Your browser is old and dusty. Try Google Chrome!

Details for ssr1853

ORF ssr1853
Accession NP_439961.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -350 -364 6.58777 0.115
NP_441061.1_2 Forward -104 -90 1.08123 0.195
NP_440795.1_7 Forward -104 -97 14.6904 0.0123
NP_440795.1_7 Reverse -97 -104 14.6904 0.0123
NP_440795.1_7 Forward -357 -350 11.3472 0.0978
NP_442100.1_1 Reverse -262 -281 6.73176 0.281
NP_442100.1_4 Forward -261 -242 10.1267 0.278
NP_441418.1_6 Reverse -349 -368 -9.047 0.0273
NP_441418.1_6 Forward -105 -86 -19.0768 0.0844
NP_441418.1_6 Reverse -96 -115 -21.83 0.16
NP_440815.1_5 Forward -105 -86 7.96426 0.237
NP_442291.1_5 Reverse -95 -111 6.45005 0.0694
NP_441453.1_4 Reverse -96 -104 16.539 0.00633
NP_441453.1_4 Forward -105 -97 16.539 0.00633
NP_441453.1_4 Forward -358 -350 7.29591 0.0589
NP_441453.1_4 Reverse -349 -357 4.93597 0.224
NP_442151.1_6 Reverse -96 -110 14.4542 0.0349
NP_440259.1_4 Forward -179 -165 10.4676 0.262
NP_442623.1_7 Forward -162 -151 14.5133 0.286
NP_442173.1_1 Forward -104 -96 15.4574 0.00633
NP_442173.1_1 Reverse -97 -105 15.4574 0.00633
NP_442173.1_1 Reverse -350 -358 7.49257 0.171
NP_442173.1_1 Forward -357 -349 4.73931 0.258
NP_442752.1_4 Forward -105 -98 13.8055 0.0199
NP_442752.1_4 Reverse -96 -103 13.8055 0.0199
NP_443027.1_4 Forward -360 -350 12.5664 0.0683
NP_442975.1_10 Forward -109 -95 10.3237 0.056
NP_442975.1_10 Forward -139 -125 2.26061 0.28
NP_440784.1_7 Forward -104 -97 15.9687 0.0123
NP_440784.1_7 Reverse -97 -104 15.9687 0.0123
NP_440784.1_7 Reverse -350 -357 12.4288 0.0475
NP_440784.1_7 Forward -357 -350 6.23397 0.241
NP_442909.1_7 Reverse -97 -111 7.47213 0.215
NP_440061.1_9 Reverse -94 -108 14.0603 0.0735
NP_440061.1_9 Forward -377 -363 9.43874 0.145
NP_440061.1_9 Reverse -101 -115 8.55376 0.17
NP_440110.1_4 Reverse -85 -104 11.1109 0.104
NP_440110.1_8 Reverse -347 -366 -0.590531 0.225
NP_441054.1_2 Reverse -325 -344 14.0608 0.172
NP_439979.1_2 Reverse -349 -368 7.66927 0.26
NP_440878.1_9 Forward -122 -103 -1.57384 0.245
NP_442062.1_6 Reverse -123 -141 19.1937 0.0903
NP_442062.1_8 Reverse -96 -106 17.6796 0.00193
NP_442062.1_8 Forward -105 -95 17.3846 0.00193
NP_442062.1_8 Reverse -349 -359 6.27322 0.132
NP_442062.1_8 Forward -358 -348 4.99491 0.188
NP_441900.1_2 Forward -377 -359 8.57317 0.114
NP_440304.1_4 Forward -107 -97 9.91146 0.051
NP_440304.1_4 Reverse -94 -104 1.84832 0.299
NP_442242.1_4 Forward -104 -97 14.3954 0.0124
NP_442242.1_4 Reverse -97 -104 14.3954 0.0124
