Your browser is old and dusty. Try Google Chrome!

Details for ssr2016

ORF ssr2016
Accession NP_440709.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Reverse -301 -308 12.9205 0.23
NP_441818.1_9 Reverse -53 -72 -1.96717 0.201
NP_441098.1_3 Reverse -106 -125 -7.5546 0.296
NP_443027.1_4 Reverse -258 -268 5.87989 0.294
NP_441438.1_1 Reverse -111 -130 8.06259 0.228
NP_442062.1_8 Reverse -198 -208 4.10993 0.232
NP_440304.1_4 Reverse -51 -61 4.60159 0.258
NP_441352.1_4 Forward -64 -45 10.6192 0.284
NP_441200.1_3 Reverse -359 -378 8.84924 0.259
NP_441594.1_6 Forward -255 -236 -0.000545616 0.294
NP_442196.1_10 Reverse -348 -367 10.5209 0.256
NP_440300.1_5 Forward -112 -94 12.6069 0.271
NP_440447.1_6 Reverse -45 -63 0.707465 0.282
NP_441713.1_1 Reverse -46 -65 -4.6221 0.113
NP_440178.1_7 Reverse -52 -71 -11.4069 0.0927
NP_440178.1_7 Reverse -374 -393 -21.7317 0.237
NP_442461.1_2 Reverse -196 -215 13.3725 0.267
NP_441025.1_6 Reverse -93 -112 10.342 0.15
NP_441327.1_1 Forward -136 -117 5.5589 0.252
NP_441624.1_7 Forward -365 -351 6.78443 0.275
NP_442145.1_4 Forward -110 -91 11.6973 0.132
NP_442145.1_4 Reverse -100 -119 7.49569 0.214
NP_440470.1_5 Reverse -104 -123 7.68668 0.271
NP_440470.1_5 Forward -124 -105 6.34979 0.279
NP_440842.1_4 Forward -140 -121 2.29163 0.23
NP_443017.1_1 Forward -129 -110 17.6806 0.147
NP_440376.1_1 Reverse -357 -366 0.589713 0.267
NP_440376.1_1 Reverse -52 -61 -0.0986038 0.285
NP_441422.1_7 Forward -254 -237 -8.81095 0.282
NP_442658.1_1 Reverse -51 -61 5.87944 0.246
NP_440184.1_7 Reverse -108 -127 15.3242 0.228
NP_441317.1_4 Reverse -145 -159 11.4693 0.252
NP_441317.1_4 Reverse -323 -337 9.46396 0.294
NP_440984.1_7 Reverse -182 -196 14.3559 0.0818
NP_440827.1_3 Forward -212 -193 18.6823 0.101
NP_443044.1_1 Forward -279 -260 3.34271 0.288
NP_442002.1_9 Reverse -24 -31 9.97054 0.246
NP_441712.1_3 Forward -224 -211 13.884 0.288
NP_440411.1_10 Forward -362 -343 9.18818 0.293
NP_441646.1_1 Reverse -380 -399 1.17943 0.235
NP_442438.1_10 Reverse -252 -266 4.91614 0.142
NP_440377.1_1 Forward -123 -106 15.4289 0.181
NP_440484.1_1 Forward -352 -333 14.8466 0.191
NP_441916.1_10 Forward -203 -184 10.2259 0.15
NP_442396.1_5 Reverse -183 -196 11.3273 0.0996
NP_441725.1_5 Forward -61 -51 5.19158 0.115
NP_441678.1_9 Reverse -375 -394 2.45773 0.223
NP_441079.1_7 Forward -123 -104 -6.78612 0.284
NP_440437.1_1 Forward -202 -183 -3.93378 0.248
NP_442500.1_9 Reverse -362 -381 17.5024 0.202
