Your browser is old and dusty. Try Google Chrome!

Details for ssr2062

ORF ssr2062
Accession NP_440854.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -126 -107 -24.9766 0.201
NP_441623.1_1 Reverse -110 -128 -1.06249 0.24
NP_441342.1_2 Forward -302 -288 10.6193 0.209
NP_443027.1_4 Forward -396 -386 6.17489 0.289
NP_441812.1_2 Reverse -355 -374 15.7324 0.226
NP_442074.1_3 Reverse -301 -314 16.3416 0.285
NP_442062.1_3 Reverse -17 -36 0.196116 0.239
NP_441082.1_10 Reverse -367 -380 8.47575 0.272
NP_440769.1_8 Reverse -31 -50 13.2741 0.15
NP_440769.1_8 Forward -49 -30 6.78429 0.286
NP_440856.1_7 Forward -126 -107 -5.50708 0.228
NP_441083.1_5 Reverse -118 -128 1.65166 0.2
NP_439957.1_9 Reverse -295 -314 5.1084 0.3
NP_442462.1_2 Forward -164 -145 10.1275 0.172
NP_440851.1_3 Forward -329 -310 2.55606 0.248
NP_440851.1_6 Forward -129 -112 2.49712 0.288
NP_442145.1_4 Forward -260 -241 7.11373 0.216
NP_442145.1_4 Forward -218 -199 3.77151 0.284
NP_440470.1_5 Forward -50 -31 7.97315 0.265
NP_441014.1_10 Forward -251 -232 1.17865 0.231
NP_443018.1_3 Reverse -160 -167 8.39725 0.147
NP_441077.1_6 Forward -59 -43 3.18749 0.271
NP_441950.1_7 Forward -234 -215 -8.85033 0.287
NP_441414.1_9 Forward -380 -361 -10.9153 0.297
NP_440184.1_1 Forward -43 -24 10.9152 0.0985
NP_440184.1_7 Forward -46 -27 14.8467 0.268
NP_441317.1_4 Reverse -92 -106 10.0369 0.29
NP_441958.1_5 Forward -340 -330 -2.28158 0.27
NP_442025.1_5 Forward -255 -236 16.9124 0.158
NP_439905.1_2 Forward -299 -285 7.76774 0.291
NP_442690.1_1 Forward -51 -32 -14.6519 0.273
NP_442690.1_1 Reverse -18 -37 -17.1101 0.297
NP_441129.1_3 Forward -172 -153 -9.83364 0.228
NP_442002.1_9 Reverse -116 -123 11.1505 0.185
NP_442032.1_5 Forward -299 -289 16.2041 0.279
NP_441550.1_8 Forward -341 -331 6.56775 0.201
NP_442996.1_1 Forward -199 -180 5.49036 0.246
NP_439966.1_9 Reverse -369 -378 6.5879 0.253
NP_440202.1_8 Forward -176 -157 10.6817 0.292
NP_441076.1_1 Forward -395 -376 11.5502 0.209
NP_441514.1_2 Reverse -298 -317 13.4708 0.281
NP_442281.1_1 Reverse -154 -168 2.16228 0.276
NP_441079.1_7 Forward -49 -30 -0.29631 0.199
NP_442500.1_8 Reverse -301 -315 17.3124 0.137
NP_442247.1_7 Reverse -258 -277 9.53756 0.21
NP_440780.1_1 Forward -60 -41 9.31004 0.274
NP_440430.1_5 Reverse -83 -102 12.6841 0.23
NP_440919.1_1 Reverse -8 -27 -5.31042 0.258
NP_441024.1_6 Forward -373 -354 7.30471 0.292
NP_440357.1_3 Forward -128 -109 2.55606 0.255
NP_441876.1_9 Forward -121 -111 10.501 0.292
NP_441764.1_1 Reverse -27 -46 9.0459 0.241
NP_442719.1_2 Forward -29 -11 -11.3879 0.291
NP_442808.1_1 Forward -12 -2 4.20782 0.203
NP_440038.1_4 Reverse -218 -237 1.47442 0.275
NP_440601.1_10 Forward -360 -341 12.9791 0.29
NP_441458.1_8 Forward -51 -32 1.81158 0.295
NP_441819.1_5 Reverse -29 -48 16.4719 0.178
NP_441819.1_5 Forward -370 -351 13.3207 0.218
NP_440276.1_2 Reverse -278 -297 9.90745 0.288
NP_442494.1_6 Reverse -100 -119 9.24257 0.294
NP_442347.1_2 Reverse -386 -395 14.0611 0.056
NP_442347.1_2 Forward -297 -288 6.8829 0.145
NP_440932.1_5 Reverse -148 -167 6.29264 0.172
NP_441728.2_4 Reverse -33 -52 14.1801 0.23
