Your browser is old and dusty. Try Google Chrome!

Details for ssr2153

ORF ssr2153
Accession NP_440173.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -384 -398 12.6843 0.0449
NP_441061.1_2 Forward -296 -282 6.88276 0.112
NP_441061.1_2 Forward -263 -249 -1.67204 0.269
NP_441061.1_2 Forward -302 -288 -1.8687 0.274
NP_441061.1_3 Reverse -195 -214 15.0432 0.217
NP_440795.1_7 Forward -391 -384 14.6904 0.0123
NP_440795.1_7 Reverse -384 -391 14.6904 0.0123
NP_441418.1_6 Forward -81 -62 -27.8282 0.203
NP_441418.1_6 Reverse -179 -198 -30.2865 0.267
NP_442291.1_5 Reverse -382 -398 4.87675 0.0841
NP_442291.1_5 Forward -393 -377 3.59845 0.107
NP_440897.1_6 Reverse -108 -127 5.99684 0.108
NP_441453.1_4 Reverse -383 -391 16.539 0.00633
NP_441453.1_4 Forward -392 -384 16.539 0.00633
NP_441453.1_4 Reverse -332 -340 5.23096 0.157
NP_441453.1_7 Reverse -317 -324 12.9205 0.23
NP_442151.1_6 Forward -392 -378 17.6008 0.00997
NP_442151.1_6 Reverse -383 -397 10.226 0.127
NP_442151.1_6 Forward -341 -327 8.25939 0.178
NP_442151.1_6 Forward -201 -187 8.06273 0.183
NP_441818.1_1 Forward -391 -380 10.1862 0.232
NP_441818.1_1 Reverse -384 -395 10.1862 0.232
NP_441818.1_9 Reverse -262 -281 -10.817 0.299
NP_440226.1_1 Forward -392 -373 9.43923 0.0726
NP_442169.1_1 Reverse -270 -289 -3.54046 0.295
NP_442173.1_1 Forward -391 -383 15.4574 0.00633
NP_442173.1_1 Reverse -384 -392 15.4574 0.00633
NP_442173.1_1 Forward -340 -332 8.86921 0.0882
NP_442752.1_4 Forward -392 -385 13.8055 0.0199
NP_442752.1_4 Reverse -383 -390 13.8055 0.0199
NP_443027.1_4 Forward -394 -384 14.0414 0.0452
NP_442975.1_10 Reverse -379 -393 10.9137 0.0516
NP_442975.1_10 Forward -396 -382 4.91554 0.234
NP_440784.1_7 Forward -391 -384 15.9687 0.0123
NP_440784.1_7 Reverse -384 -391 15.9687 0.0123
NP_442909.1_7 Reverse -384 -398 13.077 0.128
NP_442909.1_7 Forward -340 -326 10.8154 0.131
NP_440061.1_3 Reverse -93 -112 7.96426 0.278
NP_440061.1_9 Reverse -381 -395 10.717 0.123
NP_439979.1_9 Reverse -327 -345 8.67227 0.26
NP_442062.1_8 Forward -392 -382 17.3846 0.00193
NP_442062.1_8 Reverse -383 -393 17.3846 0.00193
NP_441859.1_2 Reverse -174 -193 14.5516 0.178
NP_441802.1_1 Forward -253 -234 10.1275 0.197
NP_440304.1_4 Forward -394 -384 10.8948 0.051
NP_440304.1_4 Reverse -330 -340 6.17489 0.174
NP_440304.1_4 Reverse -381 -391 1.84832 0.299
NP_442242.1_4 Forward -391 -384 14.3954 0.0124
NP_442242.1_4 Reverse -384 -391 14.3954 0.0124
NP_440044.1_8 Forward -391 -372 5.89931 0.0967
NP_440370.1_10 Reverse -323 -342 8.06259 0.243
NP_442110.1_7 Reverse -383 -397 10.7177 0.0644
NP_442110.1_7 Forward -392 -378 0.0979218 0.267
NP_441925.1_4 Forward -340 -321 -16.6192 0.284
NP_440856.1_7 Reverse -176 -195 -1.47551 0.182
NP_441083.1_5 Forward -392 -382 20.3345 0.00053
NP_441083.1_5 Reverse -383 -393 20.3345 0.00053
NP_439957.1_9 Forward -171 -152 2.81659 0.3
NP_441738.1_2 Forward -390 -383 15.28 0.0102
NP_441738.1_2 Reverse -385 -392 15.28 0.0102
NP_441558.1_5 Forward -394 -375 19.6656 0.00692
NP_441942.1_3 Reverse -294 -313 16.8907 0.228
NP_440209.1_1 Reverse -383 -391 18.1123 0.00295
NP_440209.1_1 Forward -392 -384 18.1123 0.00295
NP_440655.1_2 Forward -340 -321 1.67108 0.293
NP_442889.1_8 Reverse -380 -394 10.9137 0.077
NP_442889.1_8 Forward -395 -381 4.12889 0.27
NP_442570.1_3 Reverse -285 -304 -8.94866 0.294
NP_441025.1_5 Forward -257 -243 14.7492 0.258
NP_441716.1_1 Reverse -383 -397 19.4691 0.00947
NP_443013.1_9 Reverse -281 -300 9.83255 0.285
NP_442111.1_4 Reverse -382 -396 12.0943 0.0451
NP_442111.1_4 Reverse -331 -345 4.32615 0.212
NP_441163.1_1 Forward -339 -322 7.11794 0.249
NP_440906.1_5 Forward -391 -384 15.8704 0.0124
NP_440906.1_5 Reverse -384 -391 15.8704 0.0124
NP_440747.1_10 Forward -395 -383 17.2469 0.000522
NP_440747.1_10 Reverse -380 -392 14.9853 0.00221
NP_440747.1_10 Forward -86 -74 -12.0557 0.199
NP_441130.1_10 Forward -394 -380 7.86607 0.146
NP_441486.1_1 Reverse -380 -394 21.3374 0.00239
NP_441486.1_1 Forward -395 -381 14.7492 0.00628
NP_442634.1_4 Reverse -381 -395 -1.67204 0.149
NP_441014.1_5 Reverse -378 -396 11.3272 0.258
NP_441014.1_8 Reverse -185 -204 -7.67036 0.281
NP_442848.1_1 Forward -398 -384 17.5025 0.0143
NP_442848.1_9 Reverse -15 -34 -1.57384 0.293
NP_441012.1_4 Forward -311 -298 7.59077 0.272
NP_441012.1_4 Forward -396 -383 7.49244 0.272
NP_441012.1_4 Reverse -175 -188 7.29578 0.272
NP_441012.1_4 Reverse -385 -398 7.09911 0.272
NP_443018.1_3 Forward -391 -384 14.8871 0.0123
NP_443018.1_3 Reverse -384 -391 14.8871 0.0123
NP_441634.1_8 Forward -394 -380 2.2612 0.169
NP_440376.1_1 Forward -392 -383 19.4693 0.000692
