601 0.129
NP_443062.1_6 Forward -224 -205 11.2092 0.105
NP_443062.1_6 Forward -386 -367 4.71934 0.214
NP_442204.1_1 Forward -362 -351 0.353664 0.281
NP_440544.1_5 Reverse -7 -14 14.5681 0.264
NP_440516.1_8 Forward -216 -207 16.9127 0.00442
NP_440516.1_8 Reverse -207 -216 16.9127 0.00442
NP_442428.1_5 Forward -215 -208 15.8704 0.0124
NP_442428.1_5 Reverse -208 -215 15.8704 0.0124
NP_441353.1_7 Reverse -203 -221 17.4229 0.196
NP_441267.1_1 Forward -222 -203 3.53937 0.234
NP_440673.1_2 Forward -226 -207 14.2917 0.0986
NP_440673.1_2 Reverse -197 -216 12.1455 0.153
NP_440673.1_3 Forward -214 -207 12.4288 0.0426
NP_440673.1_3 Reverse -209 -216 12.4288 0.0426
NP_440673.1_7 Reverse -331 -350 8.94757 0.119
NP_440673.1_7 Reverse -89 -108 1.0811 0.254
NP_440865.1_9 Forward -222 -203 -8.752 0.269
NP_441052.1_2 Reverse -207 -217 19.9412 0.00106
NP_441052.1_2 Forward -216 -206 10.4031 0.0285
NP_441052.1_2 Reverse -329 -339 -0.708283 0.294
NP_442219.1_9 Reverse -208 -217 17.7976 0.00718
NP_442219.1_9 Forward -215 -206 8.25953 0.0681
NP_440436.1_4 Reverse -208 -217 17.2072 0.00233
NP_440436.1_4 Forward -215 -206 15.9289 0.00508
NP_441884.1_9 Reverse -204 -223 -13.6686 0.138
NP_441884.1_9 Forward -356 -337 -19.4701 0.15
NP_441884.1_9 Reverse -326 -345 -22.0267 0.275
NP_441884.1_9 Forward -219 -200 -23.5016 0.284
NP_440314.1_9 Forward -215 -196 0.786102 0.0952
NP_441086.1_3 Reverse -131 -150 5.84819 0.289
NP_441719.1_4 Forward -215 -208 16.3621 0.0124
NP_441719.1_4 Reverse -208 -215 16.3621 0.0124
NP_441733.1_10 Reverse -204 -217 10.049 0.106
NP_441733.1_10 Forward -219 -206 8.18076 0.14
NP_441004.1_1 Reverse -364 -383 -9.53865 0.209
NP_441004.1_2 Reverse -359 -378 -3.04881 0.271
NP_442366.1_3 Reverse -206 -224 -5.88071 0.298
NP_443054.1_2 Forward -218 -204 19.4691 0.0134
NP_443054.1_2 Reverse -367 -381 3.8345 0.24
NP_441851.1_10 Reverse -206 -216 17.4829 0.0027
NP_441851.1_10 Forward -217 -207 15.8113 0.00552
NP_442001.1_1 Forward -251 -232 -4.03287 0.276
NP_442622.1_1 Forward -217 -198 -12.5869 0.27
NP_442622.1_5 Reverse -205 -224 -4.6221 0.204
NP_442515.1_1 Forward -217 -203 14.8476 0.0276
NP_442515.1_1 Reverse -206 -220 1.57289 0.155
NP_441982.1_6 Reverse -69 -78 10.7665 0.292
NP_442689.1_8 Forward -263 -246 -8.31929 0.294
NP_440940.1_7 Forward -226 -208 5.03327 0.234
NP_441349.1_10 Forward -226 -207 18.1907 0.00776
NP_441409.1_6 Forward -222 -203 -7.86702 0.158
NP_440432.1_9 Forward -215 -200 27.0209 0.000471
NP_439960.1_4 Reverse -126 -145 12.585 0.28
NP_439960.1_10 Forward -345 -327 6.60732 0.138
NP_442944.1_9 Reverse -276 -295 14.9458 0.283