NP_442012.1_1 Reverse -192 -211 3.6377 0.179
NP_442012.1_5 Reverse -197 -216 -1.37718 0.296
NP_442049.1_4 Forward -353 -334 -3.3438 0.273
NP_441087.1_6 Forward -367 -349 1.19838 0.258
NP_441556.1_4 Reverse -342 -361 14.1506 0.171
NP_441556.1_7 Reverse -299 -318 2.26028 0.269
NP_441644.1_6 Forward -366 -356 9.41933 0.0767
NP_442215.1_2 Forward -209 -193 -7.11963 0.286
NP_442029.1_6 Reverse -330 -349 2.85105 0.286
NP_442167.1_1 Reverse -111 -130 14.8474 0.239
NP_441371.1_3 Forward -87 -69 6.60732 0.277
NP_440158.1_1 Forward -128 -109 15.899 0.0997
NP_441731.1_1 Reverse -131 -149 15.9491 0.264
NP_441826.1_2 Forward -366 -352 1.17956 0.161
NP_441330.1_1 Reverse -345 -364 -15.5368 0.285
NP_441764.1_1 Reverse -92 -111 17.7974 0.064
NP_441764.1_1 Reverse -113 -132 15.4374 0.0923
NP_441764.1_4 Reverse -90 -107 17.3345 0.0666
NP_441764.1_4 Reverse -111 -128 11.0321 0.232
NP_441764.1_8 Reverse -126 -136 16.0002 0.284
NP_443058.1_7 Forward -361 -342 2.85105 0.279
NP_440789.1_1 Forward -109 -90 14.4533 0.285
NP_441911.1_7 Forward -82 -63 -18.9791 0.261
NP_442630.1_1 Reverse -222 -241 10.6192 0.202
NP_441114.1_3 Forward -60 -51 7.57121 0.231
NP_440558.1_2 Forward -65 -46 8.55425 0.109
NP_440558.1_2 Reverse -49 -68 -6.58872 0.277
NP_440558.1_5 Reverse -208 -222 14.7492 0.282
NP_440923.1_1 Forward -110 -92 25.6827 0.000417
NP_440923.1_1 Forward -131 -113 11.5231 0.272
NP_441878.1_6 Reverse -52 -62 -6.70647 0.194
NP_442962.1_5 Reverse -255 -274 8.06259 0.242
NP_441739.1_2 Forward -270 -254 2.02449 0.288
NP_442347.1_5 Forward -101 -82 16.3215 0.152
NP_442594.1_8 Reverse -348 -367 3.83436 0.279
NP_442317.1_6 Reverse -48 -67 8.06259 0.216
NP_442998.1_10 Forward -205 -198 4.07068 0.276
NP_440899.1_5 Forward -376 -357 9.63589 0.231
NP_440299.1_1 Reverse -194 -207 6.21356 0.149
NP_440256.1_1 Reverse -49 -68 -2.36049 0.116
NP_440256.1_1 Reverse -347 -366 -5.21209 0.178
NP_443042.1_5 Reverse -108 -127 13.8831 0.219
NP_440709.1_1 Forward -132 -113 25.2696 0.0116
NP_440709.1_2 Forward -106 -92 23.5 0.000895
NP_440456.1_9 Reverse -300 -319 11.2092 0.145
NP_442866.1_1 Forward -365 -346 2.0644 0.158
NP_441199.1_7 Reverse -89 -108 2.45773 0.256
NP_442993.1_1 Reverse -357 -373 -14.1995 0.297
NP_442327.1_3 Reverse -104 -123 6.34979 0.261
NP_440586.1_1 Reverse -182 -201 -0.787193 0.237
NP_440027.1_4 Reverse -102 -121 6.82367 0.178
NP_439937.1_9 Forward -63 -46 -9.89323 0.215
