Your browser is old and dusty. Try Google Chrome!

Details for ssr2087

ORF ssr2087
Accession NP_441164.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_5 Reverse -346 -365 4.03102 0.286
NP_441605.1_1 Forward -390 -371 13.2741 0.19
NP_441480.1_10 Forward -381 -362 8.16093 0.282
NP_442291.1_5 Forward -94 -78 -4.95634 0.292
NP_440897.1_6 Reverse -224 -243 -3.04956 0.231
NP_441818.1_1 Reverse -347 -358 8.71129 0.28
NP_441642.1_1 Forward -351 -332 1.96607 0.289
NP_440120.1_4 Reverse -307 -321 15.2409 0.273
NP_440931.1_7 Forward -371 -353 9.85146 0.297
NP_442287.1_1 Forward -356 -346 13.7459 0.277
NP_442655.1_1 Reverse -46 -65 1.0811 0.238
NP_442752.1_4 Forward -162 -155 12.1338 0.0546
NP_442752.1_4 Reverse -188 -195 5.25066 0.256
NP_442975.1_10 Forward -49 -35 10.6187 0.0541
NP_441250.1_4 Forward -196 -177 3.44104 0.298
NP_440061.1_9 Reverse -151 -165 10.717 0.123
NP_441054.1_2 Forward -120 -101 12.6841 0.229
NP_441476.1_5 Reverse -341 -360 6.39097 0.132
NP_442062.1_8 Reverse -346 -356 9.02648 0.069
NP_441035.1_3 Reverse -343 -362 0.687771 0.254
NP_439923.1_5 Forward -157 -138 18.584 0.0292
NP_441935.1_1 Reverse -347 -366 4.81767 0.293
NP_441594.1_6 Forward -358 -339 5.50599 0.209
NP_440856.1_7 Reverse -346 -365 -6.88371 0.246
NP_442570.1_3 Reverse -186 -205 -6.09707 0.255
NP_442570.1_3 Reverse -359 -378 -6.78538 0.259
NP_442570.1_3 Forward -180 -161 -9.24366 0.296
NP_439953.1_2 Reverse -340 -358 14.6705 0.183
NP_441716.1_1 Reverse -346 -360 5.99778 0.208
NP_442111.1_4 Reverse -295 -309 5.89945 0.145
NP_441163.1_7 Reverse -99 -118 20.2556 0.097
NP_441163.1_9 Reverse -2 -21 17.5024 0.112
NP_440906.1_5 Reverse -62 -69 8.79057 0.149
NP_440747.1_1 Reverse -2 -20 7.29564 0.251
NP_440944.1_2 Reverse -78 -97 3.6377 0.219
NP_442848.1_5 Reverse -61 -79 0.21581 0.276
NP_441012.1_4 Forward -353 -340 5.91914 0.286
NP_443018.1_3 Forward -19 -12 8.20058 0.153
NP_441634.1_8 Forward -357 -343 4.32615 0.13
NP_440376.1_1 Forward -77 -68 8.06287 0.0463
NP_440376.1_1 Reverse -61 -70 5.21127 0.144
NP_440376.1_1 Reverse -346 -355 3.63797 0.2
NP_440376.1_1 Forward -162 -153 0.196389 0.283
NP_441077.1_6 Reverse -18 -34 2.31983 0.286
NP_441846.1_10 Forward -173 -154 -13.4719 0.206
NP_442530.1_2 Reverse -89 -99 12.9597 0.263
NP_441029.1_8 Forward -370 -351 13.7649 0.242
NP_442782.1_2 Forward -114 -100 3.44117 0.265
NP_442782.1_2 Reverse -188 -202 0.392915 0.29
NP_442544.1_2 Reverse -161 -175 -0.0987402 0.217
