Your browser is old and dusty. Try Google Chrome!

Details for ssr2060

ORF ssr2060
Accession NP_440851.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -397 -383 16.2242 0.104
NP_441061.1_2 Reverse -323 -337 4.52282 0.147
NP_441061.1_2 Reverse -197 -211 2.16287 0.178
NP_441061.1_2 Reverse -185 -199 -0.590395 0.234
NP_441061.1_2 Reverse -191 -205 -1.47537 0.262
NP_440557.1_1 Reverse -323 -342 -0.295539 0.269
NP_440557.1_3 Forward -40 -21 7.47261 0.183
NP_440795.1_7 Forward -330 -323 14.6904 0.0123
NP_440795.1_7 Reverse -323 -330 14.6904 0.0123
NP_441418.1_6 Forward -191 -172 -22.5183 0.179
NP_441418.1_6 Reverse -322 -341 -29.0082 0.215
NP_442291.1_5 Reverse -48 -64 8.31834 0.0558
NP_442291.1_5 Forward -59 -43 -0.531451 0.185
NP_442291.1_7 Reverse -175 -189 11.3077 0.217
NP_441453.1_4 Reverse -322 -330 16.539 0.00633
NP_441453.1_4 Forward -331 -323 16.539 0.00633
NP_441453.1_4 Reverse -49 -57 7.19758 0.0757
NP_441453.1_4 Forward -58 -50 6.80426 0.121
NP_441453.1_7 Forward -14 -7 12.9205 0.23
NP_441960.1_2 Forward -196 -177 16.1257 0.287
NP_442151.1_6 Reverse -322 -336 18.4858 0.0071
NP_442151.1_6 Forward -205 -191 9.63603 0.142
NP_442151.1_6 Reverse -196 -210 6.88276 0.217
NP_442151.1_6 Forward -331 -317 6.6861 0.224
NP_441818.1_1 Reverse -323 -334 18.8393 0.00301
NP_441818.1_1 Reverse -50 -61 15.0044 0.0389
NP_441818.1_1 Forward -330 -319 13.8245 0.0623
NP_441818.1_1 Reverse -66 -77 10.9729 0.21
NP_441818.1_9 Forward -205 -186 0.294447 0.191
NP_440226.1_1 Forward -58 -39 15.7324 0.0231
NP_440226.1_1 Forward -331 -312 11.3075 0.0547
NP_440226.1_1 Reverse -322 -341 1.86774 0.286
NP_440931.1_5 Forward -108 -89 12.3892 0.255
NP_442173.1_1 Forward -330 -322 15.4574 0.00633
NP_442173.1_1 Reverse -323 -331 15.4574 0.00633
NP_442173.1_1 Forward -132 -124 7.8859 0.134
NP_442173.1_1 Forward -57 -49 7.68924 0.142
NP_442173.1_1 Reverse -50 -58 5.72262 0.203
NP_442752.1_4 Forward -331 -324 13.8055 0.0199
NP_442752.1_4 Reverse -322 -329 13.8055 0.0199
NP_442752.1_4 Forward -58 -51 13.8055 0.0199
NP_442752.1_4 Forward -205 -198 10.5605 0.1
NP_443027.1_4 Forward -333 -323 14.0414 0.0452
NP_443027.1_4 Forward -60 -50 10.2065 0.138
NP_443027.1_4 Forward -265 -255 6.37155 0.283
NP_442975.1_10 Forward -335 -321 4.91554 0.234
NP_440784.1_7 Forward -330 -323 15.9687 0.0123
NP_440784.1_7 Reverse -323 -330 15.9687 0.0123
NP_440784.1_7 Reverse -197 -204 8.59391 0.129
NP_440784.1_7 Reverse -66 -73 6.43063 0.218
NP_440784.1_7 Forward -57 -50 6.23397 0.241
NP_440784.1_7 Reverse -50 -57 6.13563 0.241
NP_442909.1_7 Reverse -323 -337 6.29216 0.252
NP_440061.1_9 Forward -333 -319 18.9768 0.00701
NP_440061.1_9 Reverse -177 -191 8.25877 0.177
NP_441054.1_2 Forward -199 -180 10.7175 0.284
NP_441054.1_4 Reverse -312 -330 17.8171 0.0254
NP_442062.1_8 Forward -331 -321 17.6796 0.00193
NP_442062.1_8 Reverse -322 -332 17.3846 0.00193
NP_442062.1_8 Forward -58 -48 14.6313 0.012
NP_442062.1_8 Reverse -49 -59 5.09324 0.184
NP_442062.1_8 Forward -182 -172 4.10993 0.232
NP_440304.1_4 Forward -333 -323 10.8948 0.051
NP_440304.1_4 Reverse -320 -330 9.91146 0.051
NP_440304.1_4 Reverse -24 -34 2.7333 0.299
NP_442242.1_4 Forward -330 -323 14.3954 0.0124
NP_442242.1_4 Reverse -323 -330 14.3954 0.0124
NP_442242.1_4 Reverse -50 -57 10.8555 0.127
NP_440044.1_8 Reverse -50 -69 10.2259 0.0596
NP_440132.1_1 Forward -207 -189 8.57394 0.269
NP_442110.1_7 Reverse -322 -336 10.1277 0.0684
NP_441082.1_10 Reverse -338 -351 11.4257 0.236
NP_441082.1_10 Forward -49 -36 10.4424 0.236
NP_441925.1_4 Reverse -175 -194 -6.68779 0.185
NP_441925.1_4 Reverse -180 -199 -8.06442 0.203
NP_440273.1_3 Forward -199 -180 6.4893 0.232
NP_440856.1_7 Forward -217 -198 -1.47551 0.182
NP_440856.1_7 Forward -206 -187 -8.55534 0.274
NP_441083.1_5 Reverse -322 -332 20.3345 0.00053
NP_441083.1_5 Forward -331 -321 19.3512 0.000718
NP_441083.1_5 Reverse -182 -192 1.84832 0.198
NP_441083.1_5 Reverse -49 -59 1.74999 0.198
NP_441083.1_5 Forward -58 -48 0.963343 0.218
NP_441738.1_2 Forward -329 -322 15.28 0.0102
NP_441738.1_2 Reverse -324 -331 15.28 0.0102
NP_441738.1_2 Reverse -51 -58 15.28 0.0102
NP_441558.1_5 Forward -333 -314 14.6508 0.0482
NP_441558.1_5 Reverse -320 -339 12.4875 0.0677
NP_440209.1_1 Reverse -322 -330 18.1123 0.00295
NP_440209.1_1 Forward -331 -323 18.1123 0.00295
NP_440209.1_1 Forward -58 -50 8.57422 0.0425
NP_440209.1_1 Reverse -49 -57 5.32929 0.139
NP_442889.1_8 Reverse -319 -333 18.7801 0.0097
NP_442889.1_8 Forward -61 -47 9.14375 0.103
NP_440447.1_5 Reverse -4 -14 14.4347 0.277
NP_440447.1_6 Reverse -314 -332 8.08229 0.14
NP_441713.1_1 Reverse -316 -335 -11.5053 0.228
NP_441713.1_5 Forward -212 -193 7.37428 0.262
NP_440178.1_7 Reverse -321 -340 5.211 0.0199
NP_442570.1_3 Forward -207 -188 -0.197208 0.208
NP_442570.1_3 Forward -247 -228 -4.22878 0.228
NP_441716.1_1 Reverse -322 -336 15.3392 0.0498
NP_441716.1_1 Reverse -163 -177 3.34284 0.268
NP_442111.1_4 Forward -332 -318 12.1926 0.0451
NP_442111.1_4 Reverse -195 -209 3.8345 0.229
NP_440906.1_5 Forward -330 -323 15.8704 0.0124
NP_440906.1_5 Reverse -323 -330 15.8704 0.0124
NP_440906.1_5 Forward -57 -50 6.23397 0.234
NP_440906.1_5 Reverse -50 -57 6.13563 0.241
NP_440747.1_10 Forward -334 -322 7.51213 0.00286
NP_440747.1_10 Reverse -319 -331 7.31547 0.00577
NP_440747.1_10 Reverse -46 -58 -4.58258 0.109
NP_440747.1_10 Forward -61 -49 -12.0557 0.199
NP_440747.1_10 Forward -236 -224 -12.3507 0.27
NP_441130.1_10 Forward -333 -319 9.34103 0.126
NP_441130.1_10 Reverse -320 -334 5.99778 0.207
NP_441486.1_1 Forward -61 -47 14.7492 0.00628
NP_441486.1_1 Forward -334 -320 14.5526 0.00628
NP_441486.1_1 Reverse -46 -60 10.226 0.0218
NP_441486.1_1 Forward -77 -63 -4.62196 0.204
NP_441486.1_1 Reverse -319 -333 -5.11362 0.222