NP_440474.1_8 Forward -215 -201 7.86545 0.196
NP_440474.1_8 Reverse -208 -222 6.58715 0.222
NP_441124.1_5 Reverse -141 -151 14.2496 0.215
NP_440431.1_3 Reverse -131 -150 -2.16383 0.165
NP_442450.1_5 Reverse -205 -215 10.1081 0.115
NP_442450.1_5 Forward -218 -208 9.32148 0.115
NP_440588.1_2 Forward -225 -206 -1.57384 0.155
NP_440195.1_4 Reverse -88 -107 5.40766 0.284
NP_440195.1_5 Reverse -201 -220 5.01433 0.264
NP_442006.1_2 Reverse -198 -215 -8.22096 0.192
NP_442006.1_2 Reverse -87 -104 -15.7924 0.228
NP_441003.1_9 Forward -362 -343 5.11266 0.268
NP_443047.1_7 Forward -215 -196 3.34271 0.3
NP_440483.1_1 Forward -102 -83 -8.35868 0.282
NP_441570.1_1 Reverse -207 -225 9.55725 0.0106
NP_441570.1_1 Forward -216 -198 -11.2889 0.191
NP_441078.1_4 Forward -216 -207 19.6659 0.0007
NP_441078.1_4 Reverse -207 -216 19.6659 0.0007
NP_442348.1_2 Forward -83 -74 9.83282 0.273
NP_442348.1_2 Forward -84 -75 7.47288 0.28
NP_442443.1_1 Reverse -362 -381 13.1758 0.0815
NP_441091.1_5 Reverse -325 -344 3.44104 0.285
NP_441094.1_6 Forward -223 -206 16.656 0.136
NP_440526.1_3 Forward -215 -204 20.7076 0.0073
NP_440526.1_3 Reverse -208 -219 10.1862 0.0646
NP_441432.1_8 Forward -217 -208 16.8143 0.00595
NP_441432.1_8 Reverse -206 -215 8.35786 0.0755
NP_442320.1_8 Forward -222 -208 14.9459 0.0125
NP_442320.1_8 Reverse -201 -215 5.01447 0.0442
NP_441732.1_2 Forward -220 -204 -16.3627 0.165
NP_441732.1_2 Forward -140 -124 -16.5594 0.174
NP_440497.1_6 Forward -349 -330 -5.9004 0.264
NP_440759.1_10 Reverse -189 -208 3.83436 0.253
NP_440760.1_1 Forward -216 -197 -20.3551 0.222
NP_442797.1_7 Forward -223 -205 6.90232 0.198
NP_440199.1_10 Forward -219 -209 16.7946 0.0381
NP_440913.1_1 Reverse -347 -365 10.0489 0.175
NP_440913.1_1 Forward -218 -200 6.41066 0.228
NP_440713.1_4 Forward -226 -207 8.35759 0.17
NP_440713.1_4 Reverse -344 -363 1.57275 0.284
NP_442489.1_7 Forward -216 -207 20.1576 0.000695
NP_442489.1_7 Reverse -207 -216 20.1576 0.000695
NP_440559.1_1 Reverse -208 -217 17.4043 0.00658
NP_440559.1_1 Forward -215 -206 17.306 0.00658
NP_441659.2_8 Forward -216 -206 19.3512 0.000966
NP_441659.2_8 Reverse -207 -217 18.1713 0.00133
NP_442913.1_10 Reverse -198 -217 17.3057 0.0136
NP_441040.1_2 Forward -105 -86 -16.3235 0.295
NP_441040.1_5 Forward -227 -208 5.50599 0.232
NP_440779.1_5 Forward -216 -199 4.75873 0.0372
NP_442346.1_5 Reverse -206 -216 17.9746 0.00128
NP_442346.1_5 Forward -217 -207 16.6963 0.00248
NP_442346.1_10 Forward -218 -199 5.99764 0.168
NP_440545.1_3 Reverse -123 -140 -1.43612 0.168
NP_440545.1_3 Reverse -203 -220 -3.40274 0.203