NP_440770.1_3 Reverse -142 -156 14.9459 0.257
NP_442783.1_1 Forward -347 -328 10.2259 0.232
NP_441616.1_1 Forward -322 -303 3.24438 0.149
NP_442549.1_9 Reverse -324 -343 13.6675 0.299
NP_442384.1_10 Forward -61 -48 0.510939 0.289
NP_441877.1_9 Reverse -111 -128 14.4935 0.112
NP_441689.1_4 Reverse -120 -139 18.5728 0.0845
NP_440297.1_9 Forward -61 -51 4.10993 0.245
NP_442280.1_10 Forward -363 -345 12.7595 0.17
NP_442280.1_10 Reverse -188 -206 6.91543 0.268
NP_440894.1_10 Forward -371 -352 5.50599 0.229
NP_440937.1_5 Forward -366 -347 7.57094 0.295
NP_440999.1_2 Forward -309 -290 12.4875 0.191
NP_440888.1_2 Reverse -240 -254 8.06211 0.172
NP_440803.1_3 Reverse -374 -393 5.40766 0.238
NP_442454.1_5 Forward -52 -33 16.6165 0.125
NP_441268.1_5 Reverse -27 -41 19.4691 0.265
NP_442077.1_9 Reverse -68 -87 -2.85214 0.22
NP_441469.1_5 Reverse -197 -216 19.764 0.254
NP_441621.1_7 Forward -245 -231 -6.39192 0.29
NP_440936.1_10 Forward -46 -27 1.4797 0.241
NP_440519.1_3 Reverse -198 -217 9.14423 0.282
NP_442204.1_2 Reverse -241 -260 6.78429 0.287
NP_442780.1_1 Reverse -94 -113 6.78429 0.295
NP_440454.1_2 Forward -159 -145 16.8182 0.154
NP_440516.1_6 Forward -360 -346 7.86545 0.262
NP_440128.1_10 Reverse -349 -368 15.0441 0.227
NP_441867.1_3 Reverse -68 -87 4.42435 0.227
NP_440673.1_3 Forward -32 -25 9.08556 0.202
NP_441884.1_8 Reverse -197 -216 -12.9802 0.275
NP_440314.1_9 Forward -268 -249 -3.54046 0.186
NP_441004.1_4 Reverse -50 -60 16.1063 0.154
NP_441115.1_4 Forward -63 -45 11.0314 0.154
NP_443054.1_2 Forward -63 -49 6.19444 0.204
NP_441851.1_10 Reverse -186 -196 4.3066 0.277
NP_441501.1_6 Forward -369 -350 15.4374 0.27
NP_441396.1_5 Reverse -65 -74 7.37455 0.279
NP_442689.1_8 Reverse -108 -125 -3.69774 0.251
NP_439960.1_10 Reverse -191 -209 -1.94747 0.246
NP_440726.1_2 Reverse -347 -366 -0.787193 0.295
NP_441124.1_5 Reverse -111 -121 14.2496 0.215
NP_441124.1_5 Forward -127 -117 11.1938 0.259
NP_440431.1_3 Forward -63 -44 3.83436 0.0911
NP_440431.1_4 Reverse -91 -110 -9.59736 0.287
NP_441031.1_1 Forward -113 -94 8.75086 0.23
NP_441031.1_1 Reverse -108 -127 4.50898 0.288
NP_441031.1_5 Reverse -184 -203 5.60432 0.282
NP_440040.1_8 Forward -127 -108 5.87233 0.218
NP_441539.1_1 Reverse -113 -127 11.4053 0.285
NP_442348.1_2 Reverse -52 -61 11.8978 0.225
NP_441432.1_8 Reverse -52 -61 3.83464 0.243
NP_441432.1_9 Reverse -110 -123 9.76185 0.267
NP_441432.1_9 Forward -186 -173 8.50141 0.289