NP_441414.1_9 Reverse -69 -88 -8.55534 0.239
NP_440203.1_5 Reverse -349 -359 9.02601 0.275
NP_442064.1_4 Reverse -336 -355 6.88182 0.246
NP_443055.1_3 Forward -364 -345 12.173 0.229
NP_442236.1_3 Reverse -337 -356 9.14423 0.238
NP_440809.1_4 Reverse -76 -95 3.93269 0.153
NP_441646.1_1 Forward -362 -343 2.26107 0.219
NP_441646.1_1 Forward -77 -58 2.26107 0.219
NP_441646.1_1 Reverse -339 -358 -1.37718 0.284
NP_441000.1_6 Forward -71 -57 4.42448 0.0953
NP_440147.1_4 Reverse -99 -112 3.16588 0.193
NP_440147.1_4 Forward -72 -59 -0.767364 0.299
NP_441175.1_1 Forward -213 -194 13.7649 0.198
NP_441725.1_5 Forward -92 -82 -1.10161 0.288
NP_439966.1_7 Reverse -151 -161 5.09279 0.243
NP_440289.1_2 Reverse -58 -71 2.08423 0.105
NP_440260.1_8 Reverse -327 -345 -6.4707 0.291
NP_441164.1_2 Forward -353 -334 22.1239 0.0135
NP_441164.1_3 Forward -400 -381 30.2854 0.00033
NP_441164.1_4 Forward -152 -133 21.2381 0.0283
NP_442012.1_1 Forward -361 -342 1.57275 0.214
NP_442012.1_1 Reverse -340 -359 -0.000545616 0.249
NP_441556.1_7 Forward -366 -347 10.9134 0.165
NP_441556.1_10 Reverse -341 -355 12.3632 0.195
NP_443049.1_6 Forward -163 -153 11.7385 0.24
NP_442215.1_2 Reverse -126 -142 -4.95634 0.242
NP_442215.1_2 Forward -180 -164 -6.7263 0.278
NP_442029.1_1 Forward -174 -155 -20.3551 0.297
NP_440566.1_6 Forward -86 -67 9.63589 0.287
NP_442142.1_4 Reverse -221 -234 2.37867 0.294
NP_443009.1_5 Forward -71 -60 9.20294 0.0965
NP_443009.1_5 Forward -356 -345 6.35136 0.165
NP_440357.1_3 Reverse -344 -363 17.0107 0.0928
NP_440279.1_2 Forward -155 -136 19.5673 0.0479
NP_441198.1_8 Forward -72 -62 10.5368 0.265
NP_441015.1_10 Reverse -219 -238 -8.65367 0.276
NP_441015.1_10 Reverse -329 -348 -9.047 0.278
NP_441015.1_10 Forward -177 -158 -11.5053 0.298
NP_442253.1_5 Reverse -343 -360 9.67528 0.122
NP_442253.1_5 Reverse -58 -75 -2.81276 0.284
NP_442253.1_5 Forward -379 -362 -4.38605 0.292
NP_442253.1_5 Forward -359 -342 -7.13932 0.298
NP_441876.1_9 Reverse -149 -159 10.9926 0.28
NP_442490.1_9 Reverse -331 -350 -6.58872 0.273
NP_442868.1_6 Forward -357 -347 1.55333 0.205
NP_442559.1_5 Reverse -319 -338 10.1275 0.124
NP_442808.1_1 Reverse -60 -70 5.68278 0.144
NP_442808.1_1 Reverse -345 -355 4.01116 0.212
NP_442808.1_1 Reverse -67 -77 2.92952 0.252
NP_441101.1_10 Reverse -357 -376 -3.73712 0.262
NP_440145.1_4 Reverse -154 -164 17.4824 0.0863
NP_440346.1_6 Reverse -75 -85 13.6614 0.291
NP_441114.1_3 Forward -354 -345 7.66954 0.231