NP_442998.1_5 Reverse -115 -125 17.4829 0.149
NP_440709.1_1 Reverse -197 -216 4.32522 0.205
NP_441395.1_7 Forward -386 -367 16.2232 0.281
NP_440997.1_6 Reverse -109 -128 9.14423 0.266
NP_442866.1_1 Reverse -366 -385 -8.752 0.282
NP_442327.1_3 Forward -269 -250 12.4613 0.182
NP_440168.1_8 Reverse -207 -226 3.24438 0.244
NP_441248.1_6 Forward -73 -59 20.1574 0.285
NP_441248.1_6 Forward -53 -39 20.1574 0.285
NP_440211.1_4 Reverse -10 -20 14.6313 0.286
NP_440586.1_8 Reverse -160 -167 7.21693 0.27
NP_441595.1_2 Forward -376 -363 9.99293 0.277
NP_441167.1_9 Reverse -174 -193 9.24257 0.151
NP_442384.1_10 Reverse -330 -343 9.2624 0.0557
NP_441877.1_9 Reverse -26 -43 4.56207 0.284
NP_441877.1_9 Reverse -25 -42 3.0871 0.285
NP_442262.1_10 Reverse -160 -167 10.7572 0.124
NP_442262.1_10 Reverse -372 -379 7.6106 0.274
NP_442917.1_1 Reverse -250 -269 8.75009 0.245
NP_441335.1_8 Reverse -10 -29 7.27595 0.281
NP_442129.1_9 Reverse -334 -353 16.2725 0.235
NP_440600.1_1 Forward -43 -24 12.8432 0.29
NP_442277.1_7 Forward -204 -188 -1.04361 0.264
NP_442277.1_7 Reverse -299 -315 -1.71205 0.284
NP_442966.1_8 Forward -70 -52 15.0638 0.274
NP_441443.1_1 Reverse -3 -22 -2.65548 0.271
NP_441086.1_3 Reverse -20 -39 13.9214 0.114
NP_441086.1_3 Reverse -19 -38 4.9832 0.29
NP_442366.1_3 Forward -169 -151 1.88744 0.139
NP_442939.1_5 Forward -263 -249 17.0972 0.269
NP_441982.1_6 Forward -363 -354 13.3448 0.274
NP_441046.1_2 Forward -161 -142 0.196116 0.271
NP_442689.1_8 Forward -367 -350 -3.69774 0.251
NP_442689.1_8 Reverse -22 -39 -3.79607 0.252
NP_442689.1_8 Forward -48 -31 -8.61428 0.294
NP_441124.1_5 Reverse -27 -37 14.6315 0.215
NP_441124.1_5 Forward -43 -33 12.8172 0.215
NP_441124.1_5 Reverse -244 -254 10.5254 0.286
NP_440431.1_4 Reverse -300 -319 -6.15965 0.25
NP_440431.1_4 Reverse -297 -316 -6.8281 0.262
NP_440431.1_4 Forward -105 -86 -10.0748 0.295
NP_441031.1_1 Forward -48 -29 8.65445 0.233
NP_442237.1_3 Reverse -32 -46 16.5317 0.289
NP_442749.1_5 Reverse -13 -30 8.60932 0.231
NP_441022.1_1 Forward -40 -31 15.9587 0.163
NP_441968.1_1 Reverse -295 -303 15.162 0.257
NP_440352.1_5 Forward -112 -93 14.7971 0.139
NP_440352.1_5 Forward -190 -171 11.7797 0.254
NP_440545.1_3 Reverse -215 -232 3.57876 0.0817
NP_441126.1_6 Reverse -24 -38 14.8001 0.264
NP_443040.1_1 Forward -360 -346 10.0873 0.291
NP_441329.1_1 Reverse -25 -44 17.2359 0.106
NP_441329.1_1 Forward -262 -243 3.96249 0.3
NP_441329.1_3 Forward -65 -55 15.8708 0.231
NP_441329.1_3 Forward -45 -35 15.8708 0.231
NP_441329.1_3 Reverse -55 -65 13.075 0.266
NP_441329.1_3 Reverse -35 -45 13.075 0.266
NP_441329.1_6 Reverse -298 -317 -3.1994 0.298
NP_442943.1_1 Reverse -32 -47 5.40251 0.211
NP_442028.1_1 Reverse -344 -357 7.51014 0.292
NP_440884.1_7 Forward -337 -323 20.6491 0.233
NP_440227.1_2 Forward -198 -182 7.04003 0.295
NP_440542.1_8 Reverse -358 -371 18.8005 0.215
NP_442627.1_4 Forward -73 -55 17.095 0.216
NP_442627.1_4 Forward -53 -35 17.095 0.216
NP_442627.1_4 Reverse -47 -65 16.1401 0.262
NP_442105.1_9 Reverse -108 -122 15.2254 0.285
NP_441698.1_2 Forward -45 -26 18.0882 0.137