NP_440044.1_8 Forward -104 -85 2.16274 0.155
NP_440044.1_8 Forward -357 -338 -0.590531 0.224
NP_440044.1_8 Reverse -97 -116 -3.83545 0.292
NP_442762.1_10 Forward -124 -105 -11.8003 0.275
NP_439918.1_3 Reverse -81 -100 5.30933 0.264
NP_439918.1_3 Forward -90 -71 2.3594 0.295
NP_441935.1_1 Reverse -325 -344 5.01433 0.293
NP_440132.1_1 Forward -107 -89 10.1472 0.223
NP_440273.1_3 Forward -236 -217 8.35759 0.19
NP_440856.1_4 Forward -145 -126 -3.93378 0.243
NP_441083.1_5 Forward -105 -95 20.3345 0.00053
NP_441083.1_5 Reverse -96 -106 19.3512 0.000718
NP_441434.1_6 Reverse -17 -27 15.123 0.277
NP_441738.1_2 Forward -103 -96 15.28 0.0102
NP_441738.1_2 Reverse -98 -105 15.28 0.0102
NP_441558.1_5 Reverse -94 -113 4.22769 0.286
NP_441558.1_5 Forward -107 -88 3.93269 0.294
NP_441645.1_8 Reverse -362 -381 10.2259 0.298
NP_440209.1_1 Reverse -96 -104 18.1123 0.00295
NP_440209.1_1 Forward -105 -97 18.1123 0.00295
NP_442889.1_8 Forward -108 -94 10.8154 0.0775
NP_442889.1_8 Forward -316 -302 6.88214 0.171
NP_441713.1_1 Reverse -90 -109 -16.0285 0.275
NP_440178.1_7 Reverse -95 -114 -21.24 0.215
NP_440538.1_10 Reverse -94 -113 10.3242 0.279
NP_441716.1_1 Forward -105 -91 10.816 0.0936
NP_441327.1_1 Reverse -261 -280 9.97993 0.203
NP_442111.1_4 Reverse -95 -109 8.55439 0.0729
NP_442111.1_4 Forward -106 -92 7.86607 0.0849
NP_441163.1_1 Forward -113 -96 7.70792 0.238
NP_440906.1_5 Forward -104 -97 15.8704 0.0124
NP_440906.1_5 Reverse -97 -104 15.8704 0.0124
NP_440906.1_5 Forward -357 -350 6.23397 0.234
NP_440906.1_5 Reverse -350 -357 6.0373 0.262
NP_440747.1_10 Reverse -93 -105 24.7201 0.00036
NP_440747.1_10 Forward -108 -96 5.54551 0.0128
NP_441486.1_1 Reverse -346 -360 16.1259 0.00562
NP_441486.1_1 Reverse -93 -107 15.4376 0.00596
NP_441486.1_1 Forward -108 -94 14.8476 0.00628
NP_441486.1_1 Forward -361 -347 -5.21195 0.226
NP_441880.2_10 Reverse -97 -115 10.5406 0.197
NP_442634.1_3 Reverse -85 -104 13.9616 0.166
NP_442634.1_4 Forward -107 -93 -2.85201 0.156
NP_440470.1_5 Forward -281 -262 10.1695 0.204
NP_440057.1_9 Forward -343 -324 17.699 0.163
NP_441014.1_5 Reverse -199 -217 9.0656 0.287
NP_441014.1_10 Reverse -348 -367 8.25844 0.136
NP_441014.1_10 Reverse -303 -322 4.32522 0.197
NP_442848.1_1 Reverse -90 -104 -2.75368 0.263
NP_442848.1_5 Reverse -96 -114 -3.81576 0.299
NP_442848.1_9 Reverse -97 -116 2.65439 0.248
NP_441012.1_4 Reverse -112 -125 7.78743 0.272
NP_443018.1_3 Forward -104 -97 14.8871 0.0123
NP_443018.1_3 Reverse -97 -104 14.8871 0.0123
NP_443018.1_3 Forward -357 -350 13.8055 0.024