NP_442634.1_4 Reverse -320 -334 5.80112 0.051
NP_442634.1_4 Forward -207 -193 -5.40861 0.253
NP_441265.1_3 Reverse -190 -204 1.96621 0.2
NP_441014.1_8 Reverse -42 -61 -4.13045 0.247
NP_441014.1_8 Reverse -183 -202 -8.45701 0.283
NP_441014.1_10 Reverse -321 -340 8.65176 0.131
NP_441014.1_10 Reverse -48 -67 4.52188 0.196
NP_442848.1_1 Forward -337 -323 16.5192 0.0143
NP_442848.1_1 Forward -64 -50 6.3911 0.0791
NP_442848.1_5 Reverse -178 -196 8.37728 0.232
NP_442848.1_9 Reverse -174 -193 0.884433 0.265
NP_443018.1_3 Forward -330 -323 14.8871 0.0123
NP_443018.1_3 Reverse -323 -330 14.8871 0.0123
NP_443018.1_3 Forward -57 -50 12.6255 0.0471
NP_443018.1_3 Forward -181 -174 10.2655 0.107
NP_443018.1_3 Reverse -329 -336 8.49558 0.141
NP_443018.1_3 Reverse -50 -57 5.25066 0.214
NP_441634.1_8 Reverse -320 -334 -4.4253 0.295
NP_440376.1_1 Forward -331 -322 19.4693 0.000692
NP_440376.1_1 Reverse -322 -331 19.4693 0.000692
NP_440376.1_1 Forward -58 -49 -0.000272808 0.285
NP_440376.1_1 Reverse -49 -58 -0.0986038 0.285
NP_440376.1_1 Forward -44 -35 -0.295266 0.286
NP_441588.1_4 Forward -56 -46 9.12481 0.14
NP_441588.1_4 Reverse -324 -334 8.63316 0.14
NP_441588.1_4 Reverse -51 -61 8.63316 0.14
NP_442730.1_1 Reverse -1 -20 17.109 0.103
NP_443065.1_6 Reverse -180 -199 6.58763 0.208
NP_442687.1_7 Reverse -321 -331 18.5646 0.0028
NP_442687.1_7 Forward -332 -322 8.92815 0.0994
NP_442687.1_7 Forward -301 -291 3.91327 0.278
NP_442485.1_3 Forward -216 -197 0.196116 0.247
NP_442485.1_3 Forward -193 -174 -1.47551 0.259
NP_441846.1_10 Forward -199 -180 -22.8133 0.266
NP_440642.1_8 Forward -329 -310 14.0957 0.221
NP_440642.1_10 Reverse -283 -297 2.8506 0.277
NP_441013.1_2 Forward -210 -192 -1.55415 0.282
NP_441763.1_5 Reverse -198 -217 7.17762 0.077
NP_440360.1_10 Reverse -175 -189 5.50613 0.227
NP_442658.1_1 Reverse -320 -330 16.0075 0.00966
NP_442658.1_1 Forward -333 -323 6.76441 0.214
NP_442658.1_1 Forward -207 -197 5.19112 0.28
NP_441855.2_4 Reverse -18 -37 12.4153 0.196
NP_442782.1_7 Forward -66 -47 0.687771 0.21
NP_442496.1_5 Reverse -222 -240 5.82068 0.285
NP_441414.1_9 Reverse -322 -341 5.60432 0.0461
NP_441414.1_9 Forward -331 -312 2.26107 0.0685
NP_441256.1_1 Reverse -325 -344 -7.27704 0.239
NP_441958.1_5 Reverse -321 -331 20.5312 0.000966
NP_441958.1_5 Forward -332 -322 12.2714 0.00183
NP_441958.1_5 Forward -59 -49 1.55333 0.095
NP_440203.1_7 Forward -216 -197 12.3892 0.3
NP_439905.1_1 Forward -330 -317 16.2439 0.0664
NP_440995.1_8 Reverse -39 -58 13.5691 0.117
NP_440984.1_7 Reverse -317 -331 10.9143 0.122
NP_439990.1_5 Forward -336 -323 19.4888 0.00712
NP_439990.1_5 Reverse -317 -330 10.344 0.128
NP_439990.1_5 Forward -138 -125 7.09911 0.212
NP_442911.1_2 Forward -341 -322 15.4374 0.0106
NP_442911.1_2 Reverse -312 -331 10.6192 0.0145
NP_442911.1_2 Reverse -186 -205 -4.81876 0.142
NP_442064.1_1 Reverse -60 -79 -13.1769 0.285
NP_443055.1_6 Reverse -26 -44 -0.0799167 0.252
NP_440602.1_8 Reverse -49 -63 16.8142 0.11
NP_441099.1_5 Reverse -312 -331 -0.787193 0.0989
NP_441099.1_5 Forward -341 -322 -0.885524 0.1
NP_442002.1_9 Reverse -321 -328 14.1004 0.074
NP_442032.1_2 Forward -139 -120 12.6841 0.0952
NP_441654.1_7 Reverse -199 -218 12.3396 0.27
NP_441294.1_7 Forward -335 -321 10.4025 0.191
NP_442438.1_10 Forward -199 -185 8.75105 0.0731
NP_442438.1_10 Forward -336 -322 6.19444 0.119
NP_441000.1_6 Reverse -321 -335 -3.93365 0.225
NP_441000.1_6 Forward -183 -169 -5.50694 0.279
NP_440484.1_1 Forward -22 -3 11.995 0.194
NP_440147.1_4 Reverse -320 -333 10.5407 0.0355
NP_440147.1_4 Forward -333 -320 10.049 0.0355
NP_440147.1_4 Reverse -47 -60 -0.570702 0.291
NP_441550.1_8 Reverse -320 -330 18.1707 0.00754
NP_441550.1_8 Forward -333 -323 12.3692 0.0336
NP_441916.1_7 Forward -331 -321 16.893 0.00407
NP_441916.1_7 Reverse -322 -332 10.3048 0.0261
NP_441916.1_7 Reverse -49 -59 7.74818 0.0608
NP_441916.1_7 Reverse -173 -183 1.74999 0.275
NP_440206.1_4 Reverse -186 -205 4.62021 0.257
NP_441041.1_4 Reverse -322 -341 12.7825 0.0234
NP_441041.1_4 Forward -205 -186 -8.16202 0.197
NP_441041.1_7 Reverse -319 -331 10.8188 0.0864
NP_441041.1_7 Forward -38 -26 8.87526 0.128
NP_442004.1_6 Forward -245 -231 3.04785 0.251
NP_442004.1_6 Reverse -322 -336 1.86788 0.276
NP_440703.1_9 Forward -352 -339 7.78685 0.254
NP_441725.1_5 Forward -330 -320 11.7798 0.0247
NP_441725.1_5 Reverse -323 -333 11.2881 0.0247
NP_441725.1_5 Reverse -50 -60 1.455 0.135
NP_441725.1_5 Forward -204 -194 0.668351 0.156
NP_441725.1_5 Reverse -197 -207 -1.00328 0.279
NP_439966.1_7 Forward -333 -323 15.8108 0.0124
NP_439966.1_7 Reverse -320 -330 8.63269 0.132
NP_439966.1_7 Forward -60 -50 6.0761 0.195
NP_439966.1_9 Reverse -340 -349 3.7363 0.253
NP_440202.1_8 Reverse -165 -184 12.0434 0.272
NP_442941.1_3 Reverse -323 -333 19.9412 0.00262
NP_442941.1_3 Forward -330 -320 10.6981 0.0116
NP_442941.1_3 Reverse -50 -60 10.1081 0.024
NP_442941.1_3 Reverse -197 -207 -0.904945 0.274
NP_442941.1_3 Forward -57 -47 -1.19994 0.288
NP_440289.1_2 Forward -334 -321 16.1456 0.00946
NP_440289.1_2 Reverse -319 -332 12.409 0.015
NP_442281.1_1 Forward -63 -49 9.83206 0.0661
NP_442281.1_1 Reverse -44 -58 9.04542 0.0747
NP_442281.1_1 Forward -336 -322 8.75042 0.0764
NP_442281.1_1 Forward -187 -173 5.60385 0.152
NP_442281.1_1 Reverse -317 -331 2.5556 0.263
NP_440177.1_1 Reverse -192 -210 7.00065 0.272
NP_442256.1_2 Reverse -320 -338 -7.25734 0.214
NP_440437.1_1 Forward -337 -318 -2.95047 0.23
NP_440437.1_1 Reverse -43 -62 -3.14714 0.232
NP_442049.1_4 Reverse -197 -216 -2.26216 0.256
NP_442068.1_4 Forward -238 -219 5.2102 0.27
NP_441644.1_6 Reverse -322 -332 17.3841 0.00127
NP_441644.1_6 Forward -331 -321 15.7125 0.0048
NP_441644.1_6 Reverse -49 -59 6.0761 0.167