NP_440863.1_2 Forward -364 -348 21.8745 0.0749
NP_441541.1_1 Forward -373 -355 -0.570966 0.237
NP_441541.1_1 Reverse -26 -44 -2.19433 0.254
NP_440354.1_7 Forward -174 -156 7.78729 0.26
NP_441848.1_4 Reverse -32 -48 9.93796 0.267
NP_441811.1_8 Reverse -379 -393 12.3893 0.209
NP_440825.1_6 Reverse -11 -30 12.3892 0.252
NP_442837.1_3 Reverse -386 -393 6.52896 0.2
NP_442837.1_3 Forward -297 -290 6.52896 0.2
NP_440351.1_9 Forward -358 -340 9.26226 0.222
NP_442532.1_1 Forward -358 -344 9.62772 0.273
NP_442532.1_2 Forward -92 -73 0.0473228 0.295
NP_442541.1_3 Forward -188 -169 3.83436 0.29
NP_440854.1_1 Forward -198 -179 25.4482 0.0118
NP_440854.1_3 Forward -298 -279 24.778 0.00725
NP_440854.1_5 Forward -359 -345 14.2399 0.295
NP_440854.1_6 Forward -47 -28 19.5277 0.0885
NP_440854.1_7 Forward -313 -299 22.1643 0.0129
NP_441697.1_5 Forward -58 -39 -3.10391 0.217
NP_441697.1_5 Reverse -22 -41 -4.91826 0.224
NP_441697.1_5 Reverse -31 -50 -10.3613 0.278
NP_440816.1_2 Forward -104 -85 8.85527 0.238
NP_441028.1_6 Reverse -95 -105 7.15773 0.23
NP_441028.1_6 Forward -173 -163 5.09279 0.267
NP_441527.1_4 Forward -153 -134 -11.9847 0.285
NP_441527.1_4 Reverse -297 -316 -12.8441 0.294
NP_442673.1_6 Forward -60 -41 14.0846 0.241
NP_441106.1_3 Reverse -24 -43 12.2908 0.217
NP_441463.1_2 Forward -319 -301 2.29285 0.24
NP_441962.1_4 Forward -227 -208 -9.93197 0.222
NP_440935.1_6 Forward -311 -294 6.25912 0.276
NP_442698.1_10 Reverse -289 -308 4.42435 0.279
NP_442930.1_1 Forward -38 -28 10.206 0.278
NP_442582.1_3 Forward -187 -173 12.5211 0.286
NP_442582.1_6 Forward -197 -178 22.1868 0.019
NP_441173.1_9 Reverse -356 -364 12.9004 0.206
NP_441173.1_9 Reverse -200 -208 11.8187 0.222
NP_441173.1_9 Reverse -105 -113 11.7204 0.226
NP_440191.1_6 Forward -43 -29 14.2399 0.294
NP_440727.1_8 Forward -57 -43 19.0145 0.18
NP_441207.1_7 Forward -40 -26 16.4195 0.179
NP_442371.1_1 Forward -183 -173 11.6809 0.288
NP_442418.1_4 Reverse -20 -38 10.8881 0.259
NP_442116.1_6 Forward -49 -32 9.79232 0.227
NP_442116.1_6 Reverse -32 -49 8.8374 0.238
NP_442116.1_6 Forward -48 -31 7.596 0.254
NP_442116.1_6 Reverse -31 -48 6.35461 0.28
NP_442116.1_6 Reverse -33 -50 5.87715 0.289
NP_440988.1_5 Forward -25 -6 15.3949 0.202
NP_440988.1_5 Forward -383 -364 13.3483 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAGCCTGGGATCAAGACAGCTCAATCTCAGCAAGTTTGGTTAAAAAAAGATTATTAGTTGGGCGTTCAGTTATTTGAGCCACTATTTTAATCTTGTTTTTTCTTGATCCCTGACCTTTTTTGTTCCATACCATACCATTATCTAAAGATTTTGTTACCTGTTAAGGTCGGGTGCTGTGTCAAACGTATCGATTTGTAAAACGAATATTAAGACAACCTGAAGAGAATTTCCTTCCATCGGGGAGGTAAAGGCAGACAGAGTAACTGTTTAATGCGGATTTGCCCCCTTGGTTGAATAGGGCAAAATATAAACATCTAGAAAGTTCGAGCTGATATTTTTCAAAAAGAGCTGATATTTTTCAAAAATTTTAACAACTGCCTAATTTCCCCACGCACCCCC

CDS

ATGAAAACCGCTAACTTTATCACCTCATCTTGTCGTTATTGCCGCTACTACCAGGCTGAAGGTAGGCGAGGCGGCACTTGCAGTCAACTCAATGTGCCAGTACAGGGACAGTGGAAGGCCTGTGCCCTAGCGGCAAAACCCTTTGCCGGTCCCTGGGAGAACCTCGAAGATGTGGTGTATTTAGAACATGCCTATGCTTTGACCAGTAAGGATGCTCTAGTGGAACAATCGGCAGAAACGATCGCCACCGCAGCCGAAGCGGCCTAG

Protein

MKTANFITSSCRYCRYYQAEGRRGGTCSQLNVPVQGQWKACALAAKPFAGPWENLEDVVYLEHAYALTSKDALVEQSAETIATAAEAA