NP_443018.1_3 Reverse -350 -357 13.6088 0.0352
NP_441634.1_8 Reverse -202 -216 -2.85201 0.295
NP_441634.1_8 Reverse -94 -108 -3.93365 0.295
NP_440376.1_1 Forward -105 -96 19.4693 0.000692
NP_440376.1_1 Reverse -96 -105 19.4693 0.000692
NP_440376.1_1 Forward -213 -204 2.94966 0.213
NP_441588.1_4 Forward -103 -93 9.02648 0.14
NP_442687.1_7 Forward -106 -96 18.5646 0.0028
NP_442687.1_7 Reverse -95 -105 8.92815 0.0994
NP_442687.1_7 Reverse -115 -125 4.89658 0.23
NP_441077.1_6 Forward -49 -33 6.56173 0.239
NP_442485.1_3 Forward -369 -350 0.196116 0.247
NP_441013.1_2 Forward -130 -112 11.0322 0.163
NP_440360.1_5 Forward -376 -357 -4.22878 0.297
NP_442658.1_1 Forward -107 -97 14.8275 0.0188
NP_442658.1_1 Forward -360 -350 14.1392 0.0252
NP_442658.1_1 Reverse -94 -104 6.76441 0.214
NP_442198.1_7 Reverse -207 -226 11.2084 0.209
NP_442496.1_5 Reverse -169 -187 7.29564 0.256
NP_442205.1_9 Forward -111 -95 -1.51476 0.264
NP_441414.1_9 Forward -105 -86 5.11266 0.0483
NP_440184.1_5 Forward -223 -204 11.7008 0.143
NP_441487.1_9 Reverse -95 -114 7.17762 0.119
NP_442300.1_5 Forward -107 -88 14.4541 0.282
NP_439959.1_6 Reverse -117 -136 26.0572 0.00285
NP_441958.1_5 Forward -106 -96 20.5312 0.000966
NP_441958.1_5 Reverse -95 -105 12.2714 0.00183
NP_442836.1_5 Forward -111 -92 5.60432 0.185
NP_440203.1_5 Forward -102 -92 10.5993 0.218
NP_440995.1_8 Reverse -339 -358 2.26107 0.264
NP_440984.1_7 Forward -110 -96 17.3058 0.0267
NP_441377.1_4 Reverse -247 -264 20.885 0.0219
NP_442376.1_2 Reverse -361 -380 -13.4719 0.296
NP_442690.1_1 Forward -281 -262 9.14423 0.0437
NP_442690.1_1 Forward -41 -22 -17.3068 0.299
NP_442911.1_2 Reverse -86 -105 0.58944 0.0657
NP_440153.1_5 Reverse -97 -111 5.80112 0.191
NP_443055.1_6 Reverse -96 -114 6.01657 0.172
NP_440827.1_3 Reverse -365 -384 13.1758 0.226
NP_441129.1_8 Forward -226 -207 8.55425 0.296
NP_441099.1_5 Reverse -86 -105 -2.85214 0.127
NP_442002.1_9 Forward -106 -99 14.1004 0.074
NP_442002.1_9 Forward -314 -307 9.08556 0.289
NP_441294.1_7 Forward -109 -95 19.7134 0.00264
NP_441294.1_7 Forward -317 -303 11.0744 0.157
NP_441646.1_1 Reverse -89 -108 -0.295539 0.26
NP_442438.1_10 Reverse -91 -105 3.8345 0.156
NP_441000.1_6 Forward -106 -92 -3.93365 0.225
NP_441000.1_6 Reverse -95 -109 -5.40861 0.275
NP_440147.1_4 Forward -107 -94 13.294 0.0326
NP_440147.1_4 Reverse -94 -107 11.7207 0.0326
NP_441175.1_7 Forward -105 -86 12.8808 0.113
NP_441550.1_8 Forward -107 -97 17.6791 0.00754
NP_441550.1_8 Reverse -94 -104 14.6309 0.0132