NP_440376.1_1 Reverse -383 -392 19.4693 0.000692
NP_440376.1_1 Forward -200 -191 3.63797 0.2
NP_441588.1_4 Forward -390 -380 18.1713 0.0143
NP_442730.1_8 Forward -349 -330 3.14526 0.276
NP_442687.1_7 Forward -393 -383 8.92815 0.0994
NP_442687.1_7 Reverse -382 -392 8.92815 0.0994
NP_442485.1_3 Forward -190 -171 -4.03212 0.277
NP_442485.1_3 Reverse -168 -187 -4.72043 0.285
NP_442485.1_3 Forward -199 -180 -5.60541 0.293
NP_440642.1_10 Forward -141 -127 1.5723 0.29
NP_441013.1_2 Forward -110 -92 4.9357 0.222
NP_441422.1_7 Forward -343 -326 -3.79607 0.235
NP_440667.1_2 Reverse -262 -281 -4.32711 0.247
NP_441950.1_8 Reverse -169 -183 4.71948 0.292
NP_442658.1_1 Reverse -381 -391 6.76441 0.214
NP_442658.1_1 Forward -394 -384 6.76441 0.214
NP_440141.1_8 Reverse -273 -292 13.2741 0.157
NP_440141.1_8 Forward -194 -175 7.7676 0.236
NP_442782.1_2 Reverse -288 -302 16.2242 0.173
NP_442782.1_2 Forward -188 -174 6.19444 0.229
NP_442782.1_2 Reverse -255 -269 5.01447 0.249
NP_442782.1_7 Forward -400 -381 1.0811 0.207
NP_441414.1_9 Forward -392 -373 -10.817 0.296
NP_443061.1_10 Forward -185 -166 17.8957 0.269
NP_441487.1_9 Forward -342 -323 4.42435 0.146
NP_441487.1_9 Forward -393 -374 3.53937 0.155
NP_442937.1_5 Reverse -378 -397 10.5209 0.158
NP_442937.1_5 Forward -206 -187 5.80098 0.3
NP_441958.1_5 Forward -393 -383 12.2714 0.00183
NP_441958.1_5 Reverse -382 -392 12.2714 0.00183
NP_441127.1_1 Forward -176 -162 8.35772 0.3
NP_442836.1_5 Forward -398 -379 4.22769 0.213
NP_440203.1_5 Reverse -386 -396 15.7125 0.0611
NP_440984.1_7 Reverse -378 -392 15.0442 0.0615
NP_439990.1_5 Forward -397 -384 11.3273 0.128
NP_439990.1_5 Reverse -317 -330 6.01747 0.261
NP_442911.1_2 Forward -351 -332 -10.1286 0.27
NP_442911.1_2 Forward -104 -85 -10.6203 0.284
NP_441580.1_6 Forward -257 -238 -5.9004 0.235
NP_440153.1_5 Reverse -384 -398 5.89945 0.191
NP_440153.1_8 Forward -194 -181 -2.63565 0.246
NP_440200.1_3 Reverse -265 -284 5.50599 0.298
NP_443055.1_6 Reverse -375 -393 2.96833 0.201
NP_441099.1_5 Forward -301 -282 -10.227 0.247
NP_441294.1_7 Reverse -379 -393 18.5615 0.00493
NP_440411.1_10 Reverse -265 -284 9.96891 0.279
NP_441646.1_1 Forward -348 -329 1.37609 0.231
NP_441646.1_1 Forward -399 -380 -1.7705 0.294
NP_442438.1_10 Forward -397 -383 8.84938 0.0718
NP_442438.1_10 Forward -99 -85 6.48943 0.114
NP_442438.1_10 Forward -346 -332 -0.000409212 0.244
NP_442438.1_10 Reverse -378 -392 -0.0987402 0.248
NP_442431.1_10 Reverse -174 -192 3.85406 0.213
NP_440377.1_1 Forward -246 -229 11.6602 0.271
NP_441000.1_6 Forward -393 -379 -4.62196 0.248
NP_441000.1_9 Reverse -10 -29 18.0059 0.229
NP_440147.1_4 Reverse -381 -394 11.3273 0.0326
NP_440147.1_4 Forward -394 -381 2.18257 0.209
NP_440147.1_4 Forward -343 -330 0.805932 0.244
NP_441550.1_8 Reverse -381 -391 14.6309 0.0132
NP_441550.1_8 Forward -394 -384 12.3692 0.0336
NP_441550.1_8 Reverse -330 -340 6.96107 0.183
NP_441916.1_7 Forward -392 -382 10.3048 0.0261
NP_441916.1_7 Reverse -383 -393 10.3048 0.0261
NP_441916.1_10 Forward -400 -381 17.0107 0.0888
NP_440206.1_4 Forward -301 -282 1.76863 0.289
NP_440345.1_3 Forward -321 -307 16.3407 0.175
NP_441041.1_4 Forward -392 -373 -6.68705 0.172
NP_441041.1_7 Reverse -380 -392 11.8878 0.0689
NP_441041.1_7 Forward -344 -332 8.00067 0.151
NP_440569.1_6 Reverse -133 -152 5.01433 0.24
NP_442004.1_6 Reverse -383 -397 8.45605 0.14
NP_441725.1_4 Forward -397 -383 3.63724 0.278
NP_441725.1_5 Reverse -384 -394 11.2881 0.0247
NP_441725.1_5 Forward -391 -381 2.04498 0.115
NP_441725.1_8 Forward -198 -179 15.8307 0.132
NP_439966.1_7 Forward -394 -384 15.8108 0.0124
NP_439966.1_7 Reverse -381 -391 7.25606 0.15
NP_439966.1_7 Forward -333 -323 4.10949 0.289
NP_442941.1_3 Reverse -384 -394 19.9412 0.00262
NP_442941.1_3 Forward -391 -381 11.0914 0.0116
NP_440289.1_2 Reverse -380 -393 4.54251 0.066
NP_440289.1_2 Forward -395 -382 3.75586 0.0741
NP_440983.1_5 Forward -200 -181 -5.11376 0.263
NP_441514.1_6 Reverse -135 -142 12.7238 0.29
NP_441678.1_9 Reverse -311 -330 -4.72043 0.296
NP_442281.1_1 Reverse -378 -392 17.8952 0.00513
NP_442281.1_1 Forward -397 -383 17.6002 0.00542
NP_442256.1_2 Reverse -381 -399 -9.81395 0.292
NP_440437.1_1 Forward -398 -379 -3.24547 0.234
NP_442500.1_2 Reverse -260 -279 7.96426 0.283
NP_441556.1_10 Forward -346 -332 12.0712 0.2
NP_440498.1_1 Reverse -374 -392 -0.0791831 0.218
NP_441644.1_6 Forward -392 -382 17.3841 0.00127
NP_441644.1_6 Reverse -383 -393 17.3841 0.00127
NP_442215.1_2 Reverse -381 -397 13.7265 0.0222
NP_442215.1_2 Forward -394 -378 7.63002 0.0678