NP_441856.1_3 Reverse -97 -116 0.687771 0.213
NP_441786.1_10 Forward -225 -206 7.7676 0.256
NP_440743.1_6 Forward -382 -364 19.3903 0.0195
NP_440459.1_2 Forward -231 -214 9.47861 0.227
NP_440459.1_2 Forward -192 -175 8.59364 0.254
NP_440010.1_3 Reverse -89 -108 -5.80207 0.25
NP_440010.1_10 Forward -350 -331 2.55606 0.276
NP_442311.1_5 Reverse -45 -64 3.14605 0.247
NP_441050.1_5 Reverse -97 -115 0.0191479 0.254
NP_441047.1_2 Reverse -128 -147 2.0644 0.239
NP_441833.1_4 Forward -215 -208 15.9687 0.0124
NP_441833.1_4 Reverse -208 -215 15.9687 0.0124
NP_442162.1_9 Forward -215 -208 16.2637 0.0124
NP_442162.1_9 Reverse -208 -215 16.2637 0.0124
NP_440671.1_4 Forward -222 -208 15.6342 0.0405
NP_442199.1_7 Forward -126 -107 2.85027 0.255
NP_442140.1_3 Forward -215 -205 14.828 0.0433
NP_442140.1_3 Reverse -208 -218 4.40493 0.243
NP_441671.1_1 Reverse -353 -372 1.0811 0.263
NP_440875.1_9 Forward -214 -204 8.5667 0.233
NP_440875.1_9 Reverse -346 -356 6.91198 0.294
NP_441813.1_5 Forward -218 -208 15.9097 0.01
NP_441813.1_5 Reverse -205 -215 8.92815 0.0347
NP_440590.1_4 Reverse -208 -221 2.57589 0.0845
NP_440590.1_4 Reverse -122 -135 -3.91395 0.256
NP_440590.1_4 Forward -215 -202 -4.20895 0.258
NP_440567.1_1 Reverse -208 -222 18.4858 0.0145
NP_440567.1_1 Forward -215 -201 7.9644 0.0637
NP_442497.1_10 Forward -215 -206 19.8626 0.00532
NP_442497.1_10 Reverse -208 -217 10.4228 0.0087
NP_440821.1_4 Reverse -205 -215 19.5479 0.00399
NP_440821.1_4 Forward -218 -208 18.2696 0.00448
NP_441239.1_9 Reverse -205 -217 14.4936 0.0272
NP_441239.1_9 Reverse -78 -90 13.117 0.0389
NP_441239.1_9 Forward -218 -206 7.90546 0.147
NP_441727.1_3 Reverse -200 -219 3.24438 0.291
NP_441892.1_1 Reverse -198 -215 2.00546 0.145
NP_442044.1_9 Forward -216 -197 9.43923 0.146
NP_442270.1_9 Forward -227 -208 -7.76869 0.214
NP_442643.1_1 Forward -222 -203 -11.8986 0.235
NP_442643.1_5 Forward -177 -158 2.26107 0.25
NP_441874.1_1 Forward -94 -80 10.3243 0.261
NP_440546.1_4 Forward -216 -206 12.8578 0.0572
NP_440546.1_4 Reverse -207 -217 10.046 0.109
NP_440546.1_4 Reverse -100 -110 10.046 0.109
NP_443033.1_7 Forward -227 -208 11.8975 0.281
NP_440462.1_6 Reverse -205 -215 10.4031 0.0396
NP_440462.1_6 Forward -218 -208 7.74818 0.0699
NP_440868.1_4 Forward -220 -208 6.23383 0.0878
NP_440868.1_4 Reverse -203 -215 0.530633 0.21
NP_442479.1_9 Forward -266 -247 -13.0786 0.288
NP_441868.1_4 Forward -223 -209 15.1426 0.282
NP_441474.1_1 Reverse -328 -347 -0.689632 0.255
NP_441474.1_1 Forward -74 -55 -3.04956 0.29
NP_442402.1_4 Reverse -115 -134 -8.85106 0.284
NP_442460.1_7 Forward -228 -209 21.8289 0.00459