NP_441550.1_8 Reverse -347 -357 8.23937 0.127
NP_441916.1_7 Reverse -96 -106 16.893 0.00407
NP_441916.1_7 Forward -105 -95 10.3048 0.0261
NP_441916.1_10 Reverse -88 -107 2.65439 0.243
NP_441041.1_4 Forward -105 -86 -0.295539 0.0941
NP_441041.1_7 Forward -108 -96 11.9849 0.0689
NP_441041.1_7 Reverse -93 -105 8.58373 0.133
NP_442396.1_5 Reverse -92 -105 10.639 0.106
NP_442004.1_6 Forward -105 -91 5.30946 0.191
NP_442004.1_6 Reverse -343 -357 1.37622 0.29
NP_441725.1_5 Reverse -97 -107 11.7798 0.0247
NP_441725.1_5 Forward -104 -94 2.04498 0.115
NP_441725.1_5 Reverse -350 -360 -0.314959 0.246
NP_439966.1_7 Reverse -94 -104 7.25606 0.15
NP_442941.1_3 Forward -104 -94 11.0914 0.0116
NP_442941.1_3 Reverse -97 -107 2.53664 0.14
NP_442941.1_3 Reverse -350 -360 -0.904945 0.274
NP_440289.1_2 Forward -108 -95 4.44418 0.0668
NP_440289.1_2 Reverse -93 -106 -2.144 0.251
NP_441076.1_3 Reverse -29 -48 17.0099 0.148
NP_440260.1_8 Reverse -87 -105 4.24738 0.154
NP_442281.1_1 Forward -363 -349 16.3219 0.00832
NP_442281.1_1 Forward -110 -96 12.782 0.034
NP_442281.1_1 Reverse -91 -105 10.3237 0.0595
NP_442281.1_1 Forward -318 -304 2.8506 0.253
NP_441079.1_3 Reverse -136 -155 12.3892 0.215
NP_442575.1_8 Forward -124 -105 1.86774 0.196
NP_442256.1_2 Forward -107 -89 -6.37237 0.214
NP_442256.1_2 Reverse -94 -112 -7.15901 0.214
NP_442500.1_8 Forward -344 -330 9.0215 0.285
NP_442012.1_1 Reverse -90 -109 20.1573 0.0318
NP_440723.1_8 Forward -119 -105 19.4691 0.117
NP_440498.1_1 Forward -114 -96 5.52568 0.102
NP_440375.1_8 Forward -104 -85 -0.39387 0.266
NP_441644.1_6 Forward -105 -95 17.3841 0.00127
NP_441644.1_6 Reverse -96 -106 15.7125 0.0048
NP_441644.1_6 Forward -358 -348 10.8943 0.0592
NP_443049.1_5 Forward -342 -323 11.2092 0.185
NP_440867.1_10 Forward -120 -101 2.65439 0.283
NP_442215.1_2 Reverse -94 -110 10.1866 0.0509
NP_442215.1_2 Forward -134 -118 5.76173 0.0769
NP_442215.1_2 Reverse -101 -117 4.87675 0.0815
NP_442215.1_2 Forward -107 -91 4.18844 0.0866
NP_442215.1_2 Reverse -229 -245 -2.98973 0.207
NP_442215.1_2 Reverse -347 -363 -6.62797 0.277
NP_442215.1_2 Reverse -25 -41 -7.31629 0.291
NP_440253.1_2 Forward -105 -87 -1.84914 0.252
NP_440929.1_8 Forward -105 -96 19.2726 0.000701
NP_440929.1_8 Reverse -96 -105 19.2726 0.000701
NP_442933.1_10 Forward -105 -96 17.601 0.00325
NP_442933.1_10 Reverse -96 -105 17.601 0.00325
NP_442933.1_10 Forward -358 -349 5.70292 0.165
NP_440576.1_9 Reverse -210 -229 20.2548 0.128
NP_441751.2_8 Forward -104 -90 8.65272 0.0325