NP_440558.1_2 Forward -359 -340 14.9458 0.0626
NP_440558.1_2 Reverse -343 -362 5.01433 0.147
NP_440558.1_2 Forward -358 -339 -4.6221 0.247
NP_441878.1_6 Forward -356 -346 -7.59145 0.245
NP_441878.1_6 Forward -163 -153 -7.98478 0.285
NP_441036.1_8 Reverse -60 -70 6.27322 0.239
NP_441557.1_8 Reverse -154 -164 13.9425 0.201
NP_441557.1_8 Forward -369 -359 13.5492 0.216
NP_441557.1_8 Reverse -106 -116 11.9759 0.236
NP_441445.1_1 Reverse -331 -350 0.0977854 0.283
NP_441458.1_10 Reverse -299 -318 1.27776 0.292
NP_442183.1_1 Forward -162 -148 7.37441 0.143
NP_442397.1_9 Forward -78 -59 3.24438 0.264
NP_442135.1_8 Forward -208 -190 9.95058 0.233
NP_441037.1_4 Forward -72 -62 10.8262 0.178
NP_442594.1_8 Reverse -329 -348 5.30933 0.247
NP_442594.1_8 Forward -165 -146 1.67108 0.298
NP_441633.1_3 Reverse -59 -72 -2.24233 0.176
NP_440136.1_1 Reverse -322 -338 8.90762 0.283
NP_440136.1_2 Reverse -62 -69 4.26735 0.218
NP_442998.1_5 Reverse -268 -278 14.3364 0.149
NP_442998.1_5 Forward -204 -194 10.5998 0.207
NP_442998.1_5 Forward -283 -273 8.23984 0.267
NP_442998.1_10 Forward -56 -49 7.21728 0.144
NP_440299.1_1 Reverse -184 -197 3.7553 0.232
NP_441007.1_10 Reverse -219 -232 -0.275709 0.273
NP_442334.1_2 Forward -163 -146 -5.36936 0.2
NP_440256.1_1 Reverse -221 -240 -8.65367 0.264
NP_441229.1_10 Forward -80 -61 3.73603 0.288
NP_441559.1_8 Reverse -342 -356 -6.58858 0.279
NP_441559.1_8 Reverse -341 -355 -7.17857 0.287
NP_441559.1_8 Forward -360 -346 -7.57189 0.295
NP_441866.1_4 Forward -106 -93 12.564 0.282
NP_442866.1_1 Reverse -350 -369 -3.54046 0.221
NP_440748.1_5 Forward -373 -354 6.09597 0.188
NP_441464.1_10 Forward -79 -65 7.66941 0.295
NP_441494.1_6 Reverse -341 -354 9.2624 0.227
NP_442386.1_9 Forward -356 -347 5.30919 0.257
NP_442791.1_5 Forward -205 -186 -7.76869 0.279
NP_442791.1_5 Forward -363 -344 -9.047 0.279
NP_440327.1_6 Reverse -349 -368 11.0125 0.188
NP_441160.1_5 Reverse -329 -348 -4.52377 0.288
NP_440586.1_8 Forward -19 -12 9.08521 0.178
NP_440192.1_4 Reverse -344 -363 12.2112 0.184
NP_440684.1_9 Forward -355 -341 7.86607 0.249
NP_440027.1_3 Forward -355 -337 9.16315 0.187
NP_439937.1_9 Reverse -345 -362 -11.3682 0.251
NP_439937.1_9 Forward -356 -339 -17.268 0.296
NP_440926.1_3 Reverse -45 -64 13.9625 0.202
NP_441181.1_4 Reverse -346 -365 20.7464 0.196
NP_440819.1_5 Forward -204 -196 7.68924 0.266
NP_442384.1_10 Forward -197 -184 12.8023 0.0249
NP_441018.1_3 Reverse -197 -216 15.1416 0.286