NP_442215.1_2 Forward -203 -187 -2.69473 0.202
NP_442029.1_1 Reverse -253 -272 -19.1751 0.281
NP_442029.1_6 Reverse -378 -397 5.80098 0.248
NP_442029.1_6 Reverse -180 -199 5.50599 0.25
NP_440929.1_8 Forward -392 -383 19.2726 0.000701
NP_440929.1_8 Reverse -383 -392 19.2726 0.000701
NP_440929.1_8 Reverse -332 -341 5.3096 0.141
NP_442933.1_10 Forward -392 -383 17.601 0.00325
NP_442933.1_10 Reverse -383 -392 17.601 0.00325
NP_441751.2_8 Reverse -384 -398 7.86607 0.0336
NP_442554.1_8 Reverse -384 -394 15.9097 0.00747
NP_442554.1_8 Forward -391 -381 15.3197 0.00882
NP_442554.1_8 Forward -340 -330 7.35486 0.0931
NP_442554.1_8 Forward -93 -83 2.63497 0.265
NP_441762.1_7 Forward -393 -381 0.432302 0.0747
NP_441762.1_7 Reverse -382 -394 -6.84419 0.284
NP_442313.1_4 Reverse -305 -324 8.25926 0.286
NP_442313.1_5 Reverse -289 -308 13.0775 0.185
NP_442142.1_4 Forward -395 -382 15.4566 0.0264
NP_442142.1_4 Reverse -380 -393 10.9334 0.0646
NP_442292.1_1 Forward -391 -382 18.486 0.00229
NP_442292.1_1 Reverse -384 -393 18.486 0.00229
NP_442381.1_2 Reverse -190 -204 21.2391 0.105
NP_443009.1_5 Reverse -382 -393 8.90795 0.0965
NP_443009.1_5 Forward -393 -382 8.90795 0.0965
NP_441715.1_4 Reverse -384 -394 14.828 0.0268
NP_441715.1_4 Forward -391 -381 7.94484 0.107
NP_441448.1_1 Reverse -247 -266 4.916 0.268
NP_440158.1_8 Reverse -265 -284 9.73422 0.264
NP_440183.1_9 Reverse -178 -197 -20.8467 0.292
NP_441198.1_1 Forward -200 -181 2.16274 0.235
NP_440379.1_5 Reverse -170 -189 -3.3438 0.204
NP_440464.1_10 Forward -391 -381 13.0082 0.169
NP_441468.1_1 Forward -391 -384 15.8704 0.0124
NP_441468.1_1 Reverse -384 -391 15.8704 0.0124
NP_441468.1_1 Reverse -299 -306 6.72562 0.126
NP_441020.2_6 Reverse -381 -398 7.217 0.237
NP_441015.1_10 Reverse -180 -199 6.29264 0.109
NP_441015.1_10 Reverse -327 -346 -1.08219 0.169
NP_441015.1_10 Reverse -250 -269 -7.37537 0.266
NP_441673.1_1 Forward -392 -383 20.8459 0.000698
NP_441673.1_1 Reverse -383 -392 20.8459 0.000698
NP_441731.1_9 Reverse -251 -268 12.3302 0.234
NP_441876.1_9 Forward -286 -276 12.9592 0.267
NP_441826.1_2 Forward -398 -384 20.0591 0.00776
NP_441826.1_2 Reverse -377 -391 -2.26202 0.269
NP_441764.1_8 Forward -251 -241 11.1193 0.287
NP_442868.1_6 Forward -394 -384 9.91146 0.038
NP_442868.1_6 Reverse -381 -391 9.81313 0.038
NP_442719.1_2 Forward -297 -279 -11.3879 0.291
NP_441612.1_2 Reverse -108 -118 15.1326 0.21
NP_441612.1_2 Reverse -383 -393 8.54929 0.21
NP_441612.1_2 Forward -392 -382 8.54929 0.21
NP_442227.1_2 Forward -352 -333 -0.590531 0.255
NP_442361.1_3 Forward -398 -385 13.589 0.14
NP_442361.1_3 Forward -347 -334 12.9006 0.168
NP_442427.1_8 Reverse -374 -393 8.94757 0.192
NP_442808.1_1 Reverse -382 -392 8.63269 0.0481
NP_442808.1_1 Forward -393 -383 8.63269 0.0481
NP_442808.1_1 Forward -269 -259 1.35624 0.287
NP_440145.1_3 Reverse -373 -392 6.88262 0.0503
NP_442050.1_5 Forward -394 -384 16.4991 0.00812
NP_442050.1_5 Forward -298 -288 8.92768 0.206
NP_442050.1_5 Reverse -381 -391 7.64939 0.243
NP_440558.1_2 Forward -267 -248 -3.54046 0.236
NP_440558.1_2 Forward -306 -287 -7.37537 0.293
NP_441878.1_6 Forward -393 -383 10.4031 0.0176
NP_441878.1_6 Reverse -382 -392 10.4031 0.0176
NP_441878.1_6 Reverse -191 -201 -7.98478 0.285
NP_441878.1_6 Reverse -107 -117 -7.98478 0.285
NP_441036.1_8 Forward -342 -332 14.0414 0.0316
NP_441036.1_8 Forward -393 -383 8.33817 0.174
NP_441036.1_8 Reverse -382 -392 8.33817 0.174
NP_442650.1_2 Reverse -383 -397 6.58777 0.13
NP_441557.1_5 Forward -392 -383 19.9609 0.000699
NP_441557.1_5 Reverse -383 -392 19.9609 0.000699
NP_441557.1_5 Forward -341 -332 -1.77023 0.299
NP_441445.1_1 Reverse -374 -393 6.4893 0.148
NP_441433.1_8 Forward -262 -243 11.2092 0.147
NP_441564.1_10 Forward -317 -298 10.3242 0.146
NP_442183.1_1 Reverse -383 -397 16.3225 0.0151
NP_441238.1_10 Reverse -98 -112 10.6193 0.292
NP_442347.1_2 Forward -391 -382 12.4878 0.056
NP_442347.1_2 Reverse -384 -393 12.4878 0.056
NP_442645.1_2 Forward -400 -381 -5.60541 0.0709
NP_442965.1_2 Reverse -283 -302 -2.65548 0.255
NP_441037.1_4 Reverse -330 -340 10.5338 0.195
NP_441037.1_4 Reverse -381 -391 7.9999 0.237
NP_442594.1_8 Reverse -320 -339 8.84924 0.201
NP_440151.1_5 Reverse -292 -311 9.14423 0.201
NP_441633.1_3 Reverse -381 -394 1.10092 0.109
NP_441633.1_3 Forward -343 -330 -4.30728 0.191
NP_441633.1_3 Forward -394 -381 -5.97891 0.236
NP_440136.1_2 Forward -391 -384 15.9687 0.0123
NP_440136.1_2 Reverse -384 -391 15.9687 0.0123
NP_442998.1_5 Reverse -119 -129 7.84651 0.28
NP_442998.1_10 Forward -390 -383 15.5754 0.0102
NP_442998.1_10 Reverse -385 -392 15.5754 0.0102