NP_442554.1_8 Forward -104 -94 15.3197 0.00882
NP_442554.1_8 Reverse -97 -107 14.238 0.0144
NP_442554.1_8 Forward -357 -347 10.8948 0.0424
NP_442554.1_8 Forward -124 -114 3.22496 0.235
NP_442554.1_8 Reverse -350 -360 3.12662 0.239
NP_441762.1_7 Forward -106 -94 8.9871 0.0142
NP_441762.1_7 Reverse -95 -107 0.333971 0.0747
NP_441762.1_7 Forward -359 -347 -5.76255 0.238
NP_442142.1_4 Forward -331 -318 5.82024 0.182
NP_442142.1_4 Reverse -93 -106 5.52525 0.188
NP_442142.1_4 Reverse -113 -126 2.96866 0.269
NP_442142.1_4 Forward -108 -95 2.772 0.278
NP_442292.1_1 Forward -104 -95 18.486 0.00229
NP_442292.1_1 Reverse -97 -106 9.53783 0.0183
NP_442292.1_1 Forward -357 -348 8.1612 0.0478
NP_443009.1_5 Reverse -95 -106 15.7911 0.0107
NP_443009.1_5 Forward -106 -95 11.1696 0.066
NP_443009.1_5 Reverse -348 -359 5.56471 0.197
NP_443009.1_5 Reverse -204 -215 4.18809 0.259
NP_442301.1_2 Forward -377 -358 4.03023 0.284
NP_442408.2_1 Reverse -96 -115 -2.85214 0.241
NP_441715.1_4 Forward -104 -94 7.94484 0.107
NP_441715.1_4 Reverse -350 -360 5.19158 0.224
NP_440357.1_3 Forward -107 -88 0.196116 0.285
NP_440183.1_9 Forward -123 -104 -17.0118 0.276
NP_441198.1_8 Forward -107 -97 12.5877 0.12
NP_441198.1_8 Forward -387 -377 10.1462 0.296
NP_440464.1_10 Forward -104 -94 13.0082 0.169
NP_441468.1_1 Forward -104 -97 15.8704 0.0124
NP_441468.1_1 Reverse -97 -104 15.8704 0.0124
NP_441468.1_1 Forward -357 -350 13.8055 0.0242
NP_441468.1_1 Reverse -350 -357 6.0373 0.223
NP_441020.2_6 Forward -107 -90 11.1502 0.127
NP_441015.1_10 Reverse -117 -136 -7.67036 0.27
NP_441673.1_1 Forward -105 -96 20.8459 0.000698
NP_441673.1_1 Reverse -96 -105 20.8459 0.000698
NP_441876.1_9 Forward -133 -123 12.1726 0.267
NP_441826.1_2 Forward -111 -97 4.52282 0.102
NP_441826.1_2 Reverse -90 -104 2.35953 0.129
NP_441826.1_2 Reverse -110 -124 -3.93365 0.29
NP_441637.1_9 Reverse -57 -75 -2.53746 0.292
NP_442868.1_6 Reverse -94 -104 9.81313 0.038
NP_442868.1_6 Forward -107 -97 9.12481 0.0539
NP_441612.1_2 Forward -105 -95 8.54929 0.21
NP_442808.1_1 Forward -106 -96 8.73102 0.0481
NP_442808.1_1 Reverse -95 -105 8.63269 0.0481
NP_440871.1_2 Reverse -75 -94 13.1758 0.267
NP_440145.1_3 Reverse -86 -105 7.57094 0.0466
NP_442050.1_5 Reverse -94 -104 7.64939 0.243
NP_442050.1_5 Forward -107 -97 6.96107 0.27
NP_442789.1_4 Reverse -82 -101 -7.27704 0.292
NP_441878.1_6 Forward -106 -96 20.2362 0.0046
NP_441878.1_6 Reverse -95 -105 10.4031 0.0176
NP_441878.1_6 Reverse -115 -125 0.57002 0.14
NP_441878.1_6 Forward -113 -103 -6.50981 0.191