NP_441018.1_7 Reverse -336 -355 9.63589 0.22
NP_441018.1_7 Reverse -184 -203 7.96426 0.259
NP_442262.1_10 Forward -19 -12 9.38056 0.202
NP_440344.1_10 Reverse -339 -356 -1.0428 0.0491
NP_440282.1_2 Reverse -145 -164 7.47261 0.258
NP_442917.1_1 Forward -251 -232 6.88182 0.254
NP_440297.1_9 Forward -304 -294 4.20827 0.238
NP_440297.1_9 Forward -92 -82 -0.216628 0.282
NP_440894.1_10 Reverse -306 -325 3.73603 0.266
NP_440999.1_9 Reverse -342 -356 1.86788 0.157
NP_440888.1_2 Reverse -346 -360 12.6836 0.0405
NP_439969.1_1 Forward -371 -352 -5.9004 0.288
NP_441949.1_5 Reverse -42 -61 15.2111 0.146
NP_441759.1_7 Reverse -7 -26 11.9958 0.231
NP_442845.1_2 Forward -203 -189 5.50613 0.231
NP_442845.1_2 Forward -239 -225 4.52282 0.258
NP_442315.1_2 Forward -82 -70 12.527 0.291
NP_441443.1_7 Forward -147 -128 2.16274 0.218
NP_442859.1_2 Reverse -189 -208 4.32602 0.219
NP_441052.1_2 Forward -45 -35 3.42162 0.18
NP_441884.1_9 Reverse -343 -362 -14.1602 0.138
NP_442366.1_5 Forward -73 -63 11.2876 0.197
NP_440296.1_10 Forward -165 -146 -5.70374 0.225
NP_442206.1_1 Reverse -346 -365 -12.1936 0.226
NP_443054.1_2 Forward -357 -343 1.47456 0.245
NP_441851.1_10 Forward -71 -61 5.5849 0.207
NP_441851.1_10 Forward -163 -153 4.89658 0.24
NP_441851.1_10 Reverse -83 -93 4.69992 0.254
NP_441851.1_10 Reverse -60 -70 4.20827 0.282
NP_440682.1_2 Forward -369 -350 -16.9135 0.299
NP_442622.1_8 Forward -93 -75 -19.3521 0.296
NP_441542.1_4 Forward -105 -91 3.73617 0.264
NP_441501.1_3 Reverse -347 -366 19.2723 0.233
NP_440593.1_3 Forward -360 -341 -6.88371 0.282
NP_442450.1_5 Forward -72 -62 5.97822 0.209
NP_442006.1_2 Forward -171 -154 -15.3991 0.224
NP_442006.1_2 Forward -233 -216 -17.5624 0.279
NP_442006.1_2 Forward -364 -347 -18.5457 0.292
NP_441570.1_1 Reverse -346 -364 -7.94566 0.0989
NP_441078.1_4 Forward -70 -61 5.80125 0.104
NP_441078.1_4 Forward -355 -346 5.60459 0.111
NP_440526.1_3 Reverse -154 -165 1.3365 0.267
NP_440526.1_3 Forward -92 -81 1.23817 0.267
NP_441432.1_8 Forward -356 -347 5.40793 0.158
NP_441432.1_8 Forward -306 -297 3.34298 0.248
NP_441732.1_2 Reverse -342 -358 -14.3961 0.145
NP_441732.1_2 Reverse -59 -75 -17.5427 0.27
NP_442510.1_5 Reverse -215 -234 12.8808 0.252
NP_442489.1_7 Forward -355 -346 -1.6719 0.235
NP_442489.1_7 Reverse -346 -355 -1.96689 0.28
NP_440941.1_1 Forward -164 -154 15.123 0.278
NP_442749.1_5 Forward -110 -93 7.64525 0.259
NP_441040.1_2 Reverse -338 -357 -9.73531 0.238