NP_440899.1_8 Reverse -348 -367 -9.53865 0.264
NP_440299.1_1 Forward -396 -383 22.3398 0.000547
NP_440299.1_1 Reverse -379 -392 4.44361 0.207
NP_441799.1_1 Reverse -379 -393 13.5686 0.0311
NP_441799.1_1 Forward -396 -382 5.30886 0.214
NP_441799.1_1 Reverse -328 -342 4.62054 0.242
NP_442802.1_2 Forward -195 -176 15.9282 0.203
NP_441007.1_10 Reverse -180 -193 7.29578 0.145
NP_441007.1_10 Reverse -327 -340 3.26421 0.182
NP_441007.1_10 Reverse -378 -391 0.707601 0.219
NP_441007.1_10 Forward -397 -384 -0.865694 0.295
NP_441435.1_6 Reverse -171 -190 2.75272 0.259
NP_441449.1_8 Forward -253 -234 14.8567 0.219
NP_440256.1_1 Reverse -380 -399 -1.37718 0.103
NP_440256.1_1 Forward -395 -376 -2.26216 0.115
NP_440256.1_1 Reverse -139 -158 -9.83364 0.289
NP_441559.1_8 Forward -397 -383 -6.68692 0.279
NP_441270.1_5 Reverse -242 -261 12.3111 0.237
NP_440915.1_6 Forward -396 -382 3.8345 0.1
NP_441179.1_9 Reverse -64 -74 9.12434 0.284
NP_442069.1_1 Forward -193 -174 16.7149 0.266
NP_441494.1_6 Reverse -327 -340 8.27909 0.23
NP_442993.1_1 Forward -392 -376 -7.21796 0.146
NP_442993.1_1 Reverse -198 -214 -9.87289 0.197
NP_440677.1_1 Reverse -99 -118 11.0125 0.163
NP_442386.1_9 Reverse -382 -391 13.8639 0.0289
NP_442386.1_9 Forward -393 -384 13.8639 0.0289
NP_441750.1_1 Reverse -323 -342 -13.1769 0.3
NP_441340.1_5 Forward -391 -384 15.6737 0.0124
NP_441340.1_5 Reverse -384 -391 15.6737 0.0124
NP_441340.1_5 Forward -340 -333 4.07068 0.239
NP_441947.1_5 Reverse -291 -310 10.0292 0.281
NP_442484.1_2 Reverse -174 -193 6.78429 0.156
NP_442714.1_5 Forward -193 -174 -0.295539 0.272
NP_440586.1_1 Reverse -351 -370 -4.91709 0.278
NP_440586.1_1 Forward -204 -185 -5.31042 0.285
NP_440586.1_8 Forward -391 -384 13.2151 0.026
NP_440586.1_8 Reverse -384 -391 13.2151 0.026
NP_440586.1_8 Reverse -390 -397 5.8403 0.283
NP_442874.1_1 Forward -199 -180 16.2241 0.107
NP_442251.1_6 Forward -391 -384 15.2804 0.0124
NP_442251.1_6 Reverse -384 -391 15.2804 0.0124
NP_441262.1_3 Reverse -383 -390 14.7888 0.0223
NP_441262.1_3 Forward -392 -385 14.7888 0.0223
NP_441262.1_3 Forward -341 -334 5.44732 0.11
NP_440027.1_3 Reverse -322 -340 6.80322 0.222
NP_440027.1_3 Forward -307 -289 4.54162 0.257
NP_443051.1_1 Reverse -382 -391 10.4228 0.00754
NP_443051.1_1 Forward -393 -384 10.4228 0.00754
NP_443051.1_1 Reverse -331 -340 0.196389 0.213
NP_439937.1_8 Forward -190 -171 0.294447 0.235
NP_439937.1_8 Reverse -171 -190 -3.14714 0.265
NP_440398.1_6 Forward -332 -313 7.86593 0.234
NP_440408.1_3 Reverse -173 -192 -5.80207 0.295
NP_440439.1_1 Reverse -329 -342 0.412608 0.192
NP_440439.1_1 Forward -395 -382 0.117615 0.202
NP_440372.1_2 Forward -391 -384 16.3621 0.0124
NP_440372.1_2 Reverse -384 -391 16.3621 0.0124
NP_440372.1_2 Forward -340 -333 4.36568 0.205
NP_441803.1_2 Forward -397 -378 13.4708 0.0502
NP_441803.1_2 Forward -193 -174 3.34271 0.191
NP_441803.1_2 Reverse -180 -199 0.58944 0.249
NP_440139.1_1 Reverse -377 -396 2.9486 0.219
NP_442384.1_10 Reverse -383 -396 17.4239 0.00585
NP_442384.1_10 Forward -392 -379 1.10092 0.268
NP_441604.1_4 Reverse -315 -334 -5.31042 0.256
NP_441018.1_7 Reverse -81 -100 11.2092 0.19
NP_441018.1_7 Reverse -245 -264 8.25926 0.253
NP_441018.1_7 Reverse -379 -398 7.86593 0.263
NP_442262.1_10 Forward -391 -384 14.1988 0.0123
NP_442262.1_10 Reverse -384 -391 14.1988 0.0123
NP_441689.1_5 Forward -394 -384 15.3192 0.0403
NP_441689.1_5 Reverse -381 -391 5.78111 0.197
NP_440163.1_10 Forward -395 -385 12.4681 0.159
NP_440344.1_10 Reverse -376 -393 -7.04099 0.115
NP_440344.1_10 Forward -399 -382 -7.13932 0.115
NP_440344.1_10 Reverse -207 -224 -9.20427 0.141
NP_440344.1_10 Reverse -172 -189 -9.79426 0.156
NP_440297.1_9 Reverse -384 -394 9.32148 0.0917
NP_440297.1_9 Forward -391 -381 -0.118297 0.282
NP_440100.1_3 Forward -88 -69 -1.96717 0.166
NP_441592.1_4 Reverse -214 -233 -2.95047 0.274
NP_440999.1_9 Forward -396 -382 3.34284 0.131
NP_440888.1_2 Reverse -383 -397 15.8302 0.00862
NP_440888.1_2 Forward -392 -378 10.3237 0.0974
NP_441543.1_2 Forward -391 -382 16.9127 0.00359
NP_441543.1_2 Reverse -384 -393 16.9127 0.00359
NP_442845.1_2 Reverse -377 -391 11.0127 0.138
NP_442845.1_2 Reverse -383 -397 7.76774 0.195
NP_442845.1_2 Forward -398 -384 5.40779 0.233
NP_442845.1_2 Reverse -287 -301 4.62115 0.256
NP_441469.1_8 Forward -95 -86 11.9961 0.136
NP_441469.1_8 Reverse -248 -257 11.0128 0.189
NP_441469.1_8 Forward -393 -384 6.48957 0.227
NP_441469.1_8 Reverse -382 -391 6.48957 0.227
NP_441469.1_8 Forward -342 -333 5.01461 0.297
NP_443064.1_6 Forward -392 -382 12.5669 0.0796