NP_441732.1_2 Forward -253 -237 -16.0677 0.164
NP_440629.1_4 Forward -73 -54 10.2259 0.238
NP_440757.1_8 Reverse -120 -132 17.8479 0.122
NP_442763.1_8 Reverse -235 -254 13.5691 0.0731
NP_441968.1_1 Reverse -31 -39 15.162 0.257
NP_442346.1_5 Reverse -52 -62 4.40493 0.29
NP_441629.1_3 Forward -253 -234 5.70185 0.214
NP_441923.1_8 Forward -386 -372 12.6843 0.286
NP_441329.1_1 Reverse -109 -128 10.265 0.194
NP_441329.1_3 Forward -129 -119 16.16 0.231
NP_441329.1_4 Forward -46 -28 15.6627 0.144
NP_440671.1_1 Reverse -111 -130 23.0707 0.0194
NP_440671.1_4 Reverse -351 -365 9.14437 0.184
NP_440875.1_9 Reverse -257 -267 9.73475 0.233
NP_440875.1_9 Forward -357 -347 8.5667 0.233
NP_442028.1_1 Forward -48 -35 6.65072 0.298
NP_440227.1_2 Reverse -115 -131 12.8416 0.271
NP_440227.1_10 Forward -85 -66 12.29 0.212
NP_442691.1_6 Forward -280 -261 22.4189 0.0813
NP_442568.1_8 Forward -67 -53 11.7993 0.257
NP_441892.1_1 Forward -252 -235 0.530496 0.167
NP_440665.1_1 Reverse -345 -364 -14.7502 0.264
NP_441508.1_1 Reverse -93 -112 19.1113 0.0922
NP_441508.1_1 Reverse -114 -133 14.4981 0.143
NP_440412.1_2 Reverse -57 -76 9.24257 0.281
NP_442041.1_5 Forward -365 -346 -0.885524 0.278
NP_441656.1_6 Forward -366 -347 9.0459 0.205
NP_440868.1_4 Forward -264 -252 -0.256015 0.255
NP_440402.1_9 Forward -324 -305 11.7992 0.262
NP_442402.1_10 Forward -79 -69 13.6475 0.2
NP_441848.1_4 Reverse -106 -122 8.50558 0.288
NP_440653.1_10 Forward -206 -187 7.47261 0.203
NP_440653.1_10 Forward -309 -290 2.26107 0.289
NP_440696.1_3 Reverse -188 -206 -0.275845 0.243
NP_442023.1_2 Forward -367 -348 6.88262 0.275
NP_441811.1_8 Forward -40 -26 9.5377 0.227
NP_442679.1_1 Reverse -23 -42 1.67108 0.171
NP_442837.1_3 Reverse -188 -195 6.43063 0.212
NP_440160.1_1 Reverse -88 -107 11.969 0.205
NP_440505.1_7 Reverse -180 -199 2.55606 0.235
NP_441408.2_7 Forward -209 -190 -1.47551 0.251
NP_441699.1_7 Forward -129 -110 7.86512 0.255
NP_440724.1_1 Forward -354 -335 9.43923 0.225
NP_442533.1_6 Forward -366 -357 9.34117 0.0634
NP_442533.1_6 Forward -61 -52 4.0313 0.194
NP_441697.1_5 Forward -123 -104 -2.62645 0.212
NP_441697.1_5 Reverse -106 -125 -11.1252 0.292
NP_441697.1_5 Reverse -105 -124 -11.6982 0.298
NP_441028.1_6 Forward -78 -68 10.0093 0.21
NP_441527.1_4 Reverse -26 -45 -12.1756 0.285
NP_440007.1_9 Reverse -347 -361 0.786239 0.29
NP_441972.1_5 Forward -206 -187 -6.09707 0.228
NP_441106.1_3 Forward -111 -92 20.2556 0.038