NP_441644.1_6 Forward -239 -229 3.32285 0.288
NP_443049.1_6 Forward -59 -49 12.3241 0.24
NP_442215.1_2 Reverse -320 -336 -3.08806 0.209
NP_442215.1_2 Forward -207 -191 -3.28472 0.213
NP_442215.1_2 Reverse -63 -79 -6.82463 0.28
NP_440253.1_2 Reverse -322 -340 7.78729 0.0662
NP_440253.1_2 Forward -331 -313 -1.45582 0.242
NP_440929.1_8 Forward -331 -322 19.2726 0.000701
NP_440929.1_8 Reverse -322 -331 19.2726 0.000701
NP_442933.1_10 Forward -331 -322 17.601 0.00325
NP_442933.1_10 Reverse -322 -331 17.601 0.00325
NP_442933.1_10 Reverse -49 -58 15.1427 0.00958
NP_442933.1_10 Forward -74 -65 8.75118 0.0688
NP_442933.1_10 Forward -58 -49 7.96454 0.0937
NP_441751.2_8 Reverse -323 -337 4.03116 0.0563
NP_441751.2_8 Reverse -50 -64 3.24451 0.0692
NP_441751.2_8 Forward -330 -316 1.96621 0.0912
NP_442554.1_8 Reverse -323 -333 15.9097 0.00747
NP_442554.1_8 Forward -330 -320 15.123 0.00944
NP_442554.1_8 Reverse -50 -60 6.07655 0.126
NP_442554.1_8 Reverse -197 -207 3.02829 0.245
NP_442554.1_8 Reverse -174 -184 2.24165 0.276
NP_441762.1_7 Reverse -321 -333 1.7106 0.0735
NP_441762.1_7 Forward -332 -320 -6.84419 0.284
NP_442142.1_4 Forward -61 -48 8.57349 0.112
NP_442142.1_4 Forward -334 -321 7.49186 0.137
NP_442142.1_4 Forward -185 -172 7.39353 0.141
NP_442142.1_4 Reverse -193 -206 6.50855 0.163
NP_442142.1_4 Reverse -319 -332 3.95196 0.239
NP_442142.1_4 Reverse -199 -212 3.46031 0.255
NP_442292.1_1 Reverse -323 -332 18.486 0.00229
NP_442292.1_1 Forward -330 -321 9.53783 0.0183
NP_442292.1_1 Reverse -50 -59 8.65285 0.0335
NP_442292.1_1 Forward -57 -48 -0.196935 0.239
NP_441525.1_1 Forward -68 -55 11.1307 0.296
NP_442476.1_6 Forward -330 -316 11.5043 0.056
NP_442016.1_10 Forward -81 -62 6.88262 0.259
NP_443009.1_5 Forward -332 -321 15.7911 0.0107
NP_443009.1_5 Reverse -321 -332 11.1696 0.066
NP_442301.1_2 Reverse -175 -194 3.44025 0.294
NP_441715.1_4 Reverse -323 -333 14.828 0.0268
NP_441715.1_4 Forward -330 -320 9.81313 0.097
NP_441715.1_4 Reverse -197 -207 6.46988 0.143
NP_441715.1_4 Reverse -50 -60 4.99491 0.24
NP_440015.1_9 Reverse -322 -340 0.510803 0.252
NP_441448.1_1 Reverse -127 -146 3.44104 0.297
NP_441448.1_6 Reverse -53 -72 20.5498 0.0407
NP_440464.1_10 Forward -87 -77 13.1036 0.169
NP_441468.1_1 Forward -330 -323 15.8704 0.0124
NP_441468.1_1 Reverse -323 -330 15.8704 0.0124
NP_441468.1_1 Forward -57 -50 6.13563 0.209
NP_441468.1_1 Reverse -50 -57 6.0373 0.223
NP_441468.1_1 Forward -204 -197 4.26735 0.246
NP_441015.1_10 Forward -193 -174 -1.86883 0.176
NP_441015.1_10 Reverse -225 -244 -6.39206 0.248
NP_441673.1_1 Forward -331 -322 20.8459 0.000698
NP_441673.1_1 Reverse -322 -331 20.8459 0.000698
NP_441673.1_1 Forward -58 -49 1.27803 0.155
NP_441673.1_1 Reverse -49 -58 1.27803 0.155
NP_441826.1_2 Forward -337 -323 13.5693 0.0214
NP_441826.1_2 Forward -211 -197 1.96621 0.137
NP_441826.1_2 Forward -64 -50 1.08123 0.164
NP_441826.1_2 Reverse -322 -336 -0.492064 0.213
NP_441826.1_2 Reverse -190 -204 -4.62196 0.298
NP_442490.1_4 Forward -148 -129 16.1903 0.287
NP_442868.1_6 Reverse -320 -330 18.5646 0.0104
NP_442868.1_6 Forward -333 -323 9.91146 0.038
NP_442868.1_6 Forward -60 -50 0.176696 0.247
NP_442719.1_2 Forward -153 -135 -9.22465 0.261
NP_442719.1_2 Reverse -19 -37 -10.6013 0.278
NP_441056.1_1 Reverse -322 -341 -7.27704 0.272
NP_441056.1_1 Forward -245 -226 -8.16202 0.282
NP_442677.1_7 Reverse -104 -114 17.2863 0.27
NP_441612.1_2 Reverse -322 -332 8.54929 0.21
NP_441612.1_2 Forward -58 -48 6.70984 0.277
NP_442227.1_2 Forward -148 -129 -3.73712 0.295
NP_442361.1_8 Reverse -60 -78 12.4089 0.282
NP_442427.1_5 Forward -240 -221 3.6377 0.284
NP_442427.1_5 Reverse -291 -310 2.75272 0.286
NP_442427.1_8 Reverse -313 -332 21.4356 0.018
NP_442808.1_1 Reverse -321 -331 8.73102 0.0481
NP_442808.1_1 Forward -332 -322 8.63269 0.0481
NP_442808.1_1 Forward -291 -281 1.94622 0.281
NP_441101.1_10 Reverse -192 -211 -5.11376 0.281
NP_442820.1_3 Reverse -58 -68 13.3526 0.277
NP_442542.1_2 Reverse -320 -333 19.1938 0.0177
NP_442050.1_5 Forward -333 -323 16.4991 0.00812
NP_442050.1_5 Reverse -320 -330 13.6475 0.0295
NP_442050.1_5 Forward -353 -343 6.96107 0.27
NP_442050.1_5 Forward -60 -50 6.76441 0.282
NP_442342.1_9 Reverse -320 -336 13.4315 0.0991
NP_441114.1_3 Reverse -175 -184 7.66954 0.231
NP_440558.1_2 Reverse -176 -195 -3.04881 0.232
NP_440558.1_2 Reverse -187 -206 -6.98204 0.284
NP_442789.1_4 Forward -216 -197 -4.32711 0.259
NP_441518.1_3 Reverse -39 -58 -13.4719 0.264
NP_441878.1_6 Reverse -321 -331 20.2362 0.0046
NP_441878.1_6 Forward -332 -322 10.4031 0.0176
NP_441878.1_6 Forward -183 -173 0.668351 0.139
NP_441878.1_6 Reverse -195 -205 -0.314959 0.174
NP_441878.1_6 Reverse -223 -233 -7.78811 0.266
NP_441036.1_8 Reverse -321 -331 8.4365 0.174
NP_441036.1_8 Forward -332 -322 8.33817 0.174
NP_441557.1_5 Forward -331 -322 19.9609 0.000699
NP_441557.1_5 Reverse -322 -331 19.9609 0.000699
NP_441557.1_5 Forward -58 -49 8.94785 0.0289
NP_441557.1_5 Reverse -49 -58 0.688044 0.128
NP_441557.1_8 Reverse -379 -389 11.4843 0.246
NP_441445.1_1 Forward -67 -48 6.29264 0.152
NP_441445.1_1 Forward -340 -321 2.3594 0.235
NP_441445.1_1 Forward -214 -195 0.196116 0.281
NP_441590.1_4 Reverse -165 -184 5.40686 0.279
NP_442066.2_4 Forward -81 -62 -8.06369 0.293
NP_442066.2_9 Reverse -318 -331 13.0973 0.154
NP_441308.1_8 Forward -207 -197 8.53483 0.254
NP_440101.1_10 Reverse -322 -341 4.52268 0.208
NP_441564.1_2 Forward -183 -164 -0.197208 0.216
NP_442183.1_1 Reverse -322 -336 9.14437 0.101
NP_442183.1_1 Reverse -49 -63 5.21113 0.226
NP_442183.1_1 Forward -331 -317 4.03116 0.282
NP_441574.1_1 Forward -133 -114 -0.4922 0.206
NP_441574.1_1 Forward -217 -198 -6.29373 0.276
NP_441574.1_1 Forward -194 -175 -6.39206 0.277