NP_443064.1_6 Reverse -383 -393 12.5669 0.0796
NP_442578.1_7 Forward -391 -384 14.5921 0.026
NP_442578.1_7 Reverse -384 -391 14.5921 0.026
NP_440220.1_4 Forward -304 -285 6.88182 0.193
NP_441462.1_2 Forward -392 -382 11.5831 0.00406
NP_441462.1_2 Reverse -383 -393 11.5831 0.00406
NP_441462.1_2 Forward -341 -331 -0.806614 0.254
NP_441621.1_7 Forward -190 -176 -5.21195 0.248
NP_443062.1_1 Forward -392 -374 4.84065 0.247
NP_443062.1_6 Forward -400 -381 0.294447 0.299
NP_441601.1_4 Forward -348 -329 -2.26216 0.293
NP_442204.1_1 Forward -396 -385 9.69511 0.0736
NP_442204.1_5 Reverse -182 -201 -0.197208 0.28
NP_442487.1_2 Forward -199 -180 3.24359 0.232
NP_440516.1_8 Forward -392 -383 16.9127 0.00442
NP_440516.1_8 Reverse -383 -392 16.9127 0.00442
NP_442428.1_5 Forward -391 -384 15.8704 0.0124
NP_442428.1_5 Reverse -384 -391 15.8704 0.0124
NP_440783.1_5 Reverse -282 -301 -3.3438 0.274
NP_442859.1_2 Reverse -283 -302 5.80098 0.201
NP_442120.1_10 Reverse -282 -301 -16.1268 0.296
NP_442823.1_8 Forward -314 -295 13.4708 0.259
NP_441867.1_2 Reverse -272 -291 -13.2752 0.277
NP_440673.1_2 Reverse -163 -182 9.31652 0.248
NP_440673.1_3 Forward -390 -383 12.4288 0.0426
NP_440673.1_3 Reverse -385 -392 12.4288 0.0426
NP_441052.1_2 Forward -392 -382 19.9412 0.00106
NP_441052.1_2 Reverse -383 -393 19.9412 0.00106
NP_441052.1_2 Reverse -108 -118 0.963343 0.255
NP_442219.1_9 Forward -391 -382 17.7976 0.00718
NP_442219.1_9 Reverse -384 -393 17.7976 0.00718
NP_440592.1_2 Reverse -371 -390 -2.16383 0.3
NP_440436.1_4 Forward -391 -382 17.2072 0.00233
NP_440436.1_4 Reverse -384 -393 17.2072 0.00233
NP_440436.1_4 Forward -263 -254 5.11253 0.222
NP_441884.1_9 Reverse -380 -399 -24.3866 0.286
NP_441893.1_10 Forward -183 -164 12.2908 0.229
NP_440314.1_9 Forward -391 -372 -9.34199 0.264
NP_440314.1_9 Forward -320 -301 -10.4236 0.298
NP_441719.1_4 Forward -391 -384 16.3621 0.0124
NP_441719.1_4 Reverse -384 -391 16.3621 0.0124
NP_441004.1_1 Reverse -282 -301 -12.2919 0.245
NP_441004.1_1 Reverse -102 -121 -13.2752 0.256
NP_441004.1_1 Reverse -317 -336 -13.4719 0.257
NP_441004.1_4 Reverse -279 -289 9.12481 0.259
NP_442366.1_3 Reverse -382 -400 -4.01242 0.262
NP_442366.1_5 Reverse -380 -390 14.8275 0.0375
NP_443029.1_8 Reverse -170 -189 11.7008 0.293
NP_442206.1_1 Forward -291 -272 -11.3086 0.219
NP_442206.1_10 Reverse -383 -398 12.8613 0.0799
NP_442206.1_10 Forward -81 -66 1.15987 0.236
NP_440328.1_4 Reverse -186 -205 1.17943 0.232
NP_443054.1_2 Forward -394 -380 11.0127 0.0761
NP_441851.1_10 Forward -393 -383 15.8113 0.00552
NP_441851.1_10 Reverse -382 -392 15.8113 0.00552
NP_442208.1_5 Reverse -266 -285 -6.58872 0.266
NP_441668.1_4 Reverse -313 -332 0.196116 0.245
NP_442515.1_1 Forward -393 -379 2.75286 0.13
NP_442515.1_1 Reverse -382 -396 1.86788 0.147
NP_441396.1_1 Forward -103 -84 2.75272 0.27
NP_441396.1_2 Forward -133 -116 25.8007 0.00177
NP_440593.1_1 Reverse -97 -116 12.8808 0.298
NP_440593.1_3 Reverse -180 -199 -0.983855 0.211
NP_440593.1_3 Reverse -378 -397 -1.67217 0.212
NP_440463.1_8 Reverse -175 -194 16.3099 0.158
NP_440940.1_7 Forward -198 -180 3.26332 0.274
NP_441349.1_10 Reverse -373 -392 6.58763 0.035
NP_441349.1_10 Reverse -294 -313 -3.24547 0.136
NP_441409.1_6 Forward -398 -379 0.392778 0.0649
NP_440432.1_9 Forward -391 -376 -2.47838 0.172
NP_442843.1_1 Reverse -250 -269 12.8808 0.0933
NP_439960.1_10 Reverse -175 -193 -3.81576 0.282
NP_440474.1_8 Forward -181 -167 4.71887 0.268
NP_442450.1_5 Forward -394 -384 9.32148 0.115
NP_442450.1_5 Reverse -381 -391 7.55152 0.13
NP_440588.1_2 Forward -126 -107 -4.72043 0.226
NP_440588.1_3 Reverse -120 -139 8.55425 0.296
NP_442006.1_2 Forward -194 -177 -17.1691 0.27
NP_442243.1_1 Forward -398 -380 3.45998 0.204
NP_442243.1_1 Reverse -185 -203 1.00172 0.22
NP_441570.1_1 Forward -392 -374 -11.0923 0.187
NP_441078.1_4 Forward -392 -383 19.6659 0.0007
NP_441078.1_4 Reverse -383 -392 19.6659 0.0007
NP_442729.1_8 Forward -396 -383 8.37742 0.125
NP_442348.1_2 Reverse -344 -353 7.57121 0.28
NP_440526.1_3 Forward -391 -380 10.2846 0.0646
NP_440526.1_3 Reverse -384 -395 7.92465 0.126
NP_441432.1_8 Reverse -382 -391 16.8143 0.00595
NP_441432.1_8 Forward -393 -384 16.8143 0.00595
NP_442320.1_4 Reverse -97 -116 14.6499 0.267
NP_442320.1_8 Reverse -377 -391 13.4709 0.0144
NP_442320.1_8 Forward -398 -384 3.44117 0.0617
NP_442344.1_7 Forward -391 -372 3.14605 0.0638
NP_441732.1_2 Forward -396 -380 1.92682 0.0254
NP_441732.1_2 Reverse -379 -395 -16.5594 0.174
NP_441732.1_2 Forward -345 -329 -17.0511 0.231
NP_440199.1_10 Forward -395 -385 7.64985 0.231