NP_442460.1_7 Forward -350 -331 -1.18052 0.292
NP_440696.1_3 Forward -226 -208 -0.374176 0.243
NP_442039.1_4 Forward -215 -208 15.1821 0.0124
NP_442039.1_4 Reverse -208 -215 15.1821 0.0124
NP_442039.1_7 Forward -134 -124 7.25653 0.277
NP_442786.1_5 Reverse -83 -102 7.47261 0.262
NP_442837.1_3 Forward -215 -208 15.7721 0.0124
NP_442837.1_3 Reverse -208 -215 15.7721 0.0124
NP_442837.1_3 Reverse -330 -337 5.74231 0.275
NP_440805.1_6 Forward -163 -149 15.9285 0.265
NP_439994.1_3 Reverse -206 -225 13.3161 0.126
NP_442053.1_1 Forward -216 -207 18.3876 0.0007
NP_442053.1_1 Reverse -207 -216 18.3876 0.0007
NP_440505.1_3 Forward -218 -208 16.303 0.00696
NP_440505.1_3 Reverse -205 -215 7.84651 0.147
NP_441959.1_5 Reverse -76 -95 6.29264 0.26
NP_440520.1_10 Reverse -59 -78 16.0265 0.115
NP_440914.1_1 Reverse -207 -217 17.5935 0.000537
NP_440914.1_1 Forward -216 -206 8.51751 0.186
NP_441011.1_8 Forward -215 -206 14.356 0.0249
NP_441011.1_8 Reverse -208 -217 8.25953 0.144
NP_442533.1_3 Reverse -6 -24 17.9578 0.186
NP_442533.1_6 Forward -216 -207 17.2076 0.00137
NP_442533.1_6 Reverse -207 -216 17.2076 0.00137
NP_441219.1_6 Reverse -197 -215 12.1139 0.192
NP_441482.1_7 Forward -222 -208 -9.04686 0.193
NP_441482.1_7 Reverse -201 -215 -10.5218 0.209
NP_439944.1_9 Reverse -208 -218 19.0562 0.00329
NP_439944.1_9 Forward -215 -205 17.4829 0.00423
NP_441028.1_6 Forward -106 -96 3.51951 0.292
NP_440116.1_8 Reverse -208 -227 -1.47551 0.12
NP_440115.1_6 Reverse -204 -214 10.1081 0.115
NP_442728.1_7 Reverse -87 -101 11.6026 0.289
NP_439965.1_1 Forward -225 -206 22.5172 0.00292
NP_441961.1_4 Forward -224 -205 4.22769 0.276
NP_441602.1_3 Forward -368 -349 -4.81876 0.274
NP_441972.1_5 Reverse -208 -227 -6.09707 0.228
NP_441106.1_1 Reverse -206 -215 9.73449 0.0311
NP_441106.1_1 Forward -217 -208 9.63616 0.0311
NP_442306.1_10 Forward -221 -202 -21.6334 0.282
NP_441286.1_1 Forward -217 -205 24.2284 0.000758
NP_441286.1_1 Reverse -206 -218 11.937 0.0108
NP_440670.1_8 Forward -216 -207 18.3876 0.000699
NP_440670.1_8 Reverse -207 -216 18.3876 0.000699
NP_441930.1_2 Reverse -369 -379 16.008 0.19
NP_440886.1_7 Reverse -206 -216 8.04271 0.0805
NP_440886.1_7 Forward -217 -207 7.94438 0.0805
NP_442614.1_2 Reverse -207 -221 12.1926 0.166
NP_441399.1_1 Reverse -83 -102 24.8772 0.000994
NP_442072.1_9 Forward -217 -199 -20.532 0.204
NP_442072.1_9 Reverse -206 -224 -20.532 0.204
NP_441753.1_10 Reverse -198 -217 5.30933 0.186
NP_440907.2_8 Forward -215 -205 19.449 0.00351
NP_440907.2_8 Forward -108 -98 3.8145 0.297
NP_442264.1_2 Reverse -203 -220 11.1502 0.185