NP_442347.1_2 Reverse -323 -332 12.4878 0.056
NP_442347.1_2 Reverse -50 -59 12.2911 0.056
NP_442347.1_2 Forward -330 -321 3.34298 0.284
NP_442645.1_2 Forward -339 -320 -14.5535 0.175
NP_441037.1_4 Reverse -320 -330 9.55921 0.21
NP_440151.1_2 Reverse -259 -277 13.588 0.277
NP_441633.1_3 Forward -333 -320 3.46087 0.0699
NP_441633.1_3 Reverse -320 -333 -3.81562 0.177
NP_440136.1_2 Forward -330 -323 15.9687 0.0123
NP_440136.1_2 Reverse -323 -330 15.9687 0.0123
NP_440136.1_2 Forward -57 -50 6.23397 0.171
NP_440136.1_2 Reverse -50 -57 6.13563 0.193
NP_442998.1_10 Forward -329 -322 15.5754 0.0102
NP_442998.1_10 Reverse -324 -331 15.5754 0.0102
NP_442998.1_10 Reverse -51 -58 15.5754 0.0102
NP_440899.1_5 Reverse -186 -205 4.81767 0.242
NP_440299.1_1 Forward -335 -322 14.08 0.0259
NP_440299.1_1 Reverse -318 -331 7.68852 0.107
NP_440299.1_1 Reverse -192 -205 6.80355 0.13
NP_441799.1_1 Reverse -318 -332 14.5519 0.0228
NP_440640.1_6 Forward -217 -198 7.27595 0.174
NP_441007.1_10 Reverse -317 -330 1.59258 0.203
NP_441435.1_4 Forward -236 -217 6.39097 0.283
NP_440256.1_1 Reverse -46 -65 -0.787193 0.0961
NP_440256.1_1 Forward -61 -42 -4.42544 0.155
NP_440256.1_1 Forward -136 -117 -7.67036 0.243
NP_440256.1_1 Reverse -166 -185 -8.06369 0.251
NP_442526.1_3 Reverse -53 -72 19.2399 0.128
NP_442007.1_8 Reverse -374 -392 18.2096 0.153
NP_441559.1_8 Forward -210 -196 -1.18038 0.181
NP_441559.1_8 Forward -148 -134 -3.54032 0.205
NP_441559.1_8 Forward -250 -236 -5.60527 0.267
NP_441559.1_8 Reverse -317 -331 -5.80194 0.27
NP_441559.1_8 Forward -336 -322 -5.9986 0.271
NP_441559.1_8 Forward -138 -124 -6.88358 0.281
NP_440915.1_6 Forward -335 -321 12.291 0.0218
NP_440915.1_6 Reverse -318 -332 2.5562 0.115
NP_442158.1_4 Forward -400 -390 11.3864 0.278
NP_441704.1_8 Forward -342 -323 9.34008 0.182
NP_442452.1_8 Reverse -163 -177 13.372 0.273
NP_442866.1_1 Forward -205 -186 -5.9004 0.245
NP_441464.1_1 Forward -345 -326 6.68596 0.285
NP_441464.1_8 Forward -331 -317 6.88276 0.222
NP_441464.1_10 Forward -395 -381 9.14437 0.263
NP_440702.1_2 Forward -396 -377 -4.52377 0.257
NP_440702.1_2 Forward -207 -188 -7.67036 0.286
NP_440702.1_2 Forward -220 -201 -8.45701 0.294
NP_440695.1_6 Reverse -311 -325 10.9931 0.265
NP_442993.1_1 Reverse -322 -338 -7.70961 0.146
NP_442386.1_9 Forward -332 -323 13.8639 0.0289
NP_442386.1_9 Reverse -321 -330 6.39082 0.219
NP_442386.1_9 Forward -10 -1 5.40752 0.253
NP_442386.1_9 Reverse -48 -57 5.11253 0.266
NP_440570.1_5 Reverse -213 -232 -3.93378 0.298
NP_442054.1_4 Forward -132 -113 9.63589 0.299
NP_441340.1_5 Forward -330 -323 15.6737 0.0124
NP_441340.1_5 Reverse -323 -330 15.6737 0.0124
NP_441340.1_5 Forward -57 -50 6.23397 0.132
NP_441340.1_5 Reverse -50 -57 5.84064 0.208
NP_441340.1_9 Forward -169 -159 9.02648 0.256
NP_441340.1_9 Forward -39 -29 8.25522 0.256
NP_441271.1_8 Forward -13 -3 13.648 0.272
NP_442484.1_2 Reverse -54 -73 -1.27885 0.288
NP_440327.1_6 Reverse -262 -281 3.24438 0.285
NP_442240.1_2 Forward -204 -185 -13.5702 0.171
NP_440161.1_3 Forward -333 -314 8.94757 0.262
NP_440586.1_8 Forward -57 -50 14.69 0.026
NP_440586.1_8 Forward -330 -323 13.2151 0.026
NP_440586.1_8 Reverse -323 -330 13.2151 0.026
NP_440586.1_8 Reverse -197 -204 9.28187 0.164
NP_440586.1_8 Forward -181 -174 9.08521 0.178
NP_442251.1_6 Forward -330 -323 15.2804 0.0124
NP_442251.1_6 Reverse -323 -330 15.2804 0.0124
NP_442251.1_6 Reverse -50 -57 12.0355 0.0627
NP_440192.1_4 Reverse -8 -27 9.20356 0.279
NP_440192.1_5 Forward -206 -187 7.27595 0.212
NP_441262.1_3 Reverse -322 -329 14.7888 0.0223
NP_441262.1_3 Forward -331 -324 14.7888 0.0223
NP_441262.1_3 Forward -58 -51 14.7888 0.0223
NP_440027.1_3 Reverse -169 -187 1.78836 0.295
NP_443051.1_1 Reverse -321 -330 18.0926 0.00402
NP_443051.1_1 Forward -332 -323 10.4228 0.00754
NP_443051.1_1 Forward -59 -50 0.884706 0.125
NP_439996.1_6 Reverse -327 -346 8.20483 0.256
NP_439937.1_9 Forward -332 -315 -14.8098 0.287
NP_439937.1_9 Reverse -321 -338 -16.678 0.287
NP_440408.1_6 Reverse -339 -357 12.9005 0.287
NP_440408.1_7 Forward -107 -88 8.55425 0.276
NP_440439.1_1 Forward -334 -321 2.08423 0.138
NP_439943.1_7 Reverse -323 -342 9.0459 0.18
NP_440372.1_2 Forward -330 -323 16.3621 0.0124
NP_440372.1_2 Reverse -323 -330 16.3621 0.0124
NP_440372.1_2 Forward -57 -50 6.82395 0.0854
NP_440372.1_2 Reverse -50 -57 6.52896 0.188
NP_440171.1_3 Forward -304 -285 3.14605 0.284
NP_440316.1_10 Forward -200 -190 8.4365 0.239
NP_440316.1_10 Reverse -229 -239 6.96153 0.251
NP_439977.1_5 Reverse -316 -335 10.1275 0.0879
NP_439977.1_5 Reverse -178 -197 -2.65548 0.287
NP_440139.1_1 Reverse -316 -335 7.66846 0.127
NP_441572.1_7 Forward -211 -192 5.11266 0.0892
NP_440267.1_2 Reverse -191 -205 5.50552 0.264
NP_442384.1_10 Forward -331 -318 19.8821 0.00338
NP_442384.1_10 Reverse -224 -237 12.2123 0.0296
NP_442384.1_10 Reverse -322 -335 10.049 0.047
NP_442384.1_10 Forward -205 -192 6.4108 0.102
NP_442790.1_4 Reverse -313 -332 -15.9302 0.3
NP_442262.1_10 Forward -330 -323 14.1988 0.0123
NP_442262.1_10 Reverse -323 -330 14.1988 0.0123
NP_442262.1_10 Forward -57 -50 12.9205 0.0422
NP_442262.1_10 Forward -181 -174 9.18389 0.211
NP_442262.1_10 Reverse -329 -336 8.59391 0.22
NP_441689.1_5 Forward -333 -323 15.3192 0.0403
NP_441689.1_5 Forward -60 -50 5.78111 0.197
NP_441689.1_5 Reverse -47 -57 5.48612 0.251
NP_441689.1_5 Forward -339 -329 4.99446 0.285
NP_440163.1_10 Forward -334 -324 11.3864 0.169
NP_440163.1_10 Forward -61 -51 11.3864 0.169
NP_440163.1_10 Forward -208 -198 8.53483 0.271
NP_440344.1_10 Forward -338 -321 -5.86102 0.11
NP_440344.1_10 Reverse -315 -332 -8.22096 0.124
NP_441632.1_7 Reverse -196 -215 19.9606 0.103
NP_440282.1_10 Forward -209 -190 1.17943 0.182
NP_440531.1_6 Reverse -165 -184 0.58944 0.19