NP_440199.1_10 Reverse -380 -390 7.25653 0.231
NP_442510.1_5 Reverse -176 -195 14.1591 0.22
NP_440913.1_1 Reverse -286 -304 5.32902 0.241
NP_440713.1_4 Reverse -185 -204 1.96607 0.273
NP_442489.1_7 Forward -392 -383 20.1576 0.000695
NP_442489.1_7 Reverse -383 -392 20.1576 0.000695
NP_440559.1_1 Forward -391 -382 17.4043 0.00658
NP_440559.1_1 Reverse -384 -393 17.4043 0.00658
NP_442763.1_10 Forward -296 -277 9.63589 0.251
NP_441659.2_8 Forward -392 -382 18.1713 0.00133
NP_441659.2_8 Reverse -383 -393 18.1713 0.00133
NP_441659.2_8 Reverse -332 -342 2.53664 0.198
NP_442913.1_10 Reverse -374 -393 7.47261 0.0538
NP_442913.1_10 Reverse -289 -308 -0.39387 0.159
NP_442913.1_10 Reverse -183 -202 -5.99873 0.287
NP_441040.1_2 Reverse -169 -188 -12.8819 0.264
NP_441800.1_7 Forward -191 -173 -3.91409 0.283
NP_442776.1_8 Forward -399 -380 16.8132 0.18
NP_442346.1_5 Forward -393 -383 16.6963 0.00248
NP_442346.1_5 Reverse -382 -392 16.6963 0.00248
NP_442346.1_5 Reverse -388 -398 9.02648 0.118
NP_440545.1_3 Reverse -379 -396 2.49712 0.0994
NP_440545.1_3 Reverse -328 -345 -3.40274 0.203
NP_440545.1_3 Forward -345 -328 -6.54933 0.283
NP_440545.1_5 Reverse -318 -335 12.1336 0.21
NP_440025.1_1 Reverse -379 -398 11.7992 0.147
NP_440555.1_4 Reverse -287 -306 10.6192 0.207
NP_440486.1_4 Forward -193 -175 -3.81576 0.231
NP_440459.1_2 Forward -203 -186 10.3636 0.2
NP_440459.1_2 Reverse -374 -391 8.98696 0.243
NP_440459.1_2 Reverse -314 -331 7.61033 0.285
NP_440010.1_10 Reverse -180 -199 10.0292 0.209
NP_442551.1_4 Forward -293 -278 -2.8717 0.276
NP_442900.1_5 Reverse -289 -308 10.8159 0.155
NP_442900.1_8 Reverse -349 -368 9.93088 0.171
NP_442311.1_8 Forward -189 -170 8.35759 0.294
NP_442603.1_7 Reverse -383 -397 17.5018 0.0211
NP_441888.1_7 Forward -397 -383 3.53951 0.225
NP_441050.1_5 Reverse -258 -276 0.314141 0.25
NP_441833.1_4 Forward -391 -384 15.9687 0.0124
NP_441833.1_4 Reverse -384 -391 15.9687 0.0124
NP_440912.1_2 Reverse -87 -102 19.6461 0.0513
NP_441895.1_3 Forward -189 -170 -16.8151 0.277
NP_442162.1_9 Forward -391 -384 16.2637 0.0124
NP_442162.1_9 Reverse -384 -391 16.2637 0.0124
NP_442162.1_9 Forward -340 -333 3.4807 0.246
NP_442162.1_9 Reverse -333 -340 3.38237 0.276
NP_440788.1_8 Forward -183 -164 7.96426 0.286
NP_440671.1_4 Forward -398 -384 19.6658 0.0089
NP_440224.1_1 Reverse -372 -391 10.3242 0.0569
NP_440204.1_4 Reverse -262 -281 9.43923 0.138
NP_441341.1_6 Reverse -288 -307 11.1109 0.246
NP_442140.1_3 Forward -391 -381 12.2714 0.0632
NP_442140.1_3 Reverse -333 -343 5.5849 0.202
NP_442140.1_3 Reverse -384 -394 4.40493 0.243
NP_442914.1_8 Reverse -174 -193 6.88262 0.237
NP_440875.1_2 Forward -99 -80 24.6805 0.00505
NP_441813.1_5 Forward -394 -384 15.9097 0.01
NP_441813.1_5 Reverse -381 -391 8.63316 0.0367
NP_441259.1_3 Forward -190 -171 9.0459 0.251
NP_442089.1_6 Reverse -288 -307 5.80098 0.235
NP_440590.1_4 Forward -391 -378 9.36073 0.0365
NP_440590.1_4 Reverse -384 -397 -2.93064 0.251
NP_440567.1_1 Forward -391 -377 7.86607 0.0642
NP_440567.1_1 Reverse -384 -398 3.73617 0.137
NP_442497.1_10 Forward -391 -382 10.4228 0.0087
NP_442497.1_10 Reverse -384 -393 10.4228 0.0087
NP_440821.1_4 Forward -394 -384 18.2696 0.00448
NP_440821.1_4 Reverse -381 -391 9.41981 0.0286
NP_441239.1_9 Forward -394 -382 4.36554 0.253
NP_441239.1_9 Reverse -381 -393 3.38223 0.285
NP_441009.1_4 Reverse -312 -331 9.53756 0.3
NP_441727.1_3 Reverse -376 -395 6.29264 0.244
NP_440400.1_1 Forward -280 -261 0.981987 0.263
NP_440400.1_1 Forward -155 -136 -0.00131823 0.277
NP_441892.1_4 Forward -308 -289 -0.787193 0.28
NP_442044.1_1 Forward -296 -277 -6.49039 0.206
NP_441017.1_8 Reverse -341 -356 13.5496 0.174
NP_440876.1_5 Forward -262 -243 8.06259 0.277
NP_442138.1_10 Forward -392 -373 -8.06369 0.296
NP_441782.1_5 Reverse -177 -196 8.06259 0.278
NP_440546.1_4 Forward -392 -382 10.046 0.109
NP_440546.1_4 Reverse -383 -393 10.046 0.109
NP_440546.1_4 Reverse -389 -399 8.20381 0.199
NP_440546.1_6 Reverse -169 -188 7.96426 0.265
NP_442349.1_6 Forward -337 -318 2.85105 0.214
NP_440462.1_6 Forward -394 -384 7.74818 0.0699
NP_440462.1_6 Reverse -330 -340 6.96153 0.0932
NP_440462.1_6 Reverse -381 -391 1.35667 0.294
NP_442340.1_3 Reverse -178 -197 -4.42544 0.217
NP_442611.1_1 Reverse -317 -336 -2.55715 0.292
NP_440868.1_4 Forward -396 -384 6.1355 0.0878
NP_440868.1_4 Reverse -379 -391 5.93884 0.0879
NP_440868.1_4 Reverse -328 -340 0.137309 0.228
NP_440374.1_1 Reverse -261 -280 14.2574 0.193
NP_442402.1_4 Reverse -234 -253 -5.50783 0.244
NP_442402.1_4 Forward -125 -106 -6.3928 0.257
NP_441084.1_6 Forward -400 -386 9.24716 0.29