NP_441021.1_1 Forward -215 -196 -11.3086 0.259
NP_441021.1_8 Forward -221 -203 3.46073 0.226
NP_441463.1_3 Reverse -197 -216 -0.197208 0.132
NP_441463.1_3 Forward -226 -207 -4.32711 0.201
NP_441463.1_3 Reverse -334 -353 -5.21209 0.222
NP_441463.1_6 Forward -218 -204 9.89475 0.242
NP_441626.1_2 Forward -215 -208 15.7721 0.0124
NP_441626.1_2 Reverse -208 -215 15.7721 0.0124
NP_442362.1_7 Forward -100 -82 15.3588 0.22
NP_442238.1_3 Forward -227 -208 5.11266 0.254
NP_441401.1_1 Forward -130 -111 14.3558 0.135
NP_441401.1_8 Forward -54 -35 22.7635 0.0174
NP_442615.1_1 Forward -225 -207 8.08229 0.0297
NP_442615.1_1 Reverse -198 -216 -2.3408 0.143
NP_441962.1_4 Forward -221 -202 -0.0988766 0.117
NP_440387.1_1 Forward -216 -200 -0.0397962 0.134
NP_440387.1_1 Reverse -207 -223 -2.69473 0.148
NP_441431.1_2 Reverse -204 -218 6.78381 0.261
NP_441993.1_1 Forward -222 -203 5.26024 0.205
NP_440114.1_10 Forward -216 -202 17.0108 0.0131
NP_440114.1_10 Reverse -207 -221 11.0127 0.127
NP_440492.1_9 Forward -329 -315 14.3095 0.294
NP_441552.1_3 Forward -223 -204 17.0099 0.126
NP_440293.1_3 Forward -346 -327 4.03102 0.192
NP_440293.1_3 Reverse -362 -381 -1.67217 0.239
NP_440766.1_4 Forward -220 -206 5.50613 0.11
NP_439988.1_3 Forward -101 -87 10.816 0.219
NP_439988.1_3 Forward -71 -57 7.76774 0.273
NP_441237.1_9 Forward -215 -205 17.2863 0.00348
NP_442743.1_5 Reverse -208 -227 18.0924 0.0604
NP_439910.1_2 Reverse -199 -216 -21.3973 0.183
NP_439910.1_2 Forward -224 -207 -22.184 0.215
NP_440457.1_1 Forward -220 -208 9.57708 0.092
NP_440457.1_1 Reverse -203 -215 8.20045 0.101
NP_440457.1_1 Reverse -96 -108 7.02048 0.105
NP_440987.1_4 Reverse -144 -163 5.80098 0.195
NP_440798.1_6 Forward -215 -202 1.88757 0.192
NP_441801.1_4 Reverse -77 -87 3.12662 0.231
NP_441984.1_3 Reverse -203 -221 5.03403 0.295
NP_440473.1_9 Reverse -196 -215 -7.27704 0.236
NP_442509.1_9 Forward -216 -206 17.3841 0.00128
NP_442509.1_9 Reverse -207 -217 8.14104 0.192
NP_442514.1_5 Reverse -79 -98 -9.73604 0.298
NP_440554.1_4 Reverse -208 -218 7.05986 0.106
NP_440554.1_4 Forward -215 -205 6.27322 0.123
NP_441885.1_5 Reverse -207 -217 20.9245 0.000538
NP_441885.1_5 Forward -216 -206 11.3864 0.00668
NP_442341.1_7 Forward -217 -203 9.34103 0.0751
NP_442341.1_7 Reverse -206 -220 6.09611 0.135
NP_442395.2_4 Reverse -88 -107 1.57197 0.237
NP_440423.1_6 Reverse -199 -218 -4.13045 0.126
NP_443000.1_3 Forward -187 -168 10.2621 0.286
NP_443000.1_7 Forward -218 -208 17.0896 0.00865
NP_443000.1_7 Reverse -205 -215 2.14332 0.226
NP_441842.1_10 Forward -223 -209 10.7177 0.155