NP_441800.1_7 Reverse -96 -114 -2.73412 0.265
NP_442346.1_10 Reverse -344 -363 2.85105 0.194
NP_440545.1_3 Forward -359 -342 4.85706 0.0661
NP_442857.1_5 Reverse -78 -97 12.5858 0.259
NP_441653.1_2 Forward -196 -177 6.13873 0.235
NP_440010.1_3 Forward -196 -177 -5.31042 0.25
NP_440010.1_4 Forward -365 -346 2.6536 0.222
NP_440847.1_3 Reverse -155 -169 17.3052 0.115
NP_441888.1_7 Reverse -183 -197 0.491246 0.295
NP_441948.1_4 Reverse -54 -72 -5.58572 0.271
NP_442060.1_10 Reverse -345 -364 13.8641 0.244
NP_440875.1_9 Forward -353 -343 7.30133 0.269
NP_441813.1_5 Reverse -59 -69 -0.806614 0.285
NP_440594.1_8 Reverse -102 -115 9.16348 0.193
NP_440590.1_4 Forward -196 -183 -2.24233 0.239
NP_442497.1_10 Reverse -62 -71 0.393051 0.175
NP_441239.1_9 Reverse -151 -163 5.15219 0.227
NP_441239.1_9 Reverse -59 -71 4.95553 0.234
NP_441239.1_9 Reverse -344 -356 3.77555 0.276
NP_441727.1_3 Reverse -339 -358 5.89931 0.248
NP_441892.1_1 Reverse -75 -92 -2.51776 0.223
NP_440665.1_1 Forward -370 -351 -13.6686 0.257
NP_442044.1_1 Reverse -341 -360 3.34271 0.132
NP_441874.1_1 Forward -175 -161 9.83269 0.27
NP_442809.1_6 Forward -355 -336 5.11266 0.256
NP_440546.1_4 Reverse -188 -198 8.20381 0.199
NP_442611.1_1 Reverse -341 -360 -1.37718 0.281
NP_442402.1_1 Reverse -97 -116 11.4058 0.254
NP_442402.1_6 Forward -117 -108 13.7661 0.276
NP_442402.1_10 Reverse -106 -116 14.3359 0.18
NP_441811.1_8 Forward -76 -62 6.09611 0.287
NP_440160.1_3 Forward -373 -354 12.3883 0.209
NP_439994.1_1 Forward -77 -58 13.2741 0.12
NP_439994.1_1 Reverse -188 -207 12.0942 0.14
NP_440505.1_3 Forward -116 -106 5.38824 0.23
NP_440505.1_3 Reverse -186 -196 4.50326 0.284
NP_440505.1_7 Reverse -357 -376 -2.36049 0.289
NP_440520.1_1 Forward -179 -160 -2.45882 0.208
NP_442971.1_3 Forward -232 -213 12.5858 0.294
NP_442533.1_6 Forward -355 -346 6.98123 0.0992
NP_442533.1_6 Reverse -68 -77 4.62128 0.179
NP_442533.1_6 Reverse -153 -162 4.0313 0.194
NP_442533.1_6 Reverse -224 -233 1.96635 0.28
NP_442541.1_10 Forward -356 -342 10.717 0.186
NP_442541.1_10 Reverse -346 -360 9.93039 0.204
NP_442232.1_3 Forward -78 -59 -14.2585 0.288
NP_441028.1_6 Forward -44 -34 5.48612 0.255
NP_442664.1_3 Forward -84 -70 15.5359 0.246
NP_440115.1_6 Forward -358 -348 4.60159 0.293
NP_441602.1_3 Reverse -341 -360 1.96607 0.206
NP_441602.1_3 Forward -360 -341 -0.197208 0.223
NP_441170.1_4 Forward -364 -346 5.82068 0.219
NP_441286.1_1 Forward -94 -82 -6.45087 0.265