NP_442460.1_7 Forward -200 -181 3.73603 0.22
NP_440696.1_3 Reverse -294 -312 12.4089 0.109
NP_440696.1_3 Reverse -288 -306 1.39578 0.217
NP_440696.1_6 Reverse -270 -289 5.11266 0.282
NP_440843.1_8 Reverse -282 -301 12.2908 0.297
NP_442039.1_4 Forward -391 -384 15.1821 0.0124
NP_442039.1_4 Reverse -384 -391 15.1821 0.0124
NP_442039.1_7 Forward -180 -170 8.04317 0.267
NP_440825.1_7 Forward -391 -381 12.9096 0.152
NP_442837.1_3 Forward -391 -384 15.7721 0.0124
NP_442837.1_3 Reverse -384 -391 15.7721 0.0124
NP_442053.1_1 Forward -392 -383 18.3876 0.0007
NP_442053.1_1 Reverse -383 -392 18.3876 0.0007
NP_440505.1_3 Forward -394 -384 16.303 0.00696
NP_440505.1_3 Reverse -381 -391 9.22315 0.122
NP_440505.1_7 Reverse -185 -204 1.47442 0.249
NP_441959.1_10 Reverse -311 -329 13.5491 0.186
NP_440914.1_1 Forward -392 -382 17.5935 0.000537
NP_440914.1_1 Reverse -383 -393 17.5935 0.000537
NP_442470.1_4 Reverse -146 -165 14.5516 0.284
NP_441011.1_8 Forward -391 -382 8.25953 0.144
NP_441011.1_8 Reverse -384 -393 8.25953 0.144
NP_442101.1_10 Reverse -375 -394 -4.81876 0.151
NP_442533.1_6 Forward -392 -383 17.2076 0.00137
NP_442533.1_6 Reverse -383 -392 17.2076 0.00137
NP_442533.1_6 Forward -201 -192 2.55633 0.25
NP_442533.1_6 Reverse -185 -194 1.96635 0.28
NP_442322.1_4 Forward -305 -288 2.49641 0.21
NP_442322.1_4 Forward -271 -254 -9.99156 0.297
NP_441482.1_7 Forward -398 -384 17.6992 0.00499
NP_441482.1_7 Forward -194 -180 -9.44018 0.202
NP_441482.1_7 Reverse -326 -340 -12.1934 0.29
NP_439944.1_9 Reverse -384 -394 19.0562 0.00329
NP_439944.1_9 Forward -391 -381 10.5014 0.0887
NP_441697.1_5 Reverse -146 -165 -11.6982 0.298
NP_440116.1_5 Reverse -380 -397 7.61033 0.155
NP_440116.1_8 Forward -391 -372 -1.18052 0.117
NP_441527.1_4 Forward -172 -153 -0.907597 0.146
NP_441527.1_4 Forward -173 -154 -3.86785 0.175
NP_441527.1_4 Reverse -122 -141 -11.9847 0.285
NP_441527.1_4 Reverse -114 -133 -12.1756 0.285
NP_441527.1_4 Forward -170 -151 -12.9396 0.296
NP_440115.1_6 Forward -395 -385 9.41981 0.115
NP_440007.1_9 Forward -300 -286 17.9942 0.15
NP_440007.1_9 Forward -396 -382 10.0294 0.163
NP_439965.1_1 Forward -197 -178 -5.99873 0.211
NP_440572.1_9 Reverse -85 -104 13.5691 0.276
NP_441602.1_3 Reverse -180 -199 -4.52377 0.268
NP_441972.1_5 Forward -330 -311 -8.45701 0.265
NP_441106.1_1 Forward -393 -384 9.63616 0.0311
NP_441106.1_1 Reverse -382 -391 9.63616 0.0311
NP_441106.1_1 Reverse -331 -340 6.09625 0.101
NP_439903.1_6 Reverse -380 -399 -0.29631 0.28
NP_442588.1_8 Forward -110 -91 13.3725 0.238
NP_441439.1_7 Reverse -139 -158 13.8641 0.139
NP_441286.1_1 Reverse -382 -394 21.3768 0.00196
NP_441286.1_1 Forward -393 -381 12.9203 0.00815
NP_440670.1_8 Forward -392 -383 18.3876 0.000699
NP_440670.1_8 Reverse -383 -392 18.3876 0.000699
NP_440670.1_8 Forward -341 -332 5.40793 0.158
NP_440670.1_8 Reverse -332 -341 4.22796 0.202
NP_440886.1_7 Forward -393 -383 7.94438 0.0805
NP_440886.1_7 Reverse -382 -392 7.94438 0.0805
NP_440886.1_7 Forward -189 -179 5.19112 0.194
NP_440828.1_1 Reverse -59 -78 -1.47628 0.287
NP_442072.1_9 Reverse -382 -400 -14.0422 0.129
NP_442072.1_9 Forward -393 -375 -20.3354 0.204
NP_440513.1_7 Forward -107 -88 14.5524 0.206
NP_442401.1_2 Forward -342 -323 12.1917 0.159
NP_441808.1_8 Reverse -180 -199 13.3725 0.201
NP_441808.1_8 Forward -200 -181 10.5209 0.236
NP_440907.2_8 Forward -391 -381 7.64939 0.117
NP_442264.1_2 Reverse -379 -396 9.47861 0.196
NP_440841.1_4 Forward -394 -375 -8.94866 0.251
NP_441463.1_3 Reverse -373 -392 -1.08219 0.135
NP_441463.1_6 Reverse -381 -395 7.86544 0.25
NP_441626.1_2 Forward -391 -384 15.7721 0.0124
NP_441626.1_2 Reverse -384 -391 15.7721 0.0124
NP_441589.1_5 Reverse -248 -267 14.9151 0.291
NP_442209.1_4 Forward -142 -123 8.35759 0.299
NP_440107.1_2 Forward -397 -378 7.66927 0.299
NP_442794.1_1 Forward -396 -384 19.7052 0.00523
NP_442794.1_1 Reverse -379 -391 2.69391 0.286
NP_442615.1_1 Reverse -374 -392 20.2753 0.00406
NP_441962.1_4 Reverse -324 -343 -11.9969 0.25
NP_441962.1_4 Reverse -378 -397 -13.8652 0.279
NP_440387.1_1 Reverse -383 -399 20.3147 0.00303
NP_440387.1_1 Forward -341 -325 0.648521 0.122
NP_440855.1_1 Forward -188 -169 0.687771 0.229
NP_441431.1_2 Reverse -329 -343 9.93039 0.172
NP_441431.1_2 Forward -197 -183 8.3571 0.218
NP_441836.1_2 Reverse -276 -295 -2.85214 0.232
NP_441993.1_1 Reverse -377 -396 5.16278 0.207
NP_441993.1_1 Reverse -249 -268 1.65431 0.273
NP_441174.1_4 Reverse -106 -116 14.1397 0.267
NP_440114.1_10 Forward -392 -378 9.83269 0.16
NP_441510.2_7 Forward -398 -384 11.012 0.28