NP_440531.1_6 Forward -82 -63 -4.42544 0.28
NP_441060.1_9 Forward -331 -312 14.0608 0.172
NP_442910.1_1 Forward -338 -319 -8.45701 0.296
NP_441965.1_3 Forward -341 -322 0.196116 0.243
NP_442556.1_10 Reverse -337 -356 7.8759 0.299
NP_440297.1_9 Forward -330 -320 9.61647 0.0917
NP_440297.1_9 Reverse -323 -333 9.32148 0.0917
NP_440297.1_9 Forward -204 -194 9.22315 0.0917
NP_440297.1_9 Reverse -197 -207 -0.118297 0.282
NP_440297.1_9 Reverse -174 -184 -0.216628 0.282
NP_440297.1_9 Reverse -50 -60 -0.511621 0.289
NP_440350.1_2 Reverse -48 -67 6.39097 0.248
NP_441896.1_3 Reverse -313 -332 0.491109 0.225
NP_440894.1_10 Reverse -317 -336 7.66927 0.197
NP_440999.1_9 Forward -335 -321 2.06454 0.154
NP_440999.1_9 Reverse -318 -332 -0.688726 0.214
NP_440999.1_9 Reverse -120 -134 -1.47537 0.239
NP_440888.1_2 Reverse -322 -336 19.0751 0.00173
NP_440888.1_2 Forward -331 -317 6.39049 0.236
NP_440888.1_4 Forward -181 -167 15.0697 0.253
NP_440600.1_4 Reverse -41 -59 5.42735 0.105
NP_439969.1_3 Forward -210 -191 2.0644 0.249
NP_442033.1_10 Reverse -320 -339 -8.16202 0.191
NP_441543.1_2 Reverse -323 -332 16.9127 0.00359
NP_441543.1_2 Reverse -197 -206 13.1761 0.0284
NP_441543.1_2 Forward -57 -48 11.9961 0.047
NP_441543.1_2 Forward -330 -321 9.34117 0.0818
NP_441543.1_2 Reverse -50 -59 7.07956 0.131
NP_442845.1_2 Forward -205 -191 7.86607 0.195
NP_442845.1_2 Reverse -224 -238 5.1128 0.243
NP_442845.1_2 Forward -337 -323 4.62115 0.256
NP_441178.1_5 Forward -343 -324 13.2741 0.152
NP_440982.1_1 Reverse -93 -112 4.52188 0.294
NP_441469.1_8 Reverse -321 -330 13.3727 0.073
NP_441469.1_8 Reverse -195 -204 9.24284 0.227
NP_441469.1_8 Forward -332 -323 6.48957 0.227
NP_441469.1_8 Forward -206 -197 5.50626 0.265
NP_441548.1_2 Reverse -8 -27 13.7658 0.212
NP_442315.1_2 Forward -49 -37 9.18376 0.291
NP_442315.1_5 Forward -110 -100 16.4013 0.3
NP_443064.1_6 Forward -331 -321 13.8273 0.0796
NP_443064.1_6 Reverse -322 -332 12.5669 0.0796
NP_443064.1_6 Reverse -49 -59 8.88251 0.262
NP_442337.1_6 Reverse -134 -153 13.1535 0.263
NP_442337.1_8 Forward -398 -379 1.37609 0.24
NP_442578.1_7 Forward -57 -50 14.6904 0.026
NP_442578.1_7 Forward -330 -323 14.5921 0.026
NP_442578.1_7 Reverse -323 -330 14.5921 0.026
NP_440071.1_1 Reverse -381 -398 12.7228 0.223
NP_441462.1_2 Forward -331 -321 20.1379 0.000967
NP_441462.1_2 Reverse -322 -332 11.5831 0.00406
NP_441462.1_2 Forward -58 -48 1.25834 0.0964
NP_441621.1_7 Reverse -194 -208 -6.09693 0.275
NP_443062.1_1 Reverse -49 -67 16.5415 0.0308
NP_443062.1_1 Reverse -322 -340 14.2013 0.051
NP_443062.1_1 Reverse -196 -214 8.15589 0.159
NP_443062.1_1 Forward -205 -187 3.76806 0.285
NP_443062.1_6 Forward -339 -320 22.0256 0.0427
NP_443062.1_6 Reverse -314 -333 1.96607 0.264
NP_440349.1_3 Reverse -197 -216 10.52 0.283
NP_440519.1_3 Reverse -1 -20 13.8641 0.137
NP_440519.1_8 Forward -205 -189 6.25339 0.21
NP_442204.1_1 Forward -209 -198 8.81013 0.0852
NP_442204.1_1 Forward -137 -126 0.550326 0.281
NP_442204.1_1 Forward -335 -324 0.353664 0.281
NP_441560.1_8 Reverse -317 -336 16.7717 0.068
NP_442780.1_3 Forward -321 -302 6.73176 0.269
NP_440516.1_6 Forward -239 -225 19.7634 0.15
NP_440516.1_6 Reverse -292 -306 6.48882 0.293
NP_440516.1_8 Forward -331 -322 16.9127 0.00442
NP_440516.1_8 Reverse -322 -331 16.9127 0.00442
NP_440516.1_8 Forward -58 -49 0.983037 0.13
NP_441785.1_1 Reverse -322 -336 15.5501 0.132
NP_442428.1_4 Reverse -321 -340 21.1406 0.0564
NP_442428.1_5 Forward -330 -323 15.8704 0.0124
NP_442428.1_5 Reverse -323 -330 15.8704 0.0124
NP_442428.1_5 Forward -204 -197 11.4455 0.062
NP_442428.1_5 Forward -57 -50 6.13563 0.209
NP_442428.1_5 Reverse -50 -57 6.0373 0.212
NP_440783.1_5 Forward -199 -180 -0.000545616 0.209
NP_441790.1_3 Forward -204 -185 -4.42544 0.291
NP_442859.1_2 Forward -204 -185 3.34271 0.255
NP_440673.1_2 Reverse -55 -74 8.1459 0.28
NP_440673.1_3 Forward -329 -322 12.4288 0.0426
NP_440673.1_3 Reverse -324 -331 12.4288 0.0426
NP_440673.1_3 Reverse -51 -58 12.4288 0.0426
NP_440673.1_3 Reverse -286 -293 6.62729 0.281
NP_441052.1_2 Reverse -322 -332 19.9412 0.00106
NP_441052.1_2 Forward -331 -321 10.4031 0.0285
NP_441052.1_2 Forward -58 -48 6.76487 0.0863
NP_441052.1_2 Reverse -49 -59 1.65166 0.233
NP_442219.1_9 Reverse -323 -332 17.7976 0.00718
NP_442219.1_9 Forward -57 -48 8.75118 0.0681
NP_442219.1_9 Forward -330 -321 8.25953 0.0681
NP_442219.1_9 Reverse -50 -59 7.96454 0.0696
NP_440436.1_4 Reverse -323 -332 17.2072 0.00233
NP_440436.1_4 Forward -330 -321 15.9289 0.00508
NP_440436.1_4 Reverse -50 -59 7.57079 0.124
NP_440436.1_4 Forward -57 -48 6.39082 0.162
NP_440436.1_4 Reverse -197 -206 5.70251 0.186
NP_441884.1_8 Forward -108 -89 -6.98204 0.241
NP_441884.1_8 Forward -55 -36 -13.8652 0.294
NP_441884.1_9 Forward -194 -175 -13.0786 0.138
NP_441336.1_3 Forward -395 -381 15.3392 0.277
NP_440314.1_9 Forward -330 -311 0.392778 0.0952
NP_440041.1_2 Forward -190 -171 -5.50708 0.296
NP_441719.1_4 Forward -330 -323 16.3621 0.0124
NP_441719.1_4 Reverse -323 -330 16.3621 0.0124
NP_441719.1_4 Forward -57 -50 13.5105 0.026
NP_441719.1_4 Reverse -50 -57 6.52896 0.188
NP_441733.1_10 Forward -334 -321 8.18076 0.14
NP_442813.1_4 Reverse -4 -23 -6.88371 0.299
NP_442366.1_3 Reverse -321 -339 2.28076 0.132
NP_442366.1_3 Reverse -195 -213 1.10079 0.158
NP_442873.1_3 Reverse -186 -205 7.96345 0.204
NP_443054.1_2 Reverse -320 -334 2.94952 0.24
NP_443054.1_2 Forward -333 -319 0.88457 0.252
NP_443054.1_2 Reverse -24 -38 0.392915 0.267
NP_441851.1_5 Reverse -229 -248 8.94757 0.23
NP_441851.1_10 Reverse -321 -331 17.4829 0.0027
NP_441851.1_10 Forward -332 -322 15.8113 0.00552
NP_441851.1_10 Forward -59 -49 13.0581 0.0372
NP_441851.1_10 Reverse -235 -245 11.5831 0.0685