NP_441842.1_10 Reverse -200 -214 7.76774 0.245
NP_440275.1_3 Reverse -205 -215 19.5479 0.00756
NP_440275.1_3 Forward -218 -208 8.1415 0.0602
NP_440091.1_1 Forward -220 -208 18.3285 0.0114
NP_440091.1_1 Reverse -203 -215 10.8554 0.0429
NP_443060.1_5 Forward -224 -205 8.55343 0.207
NP_441902.1_3 Forward -340 -330 13.8563 0.226
NP_443010.1_10 Reverse -204 -221 8.56882 0.16
NP_443010.1_10 Forward -219 -202 6.73278 0.179
NP_442451.1_2 Forward -224 -205 6.29264 0.117
NP_442753.1_1 Reverse -164 -183 10.4217 0.285
NP_440175.1_4 Reverse -205 -224 -11.4069 0.19
NP_440149.1_8 Reverse -207 -226 -4.6221 0.211
NP_441105.1_3 Forward -227 -208 1.0811 0.117
NP_440216.1_1 Forward -216 -202 6.29277 0.0156
NP_440216.1_1 Reverse -207 -221 -0.590395 0.0284
NP_440172.1_1 Forward -216 -206 16.303 0.00854
NP_440172.1_1 Reverse -207 -217 15.0247 0.00945
NP_440167.1_3 Reverse -197 -216 8.45592 0.28
NP_442015.1_10 Forward -220 -207 0.60927 0.221
NP_441226.1_7 Forward -215 -208 14.4934 0.0123
NP_441226.1_7 Reverse -208 -215 14.4934 0.0123
NP_441757.1_6 Forward -100 -81 6.09597 0.278
NP_441111.1_7 Forward -215 -207 18.7023 0.00294
NP_441111.1_7 Reverse -208 -216 18.7023 0.00294
NP_442379.1_10 Forward -223 -206 6.43035 0.115
NP_442379.1_10 Reverse -200 -217 -2.41943 0.23
NP_441766.1_2 Forward -216 -207 17.5026 0.00297
NP_441766.1_2 Reverse -207 -216 17.5026 0.00297
NP_441766.1_9 Forward -352 -333 -0.787193 0.261
NP_442252.1_3 Forward -386 -368 8.7706 0.248
NP_440416.1_1 Forward -216 -197 -5.9004 0.16
NP_440416.1_9 Forward -223 -204 -16.6185 0.218
NP_443052.1_8 Reverse -197 -216 28.5154 0.000423
NP_443052.1_8 Forward -226 -207 -6.29373 0.142
NP_442564.1_4 Reverse -208 -227 17.327 0.216
NP_442564.1_10 Reverse -79 -93 13.2743 0.244
NP_440261.1_5 Forward -215 -202 -0.865694 0.0655
NP_440988.1_10 Reverse -211 -225 6.06058 0.234
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCCCGGATTTGTTTTAACACGGGCATTTCCCGGGCCGCCCATTCGATGCGCTGACGACCTTGGGGAGCGAGGCTAATATCTTTAATATCGTATTTCTGTTTAACGGGCGTTGCTACCATACGGGGTAATTCCTAAGAACTTTGCTTGAATGTGATATAACTTAACATTTTATCGGTCTGGAATGGCGATCGCCCCTTTGTCCATTGACAGACGGTTAGCGCAGGTAGGCAAAGCTCTAATCTGATCCTAAATTTTCCTACCAAAGCTCTGGCAACCCTGCAGAACTTTAAACCTATCCCCCTAGGCTTGGGGCCAGGGGACTTTTCAAGCAACTCCTTGGGGCACTATTTGGAAATGTGATAATGGGAGTTATAATTCGCCTCTCGGAGAAAAGTTGAA

CDS

ATGCACTCATTGTCATCACTGGAATTTCCTGAGCTTAAAAGTGTTATTGCCCAATGTAATCTTGAAGAAAAACTTGAATTATTAGAACTTTTGGAAAAGGATACTTTTGGCACCAGATTTAACAAATTTTTAAATTCTGTCAAAACTGACGAATTAACCTTAGAAGACATTACACAAGAAGTTGAATCGGTCCGGCAAGCTAATTATCATGAACAATGA

Protein

MHSLSSLEFPELKSVIAQCNLEEKLELLELLEKDTFGTRFNKFLNSVKTDELTLEDITQEVESVRQANYHEQ