NP_440293.1_9 Reverse -293 -307 18.8817 0.0935
NP_440766.1_4 Forward -396 -382 7.9644 0.0871
NP_439988.1_3 Reverse -289 -303 10.521 0.219
NP_441237.1_9 Forward -391 -381 14.828 0.0242
NP_441311.1_2 Forward -87 -73 11.5037 0.248
NP_439910.1_2 Reverse -375 -392 -12.7442 0.0944
NP_439910.1_2 Forward -400 -383 -13.7275 0.162
NP_440457.1_1 Forward -396 -384 8.29878 0.101
NP_440798.1_6 Forward -391 -378 5.52582 0.14
NP_440798.1_6 Reverse -333 -346 2.2809 0.182
NP_441801.1_4 Forward -329 -319 2.63497 0.29
NP_442680.1_5 Reverse -106 -125 8.18053 0.171
NP_441984.1_3 Forward -313 -295 5.03403 0.295
NP_440473.1_3 Reverse -174 -193 15.3391 0.248
NP_442509.1_4 Reverse -185 -204 13.7658 0.26
NP_442509.1_9 Forward -392 -382 8.14104 0.192
NP_442509.1_9 Reverse -383 -393 8.14104 0.192
NP_442784.1_9 Reverse -183 -202 17.2074 0.0977
NP_440524.1_2 Forward -262 -243 -3.73712 0.27
NP_441159.1_8 Reverse -150 -169 0.981987 0.236
NP_440554.1_1 Forward -100 -86 22.714 0.0133
NP_440554.1_4 Reverse -384 -394 7.05986 0.106
NP_441761.1_7 Reverse -141 -160 19.0748 0.145
NP_441885.1_5 Forward -392 -382 20.9245 0.000538
NP_441885.1_5 Reverse -383 -393 20.9245 0.000538
NP_442341.1_7 Reverse -382 -396 16.1259 0.0186
NP_442341.1_7 Forward -393 -379 8.35772 0.0881
NP_442341.1_7 Forward -202 -188 2.35953 0.259
NP_442341.1_9 Reverse -381 -395 10.5204 0.133
NP_442341.1_9 Reverse -285 -299 9.73373 0.144
NP_442341.1_9 Forward -394 -380 7.27547 0.202
NP_443000.1_7 Forward -394 -384 17.0896 0.00865
NP_443000.1_7 Reverse -381 -391 10.3048 0.0345
NP_440076.1_5 Forward -195 -176 23.598 0.00613
NP_441842.1_10 Reverse -376 -390 9.73436 0.182
NP_440275.1_3 Forward -394 -384 8.1415 0.0602
NP_440275.1_3 Reverse -381 -391 8.04317 0.0602
NP_440275.1_3 Reverse -330 -340 8.04317 0.0602
NP_442932.1_9 Reverse -107 -126 4.71934 0.277
NP_440091.1_1 Reverse -379 -391 8.88877 0.0567
NP_440091.1_1 Forward -396 -384 -0.452677 0.273
NP_439962.1_4 Forward -190 -171 -1.18052 0.211
NP_439962.1_4 Forward -202 -183 -1.57384 0.216
NP_442495.1_3 Reverse -178 -196 12.1139 0.259
NP_440149.1_8 Reverse -179 -198 -5.11376 0.219
NP_441105.1_3 Reverse -378 -397 3.04771 0.0936
NP_441105.1_3 Reverse -372 -391 -9.44032 0.289
NP_440216.1_1 Forward -392 -378 8.06273 0.0068
NP_440216.1_1 Reverse -383 -397 -10.4235 0.145
NP_440216.1_9 Forward -359 -350 12.9794 0.213
NP_440216.1_9 Reverse -116 -125 6.39124 0.289
NP_440172.1_1 Forward -392 -382 15.0247 0.00945
NP_440172.1_1 Reverse -383 -393 15.0247 0.00945
NP_442015.1_10 Forward -396 -383 18.8988 0.00492
NP_442015.1_10 Reverse -188 -201 4.14919 0.178
NP_442015.1_10 Forward -345 -332 3.46087 0.182
NP_442015.1_10 Reverse -379 -392 1.59258 0.204
NP_441226.1_7 Forward -391 -384 14.4934 0.0123
NP_441226.1_7 Reverse -384 -391 14.4934 0.0123
NP_441226.1_7 Forward -340 -333 10.0685 0.103
NP_441757.1_3 Forward -393 -374 2.3594 0.155
NP_441111.1_7 Forward -391 -383 18.7023 0.00294
NP_441111.1_7 Reverse -384 -392 18.7023 0.00294
NP_441111.1_7 Forward -340 -332 -0.472234 0.131
NP_442379.1_10 Forward -399 -382 -1.53445 0.223
NP_441766.1_2 Forward -392 -383 17.5026 0.00297
NP_441766.1_2 Reverse -383 -392 17.5026 0.00297
NP_441766.1_2 Forward -341 -332 3.24465 0.227
NP_442417.1_5 Reverse -332 -346 14.3559 0.0633
NP_442417.1_5 Reverse -383 -397 11.8976 0.0981
NP_440416.1_1 Forward -392 -373 -11.4069 0.272
NP_440416.1_9 Forward -348 -329 3.6377 0.0362
NP_443052.1_8 Reverse -373 -392 6.88262 0.0292
NP_443052.1_9 Forward -266 -247 -3.83545 0.252
NP_441940.1_4 Forward -304 -285 9.53756 0.266
NP_442154.1_1 Reverse -177 -195 -14.1405 0.217
NP_442154.1_1 Reverse -344 -362 -16.8938 0.246
NP_440261.1_5 Forward -391 -378 -10.5021 0.201
NP_440261.1_5 Reverse -384 -397 -10.5021 0.201
NP_440261.1_5 Forward -340 -327 -12.4687 0.297
NP_440988.1_10 Forward -394 -380 8.19046 0.205
NP_440988.1_10 Reverse -183 -197 3.34982 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAACCATGGCGATCGCCAATTGACTCATGCGACGTAGCATCCAACGAAAACTCCCCTCTGCGGTCGGCTCCACTCCCCAAGGATAGCTCAAAAGCCAGCCCAAGCCGTTCCCATTACCCCCAAGCTGAAACCACCAACCCTTGCCACTGCAGAAAAAATCGAGCATTCTGGATTATGAGGATTACGGTTAAAATAGTTGGCCGTCAGCCACGGCGACAACGGTGGCAGCAAGAGTAATAAAAAACAACACCAGTGGACTTGCCCTATTCCACTTTTTTCCATGTTCATCCCCCCAAAGATGGGACTGACATGCCCTGAAGAGAGCCCTATGGTGGTAGTAGAGCAGTCAAAGCTCTAATTTGGTCTCGGTGTGTTAGGACGTGTCAAGGAGAGAAGCTG

CDS

ATGAAATTACAGCATCCCAAACCCCACAATTCTGTCCGTCGGGCGCTGCGCTCTTGGGCCGGCCCCTTGGCGATCGCCCTAGTGATGATCATTGGCCTGGAAACGGCGGCCACAGCGGCTTTTTCTAGTCTCGAGGAACATACCGTTGTTTATAACGGCAAATGCCCCGGTGACAGGGACGATGACTGTAGGGACTAA

Protein

MKLQHPKPHNSVRRALRSWAGPLAIALVMIIGLETAATAAFSSLEEHTVVYNGKCPGDRDDDCRD