NP_442674.1_3 Reverse -76 -95 3.24359 0.294
NP_441930.1_2 Reverse -346 -356 12.7631 0.253
NP_442614.1_2 Forward -349 -335 8.84938 0.244
NP_442614.1_2 Forward -305 -291 7.9644 0.257
NP_442401.1_2 Forward -398 -379 8.75009 0.23
NP_440907.2_8 Reverse -154 -164 7.0594 0.132
NP_441463.1_3 Reverse -336 -355 -6.29373 0.243
NP_441463.1_6 Forward -357 -343 6.22266 0.279
NP_441962.1_4 Reverse -341 -360 -9.34199 0.215
NP_441962.1_4 Forward -360 -341 -12.7836 0.265
NP_440387.1_1 Reverse -61 -77 -3.97304 0.171
NP_441174.1_2 Forward -358 -344 13.8643 0.185
NP_441174.1_4 Reverse -34 -44 9.7148 0.298
NP_440114.1_10 Forward -162 -148 8.75105 0.195
NP_441237.1_9 Reverse -347 -357 11.0914 0.2
NP_439910.1_2 Reverse -53 -70 -14.0225 0.177
NP_442867.1_8 Forward -84 -65 4.62101 0.278
NP_440457.1_1 Forward -166 -154 7.21714 0.105
NP_442680.1_5 Reverse -257 -276 6.03134 0.213
NP_442439.1_8 Reverse -162 -181 11.8975 0.213
NP_442514.1_5 Reverse -3 -22 -8.85106 0.29
NP_441885.1_5 Forward -70 -60 -1.19994 0.255
NP_442341.1_7 Forward -356 -342 1.57289 0.286
NP_440076.1_5 Reverse -345 -364 12.88 0.252
NP_441397.1_8 Reverse -14 -27 11.9983 0.281
NP_443010.1_10 Reverse -343 -360 10.5015 0.122
NP_440149.1_8 Forward -178 -159 -7.17871 0.275
NP_441105.1_3 Reverse -335 -354 -4.42544 0.2
NP_440678.1_9 Reverse -341 -360 13.1758 0.14
NP_441226.1_7 Reverse -154 -161 8.29857 0.205
NP_441226.1_7 Reverse -69 -76 5.34865 0.289
NP_440416.1_9 Forward -179 -160 -20.5517 0.286
NP_440416.1_9 Reverse -345 -364 -20.8467 0.289
NP_442154.1_1 Reverse -329 -347 -16.0088 0.229
NP_440988.1_10 Forward -351 -337 16.1291 0.112
NP_440988.1_10 Forward -357 -343 8.38408 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTCCAATGATTACCGCTGGACTGTTCAGTACCAACCCCAGGGTGGCAATGCCCGCCGCAAACAAAACCTCAATCCAGTAGCTTATGTCCCTGAGGCTAACGGACTCACATAACTGGGTGTAGATTTGCACCTTATGTTCATCGGTCAAATCTAAATTATTCGTAAAGCCACGGCGTAGACGCAGTAACATCAGCAGGGAAAAACGATGCCCGGAGGACTTGGACTTTGACATAGGGGGGGATGGGATTAATCGTCTCCATTGTGCTTGACCAATACTATACTCTGGGGAGAGTTTGCTGAATTATTGCCATCCACCTTTTCGGGGTTGGGCTATCCCAGGTTATATTGCCTTACATTATCCCCATATCATTCATTATTTCCCATCGAGCGAGTTGTTT

CDS

ATGTTTGGCGTTCTGCTGTTCCTTATTTTCTTCTGTGCCGTCAGTCTAGCCTTTTTTGCCAACCGTAAATGGTGGATTCGTGTTTCCACCCAGTCTCCCCGCTGTACCTATTATTTTGGCCCCTTTACTTCCCAAGAAGAGGCGATCGCCCACCACCAAGGTTATCTCCAGGATTTGGAGATGGAGGGAGCCCAGGGCATTGAATACAAAATAGAACGCTCCTATAAGCCAAGAAAATTAACCATCGAAGACTGA

Protein

MFGVLLFLIFFCAVSLAFFANRKWWIRVSTQSPRCTYYFGPFTSQEEAIAHHQGYLQDLEMEGAQGIEYKIERSYKPRKLTIED