NP_441851.1_10 Forward -206 -196 4.99491 0.233
NP_441668.1_4 Forward -192 -173 5.60432 0.165
NP_442515.1_1 Forward -332 -318 23.2057 0.00534
NP_442515.1_1 Reverse -321 -335 1.67122 0.152
NP_442515.1_1 Reverse -143 -157 -4.62196 0.298
NP_441982.1_6 Forward -24 -15 10.862 0.291
NP_441982.1_6 Forward -69 -60 10.671 0.295
NP_441046.1_2 Forward -342 -323 2.26107 0.241
NP_440940.1_7 Forward -341 -323 8.96649 0.167
NP_441349.1_9 Reverse -3 -21 11.8189 0.299
NP_441349.1_10 Forward -68 -49 14.1591 0.0159
NP_441349.1_10 Forward -341 -322 -0.983855 0.0981
NP_441661.1_3 Forward -296 -279 2.59545 0.226
NP_441409.1_6 Reverse -316 -335 1.96607 0.0586
NP_442314.1_2 Forward -194 -175 4.03102 0.189
NP_440432.1_9 Forward -330 -315 4.20813 0.0746
NP_440432.1_9 Forward -57 -42 -3.26502 0.179
NP_442843.1_1 Forward -198 -179 -9.63698 0.267
NP_442843.1_1 Forward -73 -54 -11.5053 0.291
NP_439960.1_6 Reverse -91 -110 12.2908 0.186
NP_440933.1_9 Reverse -89 -108 13.6666 0.273
NP_441477.1_10 Forward -338 -320 2.37909 0.242
NP_440431.1_3 Forward -332 -313 2.16274 0.0979
NP_440431.1_3 Forward -354 -335 -8.26035 0.229
NP_442450.1_5 Reverse -320 -330 10.0098 0.115
NP_442450.1_5 Forward -333 -323 9.32148 0.115
NP_442450.1_5 Forward -60 -50 6.07655 0.204
NP_440195.1_4 Forward -343 -324 10.5209 0.164
NP_441570.1_1 Reverse -322 -340 1.49411 0.0304
NP_441570.1_1 Reverse -49 -67 -1.55415 0.0578
NP_441570.1_1 Forward -205 -187 -2.3408 0.065
NP_441570.1_1 Forward -58 -40 -9.12563 0.129
NP_441570.1_1 Reverse -274 -292 -11.3872 0.194
NP_441078.1_4 Forward -331 -322 19.6659 0.0007
NP_441078.1_4 Reverse -322 -331 19.6659 0.0007
NP_441078.1_4 Reverse -49 -58 0.0980582 0.205
NP_441078.1_4 Forward -58 -49 0.0980582 0.205
NP_442729.1_8 Reverse -318 -331 10.934 0.125
NP_442729.1_8 Forward -335 -322 8.47575 0.125
NP_441663.1_7 Forward -208 -189 4.52268 0.268
NP_442443.1_1 Reverse -130 -149 -5.70374 0.284
NP_440526.1_3 Reverse -323 -334 10.1862 0.0646
NP_440526.1_3 Forward -330 -319 1.72983 0.267
NP_440526.1_3 Reverse -50 -61 0.54986 0.275
NP_441432.1_8 Forward -332 -323 16.8143 0.00595
NP_441432.1_8 Reverse -321 -330 8.35786 0.0755
NP_441432.1_8 Forward -59 -50 7.27622 0.101
NP_441432.1_8 Reverse -259 -268 6.98123 0.112
NP_441432.1_8 Forward -200 -191 2.94966 0.28
NP_443024.1_3 Forward -37 -27 15.2213 0.255
NP_442320.1_8 Forward -337 -323 5.01447 0.0442
NP_442320.1_8 Forward -64 -50 1.96621 0.0801
NP_442320.1_8 Reverse -43 -57 -6.19526 0.269
NP_441732.1_2 Forward -335 -319 -16.2644 0.165
NP_441030.1_3 Forward -345 -326 17.7965 0.243
NP_442815.1_2 Forward -193 -175 12.2122 0.144
NP_440760.1_1 Forward -331 -312 -0.885524 0.028
NP_440760.1_1 Reverse -322 -341 -12.4886 0.0931
NP_440199.1_10 Forward -334 -324 16.7946 0.0381
NP_440199.1_10 Forward -61 -51 16.7946 0.0381
NP_442353.1_4 Forward -337 -318 4.42355 0.205
NP_443011.1_4 Forward -209 -190 6.78429 0.275
NP_442489.1_2 Forward -210 -191 5.70265 0.191
NP_442489.1_7 Forward -331 -322 20.1576 0.000695
NP_442489.1_7 Reverse -322 -331 20.1576 0.000695
NP_442489.1_7 Reverse -49 -58 7.57121 0.057
NP_442489.1_7 Forward -58 -49 0.589713 0.17
NP_442489.1_7 Forward -205 -196 -1.6719 0.235
NP_440559.1_1 Reverse -323 -332 17.4043 0.00658
NP_440559.1_1 Forward -330 -321 17.306 0.00658
NP_440559.1_1 Forward -57 -48 14.4544 0.0174
NP_440559.1_1 Reverse -50 -59 7.76787 0.0918
NP_442763.1_10 Reverse -191 -210 21.0423 0.0236
NP_441659.2_8 Forward -331 -321 19.3512 0.000966
NP_441659.2_8 Reverse -322 -332 18.1713 0.00133
NP_441659.2_8 Reverse -49 -59 6.27322 0.0797
NP_441022.1_1 Reverse -310 -319 13.2728 0.216
NP_441040.1_5 Reverse -317 -336 8.94757 0.226
NP_441807.1_5 Reverse -311 -330 12.1925 0.142
NP_442346.1_5 Reverse -321 -331 17.9746 0.00128
NP_442346.1_5 Forward -332 -322 16.6963 0.00248
NP_442346.1_5 Forward -59 -49 7.05986 0.183
NP_442346.1_5 Forward -183 -173 6.37155 0.205
NP_442346.1_5 Reverse -48 -58 4.69992 0.276
NP_440545.1_3 Reverse -192 -209 -0.649475 0.157
NP_440545.1_3 Forward -335 -318 -3.8944 0.214
NP_440545.1_3 Forward -297 -280 -4.68105 0.23
NP_440545.1_3 Forward -209 -192 -5.36936 0.247
NP_441856.1_3 Forward -334 -315 8.16093 0.101
NP_440025.1_1 Reverse -45 -64 13.0775 0.147
NP_440459.1_2 Forward -340 -323 8.39697 0.264
NP_440010.1_3 Forward -113 -94 -1.18052 0.25
NP_442603.1_7 Forward -331 -317 15.2402 0.0502
NP_442603.1_7 Reverse -322 -336 12.6836 0.0948
NP_441047.1_2 Forward -336 -317 -2.95047 0.284
NP_441833.1_4 Forward -330 -323 15.9687 0.0124
NP_441833.1_4 Reverse -323 -330 15.9687 0.0124
NP_441833.1_4 Reverse -50 -57 6.52896 0.0924
NP_441833.1_4 Forward -57 -50 6.23397 0.163
NP_442162.1_9 Forward -330 -323 16.2637 0.0124
NP_442162.1_9 Reverse -323 -330 16.2637 0.0124
NP_442162.1_9 Forward -57 -50 6.62729 0.142
NP_442162.1_9 Reverse -50 -57 6.52896 0.178
NP_440671.1_4 Forward -337 -323 16.1259 0.0322
NP_440671.1_4 Forward -211 -197 16.1259 0.0322
NP_440671.1_4 Forward -64 -50 11.5043 0.132
NP_442140.1_3 Forward -330 -320 11.5831 0.0743
NP_442140.1_3 Reverse -323 -333 4.40493 0.243
NP_442723.1_2 Reverse -262 -281 14.3558 0.167
NP_442021.1_9 Forward -354 -335 8.16093 0.19
NP_441813.1_5 Reverse -320 -330 18.3679 0.00743
NP_441813.1_5 Forward -333 -323 15.9097 0.01
NP_441813.1_5 Forward -60 -50 6.17489 0.1
NP_440594.1_8 Forward -330 -317 21.1598 0.0534
NP_442028.1_1 Forward -318 -305 6.65072 0.298
NP_440590.1_4 Reverse -323 -336 14.3756 0.0109
NP_440590.1_4 Forward -330 -317 3.36254 0.0746
NP_442497.1_10 Forward -330 -321 19.8626 0.00532
NP_442497.1_10 Reverse -323 -332 10.4228 0.0087
NP_442497.1_10 Reverse -50 -59 0.589713 0.153
NP_442497.1_10 Forward -57 -48 -1.18024 0.256
NP_440821.1_4 Forward -333 -323 18.2696 0.00448
NP_440821.1_4 Reverse -320 -330 10.9931 0.0146