NP_441186.1_4 Forward -118 -108 16.1058 0.223
NP_441186.1_4 Forward -128 -118 15.6142 0.232
NP_442674.1_2 Reverse -84 -103 13.5691 0.208
NP_442382.1_9 Forward -178 -159 8.75009 0.281
NP_439899.1_1 Reverse -110 -128 20.4426 0.031
NP_439899.1_1 Reverse -89 -107 9.73552 0.165
NP_441753.1_10 Reverse -342 -361 7.17762 0.186
NP_441463.1_2 Reverse -108 -126 10.3661 0.138
NP_441463.1_3 Forward -72 -53 -7.4737 0.258
NP_440387.1_1 Reverse -198 -214 0.156866 0.131
NP_441431.1_2 Forward -65 -51 9.93039 0.172
NP_441431.1_2 Reverse -347 -361 9.14375 0.192
NP_441993.1_1 Forward -366 -347 0.484826 0.298
NP_440114.1_10 Reverse -52 -66 6.48943 0.269
NP_440293.1_3 Reverse -190 -209 -3.63879 0.251
NP_441421.1_6 Forward -127 -110 13.5165 0.219
NP_441237.1_9 Forward -61 -51 10.8948 0.214
NP_441237.1_9 Reverse -387 -397 10.3048 0.237
NP_440142.1_7 Forward -206 -187 9.0459 0.214
NP_441984.1_3 Reverse -340 -358 8.27895 0.232
NP_441275.1_1 Forward -110 -92 11.0322 0.0571
NP_440478.1_4 Reverse -347 -366 10.2259 0.29
NP_442341.1_7 Forward -367 -353 5.21113 0.165
NP_441173.1_9 Forward -77 -69 11.3271 0.226
NP_440686.1_1 Reverse -125 -144 5.40766 0.253
NP_442534.1_7 Forward -367 -348 8.16093 0.26
NP_440552.1_8 Forward -128 -111 19.055 0.0307
NP_440552.1_8 Forward -138 -121 14.5669 0.161
NP_440552.1_8 Forward -107 -90 9.79232 0.287
NP_443046.1_7 Forward -371 -352 12.4875 0.22
NP_443046.1_9 Forward -391 -373 1.88669 0.289
NP_439962.1_4 Forward -264 -245 -0.885524 0.204
NP_439962.1_4 Forward -367 -348 -6.49039 0.283
NP_440216.1_1 Reverse -187 -201 -12.6851 0.296
NP_440172.1_1 Reverse -53 -63 4.3066 0.194
NP_440046.1_5 Reverse -113 -132 10.0041 0.222
NP_440416.1_1 Forward -305 -286 -13.7669 0.283
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGTGCCCGATGCAGAGGATAAGCCCCAGTTTAGGCCCGTCACCATTGGCCTGGTATTGGATGACAAAACCCAAATTCTTAGGGGATTAGAGCCCAAGGAACGGGTATTCATCGATTTACCGGAAGACAGTCAAGATGCCCTCAATCCGCCGGAGGACTCCACCGAGTCGGACAATTGATCAAGCCAAACCGCATCTAACGCCAAGGGAGCCCCAACAGGCTCCTTTTTTATTGCGACCAGTAACGATAAAAAAACTCCTTGTCAACTTTGCTTTACAAAAATTTACAAAACTGTTACATTTATTTACATAAGGCAAAGAAAGTTTCCCCCATAAGGAAGCCAATGCCCCAGAAATAATTGTTTTTCTTGATTGCTCGTAGGAATTTAGGAGTCACTGCC

CDS

ATGTTCGCCCCCATCGTTATCTTGGTTCGTCAACAGTTAGGCAAAGCTAAGTTCAATCAGATCCGCGGTAAGGCGATTGCCCTCCACTGCCAGACCATCACCAACTTTTGTAACCGGGTGGGCATCGATGCCAAACAGCGCCAAAATTTAATCCGTTTAGCTAAGTCCAACGGCAAAACCCTCGGTTTATTGGCCTAA

Protein

MFAPIVILVRQQLGKAKFNQIRGKAIALHCQTITNFCNRVGIDAKQRQNLIRLAKSNGKTLGLLA