NP_440821.1_4 Forward -60 -50 8.53483 0.0468
NP_440821.1_4 Reverse -194 -204 -0.314959 0.251
NP_440821.1_4 Forward -207 -197 -0.314959 0.251
NP_441239.1_9 Reverse -320 -332 12.6253 0.0446
NP_441239.1_9 Forward -333 -321 7.90546 0.147
NP_441239.1_9 Reverse -171 -183 6.92215 0.173
NP_441239.1_9 Reverse -194 -206 5.15219 0.227
NP_440400.1_1 Reverse -187 -206 1.08032 0.263
NP_441892.1_1 Forward -67 -50 4.85706 0.105
NP_441892.1_1 Reverse -40 -57 3.18543 0.129
NP_441892.1_1 Forward -191 -174 1.31714 0.154
NP_440604.1_6 Forward -205 -186 -2.75381 0.225
NP_441508.1_4 Forward -22 -8 14.9084 0.258
NP_442643.1_1 Forward -200 -181 -10.227 0.231
NP_441017.1_6 Forward -335 -321 18.5835 0.0376
NP_441017.1_6 Forward -62 -48 12.3887 0.221
NP_440546.1_4 Forward -331 -321 12.8578 0.0572
NP_440546.1_4 Reverse -322 -332 10.046 0.109
NP_442041.1_2 Forward -189 -171 8.96727 0.283
NP_441509.1_8 Reverse -31 -45 19.2718 0.0881
NP_441230.1_5 Reverse -185 -204 10.5209 0.106
NP_441230.1_5 Reverse -168 -187 1.57275 0.239
NP_440675.1_10 Reverse -335 -354 10.8159 0.293
NP_440462.1_6 Reverse -320 -330 9.7148 0.0429
NP_440462.1_6 Forward -333 -323 7.74818 0.0699
NP_440462.1_6 Forward -60 -50 4.50326 0.197
NP_440868.1_4 Reverse -318 -330 3.2839 0.137
NP_440868.1_4 Forward -335 -323 -0.846001 0.282
NP_440401.1_9 Reverse -39 -46 14.5917 0.287
NP_442402.1_4 Reverse -53 -72 -2.06626 0.195
NP_442402.1_9 Reverse -10 -29 9.0459 0.277
NP_441848.1_4 Reverse -303 -319 12.6117 0.199
NP_441084.1_6 Reverse -228 -242 10.7985 0.228
NP_442460.1_2 Reverse -11 -30 12.3892 0.127
NP_440696.1_3 Reverse -318 -336 -0.0791831 0.238
NP_440696.1_3 Forward -249 -231 -4.01242 0.294
NP_442039.1_4 Forward -330 -323 15.1821 0.0124
NP_442039.1_4 Reverse -323 -330 15.1821 0.0124
NP_440825.1_6 Forward -166 -147 9.73422 0.285
NP_442837.1_3 Forward -330 -323 15.7721 0.0124
NP_442837.1_3 Reverse -323 -330 15.7721 0.0124
NP_442837.1_3 Reverse -50 -57 12.1338 0.0702
NP_442837.1_3 Forward -57 -50 6.0373 0.25
NP_439994.1_1 Reverse -274 -293 8.16093 0.271
NP_439994.1_3 Reverse -321 -340 8.24345 0.291
NP_442053.1_1 Forward -331 -322 18.3876 0.0007
NP_442053.1_1 Reverse -322 -331 18.3876 0.0007
NP_442053.1_1 Reverse -49 -58 6.8829 0.111
NP_440505.1_3 Forward -333 -323 16.303 0.00696
NP_440505.1_3 Reverse -320 -330 9.61647 0.122
NP_440505.1_3 Forward -60 -50 7.45319 0.154
NP_442360.1_5 Forward -14 -4 13.2547 0.28
NP_440914.1_1 Reverse -322 -332 17.5935 0.000537
NP_440914.1_1 Forward -331 -321 8.51751 0.186
NP_440914.1_1 Reverse -49 -59 7.24882 0.242
NP_440914.1_1 Reverse -236 -246 6.17532 0.293
NP_441011.1_8 Forward -330 -321 14.356 0.0249
NP_441011.1_8 Reverse -323 -332 8.25953 0.144
NP_442533.1_1 Forward -397 -378 -12.0953 0.236
NP_442533.1_1 Forward -208 -189 -14.1602 0.24
NP_442533.1_6 Forward -331 -322 17.2076 0.00137
NP_442533.1_6 Reverse -322 -331 17.2076 0.00137
NP_442533.1_6 Forward -58 -49 5.40793 0.14
NP_442533.1_6 Reverse -196 -205 5.11294 0.155
NP_442533.1_6 Forward -182 -173 4.71961 0.177
NP_442533.1_6 Reverse -65 -74 2.55633 0.25
NP_441089.1_5 Forward -213 -194 18.9773 0.241
NP_442541.1_3 Reverse -186 -205 5.50599 0.244
NP_442541.1_10 Reverse -179 -193 12.782 0.182
NP_442232.1_3 Forward -190 -171 -15.6352 0.295
NP_442322.1_4 Reverse -188 -205 -10.0899 0.298
NP_441482.1_7 Forward -337 -323 0.786239 0.0554
NP_441482.1_7 Reverse -316 -330 -2.95034 0.103
NP_441482.1_7 Reverse -230 -244 -9.44018 0.202
NP_441482.1_7 Forward -64 -50 -11.1118 0.237
NP_439944.1_8 Forward -303 -284 14.8474 0.238
NP_439944.1_9 Reverse -323 -333 19.0562 0.00329
NP_439944.1_9 Reverse -50 -60 9.22315 0.1
NP_439944.1_9 Forward -330 -320 8.82982 0.101
NP_440116.1_8 Reverse -323 -342 5.40766 0.0654
NP_441527.1_5 Forward -333 -314 11.7264 0.297
NP_440115.1_6 Reverse -319 -329 7.05986 0.161
NP_440007.1_9 Forward -209 -195 4.42448 0.267
NP_440007.1_9 Reverse -232 -246 4.32615 0.267
NP_440007.1_9 Forward -335 -321 2.06454 0.281
NP_441170.1_4 Forward -197 -179 13.0972 0.166
NP_441972.1_5 Reverse -180 -199 -3.24547 0.199
NP_441106.1_1 Reverse -321 -330 9.73449 0.0311
NP_441106.1_1 Forward -332 -323 9.63616 0.0311
NP_441106.1_1 Forward -206 -197 5.21127 0.167
NP_441825.1_4 Reverse -10 -20 16.1063 0.186
NP_439903.1_6 Reverse -187 -206 5.60352 0.178
NP_439903.1_6 Reverse -319 -338 -1.27961 0.295
NP_442588.1_6 Reverse -3 -22 5.211 0.175
NP_442588.1_6 Reverse -2 -21 4.916 0.175
NP_442588.1_6 Reverse -325 -344 -2.95047 0.296
NP_441286.1_1 Forward -332 -320 15.4769 0.00418
NP_441286.1_1 Reverse -321 -333 11.937 0.0108
NP_441286.1_1 Reverse -48 -60 2.39892 0.065
NP_441286.1_1 Forward -59 -47 -5.76255 0.223
NP_440670.1_8 Forward -331 -322 18.3876 0.000699
NP_440670.1_8 Reverse -322 -331 18.3876 0.000699
NP_442477.1_3 Forward -150 -131 5.89931 0.25
NP_441705.1_3 Forward -172 -153 -5.50708 0.291
NP_440886.1_7 Reverse -321 -331 8.04271 0.0805
NP_440886.1_7 Forward -332 -322 7.94438 0.0805
NP_440886.1_7 Reverse -181 -191 5.19112 0.194
NP_440886.1_7 Reverse -290 -300 5.09279 0.201
NP_442614.1_2 Forward -331 -317 10.1277 0.234
NP_442614.1_2 Reverse -322 -336 5.99778 0.295
NP_442382.1_7 Forward -344 -325 3.24438 0.281
NP_442072.1_9 Reverse -321 -339 5.32902 0.0167
NP_442213.1_5 Forward -398 -379 7.66927 0.176
NP_442213.1_6 Reverse -127 -146 15.8307 0.136
NP_441808.1_8 Forward -217 -198 17.109 0.152
NP_441808.1_8 Forward -211 -192 9.3409 0.259
NP_440907.2_8 Forward -330 -320 9.91099 0.103
NP_442264.1_2 Reverse -318 -335 15.7718 0.122
NP_442264.1_2 Forward -215 -198 7.90532 0.225
NP_442264.1_5 Forward -245 -231 11.996 0.253
NP_441463.1_3 Forward -68 -49 -4.03212 0.191
NP_441463.1_6 Forward -339 -325 9.41158 0.25
NP_441463.1_6 Forward -333 -319 6.70583 0.267
NP_441626.1_2 Forward -330 -323 15.7721 0.0124
NP_441626.1_2 Reverse -323 -330 15.7721 0.0124
NP_441626.1_2 Forward -57 -50 6.13563 0.177
NP_441626.1_2 Reverse -50 -57 5.93897 0.231
NP_442238.1_7 Reverse -28 -47 7.57013 0.248
NP_442794.1_1 Forward -335 -323 10.1671 0.0721
NP_442794.1_1 Forward -209 -197 5.34885 0.225
NP_442615.1_1 Reverse -313 -331 -4.60241 0.19
NP_440387.1_1 Reverse -322 -338 4.28677 0.0441
NP_441431.1_2 Reverse -170 -184 7.17714 0.247
NP_441836.1_2 Reverse -316 -335 -2.0655 0.224
NP_441836.1_2 Forward -184 -165 -2.36049 0.229
NP_441836.1_2 Forward -194 -175 -5.70374 0.284
NP_441193.1_6 Forward -57 -38 2.94938 0.246
NP_441993.1_1 Forward -205 -186 2.92126 0.246
NP_441993.1_1 Forward -398 -379 1.55686 0.274
NP_441993.1_1 Forward -188 -169 0.484826 0.298
NP_441174.1_2 Forward -136 -122 12.4876 0.248
NP_440814.1_4 Forward -340 -321 6.4893 0.0738
NP_440114.1_10 Forward -331 -317 11.7993 0.103
NP_440293.1_3 Forward -190 -171 21.8289 0.0271
NP_440293.1_3 Forward -201 -182 -5.70374 0.281
NP_440766.1_4 Forward -335 -321 15.2409 0.0269
NP_440766.1_4 Reverse -192 -206 0.196253 0.298
NP_442930.1_1 Reverse -310 -320 15.1225 0.202
NP_439910.1_2 Forward -339 -322 5.25038 0.0287
NP_439910.1_2 Reverse -314 -331 -12.7442 0.0944
NP_440457.1_1 Reverse -318 -330 9.08543 0.0967
NP_440457.1_1 Forward -335 -323 7.02048 0.105
NP_440457.1_1 Forward -62 -50 -0.256015 0.259
NP_441984.1_3 Reverse -318 -336 10.1472 0.192
NP_440054.1_2 Reverse -111 -130 10.0284 0.277
NP_442509.1_9 Forward -331 -321 17.3841 0.00128
NP_442509.1_9 Reverse -322 -332 8.14104 0.192
NP_442936.1_10 Forward -321 -307 16.7288 0.216
NP_442936.1_10 Reverse -307 -321 7.44549 0.28
NP_440554.1_4 Forward -330 -320 8.82982 0.0646
NP_440554.1_4 Reverse -323 -333 7.05986 0.106
NP_440554.1_4 Reverse -197 -207 1.94665 0.282
NP_441885.1_5 Reverse -322 -332 20.9245 0.000538
NP_441885.1_5 Forward -331 -321 11.3864 0.00668
NP_441885.1_5 Forward -58 -48 10.2065 0.012
NP_441885.1_5 Reverse -49 -59 1.35667 0.11
NP_440478.1_2 Reverse -136 -155 2.85105 0.2
NP_442703.1_4 Forward -35 -16 5.2102 0.282
NP_442341.1_7 Reverse -321 -335 15.8309 0.0203
NP_442341.1_7 Forward -332 -318 5.50613 0.154
NP_442341.1_7 Reverse -195 -209 4.52282 0.188
NP_442341.1_9 Reverse -320 -334 10.6187 0.133
NP_440686.1_7 Reverse -301 -320 15.9676 0.292
NP_443000.1_7 Forward -333 -323 17.0896 0.00865
NP_443000.1_7 Reverse -320 -330 11.6814 0.0344
NP_443000.1_7 Forward -60 -50 7.35486 0.0859
NP_443059.1_10 Forward -345 -326 12.0933 0.149
NP_440275.1_3 Reverse -320 -330 16.9913 0.0133
NP_440275.1_3 Forward -333 -323 8.1415 0.0602
NP_440091.1_1 Forward -335 -323 8.88877 0.0567
NP_440091.1_1 Forward -62 -50 6.72548 0.0921
NP_440091.1_1 Reverse -45 -57 1.7106 0.197
NP_440679.1_5 Reverse -325 -344 7.37428 0.292
NP_440679.1_10 Forward -212 -193 -12.4886 0.198
NP_443010.1_10 Forward -334 -317 2.09436 0.283
NP_442451.1_2 Forward -339 -320 -10.9153 0.28
NP_442495.1_5 Forward -193 -174 5.30933 0.291
NP_440149.1_8 Reverse -322 -341 3.44104 0.0939
NP_442214.1_1 Reverse -67 -86 13.2741 0.209
NP_441105.1_3 Forward -342 -323 -5.01543 0.211
NP_441105.1_3 Reverse -311 -330 -5.70374 0.223
NP_440216.1_1 Forward -331 -317 7.37441 0.00942
NP_440216.1_1 Reverse -322 -336 -9.63684 0.145
NP_440216.1_1 Forward -58 -44 -11.5051 0.192
NP_440172.1_1 Forward -331 -321 16.303 0.00854
NP_440172.1_1 Reverse -322 -332 15.0247 0.00945
NP_440172.1_1 Forward -58 -48 7.55152 0.0761
NP_440172.1_1 Reverse -26 -36 7.45319 0.0789
NP_440172.1_6 Forward -70 -51 4.22769 0.299
NP_442015.1_10 Forward -335 -322 10.344 0.0391
NP_442015.1_10 Reverse -192 -205 9.36073 0.0503
NP_442015.1_10 Forward -209 -196 4.34585 0.174
NP_442015.1_10 Reverse -318 -331 3.5592 0.179
NP_442015.1_10 Forward -14 -1 -0.0790467 0.25
NP_441226.1_7 Forward -330 -323 14.4934 0.0123
NP_441226.1_7 Reverse -323 -330 14.4934 0.0123
NP_441757.1_3 Forward -332 -313 -1.37718 0.245
NP_441111.1_7 Forward -330 -322 18.7023 0.00294
NP_441111.1_7 Reverse -323 -331 18.7023 0.00294
NP_441111.1_7 Reverse -50 -58 8.86921 0.0589
NP_442379.1_10 Forward -338 -321 -1.23946 0.223
NP_440244.1_1 Forward -110 -91 -9.53865 0.287
NP_441766.1_2 Forward -331 -322 17.5026 0.00297
NP_441766.1_2 Reverse -322 -331 17.5026 0.00297
NP_441766.1_2 Forward -58 -49 8.1612 0.0645
NP_440416.1_9 Reverse -189 -208 -7.76869 0.106
NP_440416.1_9 Forward -338 -319 -14.3569 0.176
NP_440416.1_9 Forward -240 -221 -17.9951 0.25
NP_440416.1_9 Reverse -162 -181 -20.0601 0.281
NP_443052.1_9 Reverse -95 -114 -5.9004 0.274
NP_442154.1_1 Forward -399 -381 -0.472507 0.114
NP_442154.1_1 Forward -207 -189 -11.8789 0.217
NP_442154.1_1 Forward -193 -175 -17.6804 0.262
NP_442154.1_1 Reverse -11 -29 -18.8604 0.286
NP_440261.1_5 Forward -330 -317 14.7689 0.0173
NP_440261.1_5 Reverse -323 -336 -12.3704 0.284
NP_440261.1_5 Forward -204 -191 -12.4687 0.297
NP_440261.1_5 Reverse -174 -187 -12.4687 0.297
NP_440988.1_5 Reverse -23 -42 14.9076 0.216
NP_440988.1_10 Reverse -200 -214 4.31795 0.266
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGATGTTGGCTGGGGTGGGTAGTAATATCTTGGATCTAGTTGTGAAACCAAATCCCAGCAAATCAATGGCGATCGCCCGAAAATTTTTTTTGATTAGGGGCAGTAGGCGACGAAACTCCAACACCGAACTGTCAAAGCCATGTATAAAAAGCATGGGTTCCCCCTGGCCTTCATCCATATAGTTGGTGTCCACGGTGATGGCACTGGGGTGGTCTGGGCCATGGATGGTTAGGGAAACTTGTTGCATTTGTCGCCAACATTCCCAGGAGGTTGCTTCAGTAAATGCCGGTGCGGGAAGGGTTAGGGAAGGAGTCATACTCAAATGGTGCTGGCTAAAAATGGCGATCGATAATTGGGGTTAGGAGAAATTGGCCTACCCAAAAACCCCTGGGGAAGCC

CDS

GTGGTAGGATTAGGCGAAAATAATCTCCCGACGAAAATTGGGGCGAAACTCACTATGGATTCAGGCAAAATCGTGGCCATTGTCACCGGTGCCATCTCAATTATTTTAGCTGTAGCGTATCTAGTTTTAGTACAAATTCTCGACTTTCGTGGCGAAATGGTGCCAGCGCCGATGGAAACCATGGGTCTGCTTACCCACATTACGGCGATCGCCAACGGCTCATTGTTGCCCTTTAGTTGA

Protein

MVGLGENNLPTKIGAKLTMDSGKIVAIVTGAISIILAVAYLVLVQILDFRGEMVPAPMETMGLLTHITAIANGSLLPFS