NP_441036.1_8 Forward -106 -96 8.4365 0.174
NP_441036.1_8 Reverse -95 -105 8.33817 0.174
NP_441534.1_5 Reverse -253 -272 0.196116 0.293
NP_441557.1_5 Forward -105 -96 19.9609 0.000699
NP_441557.1_5 Reverse -96 -105 19.9609 0.000699
NP_441557.1_5 Reverse -349 -358 6.29291 0.0666
NP_441445.1_1 Forward -114 -95 3.93269 0.204
NP_441445.1_1 Reverse -49 -68 3.34271 0.215
NP_441445.1_1 Reverse -87 -106 2.45773 0.233
NP_441458.1_10 Forward -367 -348 3.24438 0.252
NP_442166.1_3 Reverse -125 -144 -11.1119 0.279
NP_442166.1_7 Reverse -211 -225 12.8809 0.175
NP_442347.1_2 Forward -104 -95 12.4878 0.056
NP_442347.1_2 Reverse -305 -314 3.34298 0.284
NP_442347.1_2 Reverse -97 -106 3.34298 0.284
NP_442645.1_2 Reverse -88 -107 -3.63879 0.0496
NP_442645.1_2 Forward -113 -94 -14.4552 0.175
NP_442645.1_2 Reverse -296 -315 -16.9135 0.245
NP_441037.1_4 Forward -107 -97 17.3558 0.0127
NP_441037.1_4 Reverse -94 -104 7.9999 0.237
NP_442594.1_7 Forward -116 -97 3.73524 0.297
NP_442508.1_8 Forward -226 -209 10.2653 0.272
NP_441633.1_3 Reverse -94 -107 10.639 0.0286
NP_441633.1_3 Forward -107 -94 -5.97891 0.236
NP_442764.1_8 Forward -85 -66 6.19431 0.235
NP_440136.1_2 Forward -104 -97 15.9687 0.0123
NP_440136.1_2 Reverse -97 -104 15.9687 0.0123
NP_440136.1_2 Forward -357 -350 6.52896 0.116
NP_440136.1_2 Reverse -350 -357 6.13563 0.193
NP_442590.1_10 Reverse -96 -115 8.25926 0.212
NP_442590.1_10 Reverse -198 -217 4.42435 0.276
NP_442590.1_10 Forward -125 -106 3.93269 0.283
NP_442590.1_10 Reverse -322 -341 3.6377 0.289
NP_442998.1_5 Reverse -257 -267 12.3697 0.174
NP_442998.1_10 Forward -103 -96 15.5754 0.0102
NP_442998.1_10 Reverse -98 -105 15.5754 0.0102
NP_440299.1_1 Reverse -92 -105 18.6032 0.00369
NP_440299.1_1 Reverse -345 -358 13.5883 0.0298
NP_440299.1_1 Forward -109 -96 7.09854 0.121
NP_440299.1_1 Reverse -112 -125 2.47701 0.288
NP_441799.1_1 Forward -109 -95 18.2885 0.00852
NP_441799.1_1 Reverse -345 -359 11.5037 0.0575
NP_441799.1_1 Reverse -92 -106 10.1271 0.0797
NP_441007.1_10 Forward -110 -97 -0.275709 0.273
NP_441007.1_10 Reverse -91 -104 -0.865694 0.295
NP_442334.1_2 Reverse -140 -157 -7.63097 0.297
NP_442201.1_10 Forward -116 -97 -5.50708 0.165
NP_442333.2_5 Forward -369 -350 -14.0619 0.271
NP_440256.1_1 Reverse -346 -365 -5.31042 0.18
NP_440256.1_1 Reverse -93 -112 -9.047 0.273
NP_440087.1_1 Forward -114 -95 -5.40875 0.249
NP_442007.1_8 Reverse -95 -113 8.57317 0.297
NP_441559.1_8 Forward -380 -366 1.96621 0.151
NP_441559.1_8 Forward -130 -116 -7.57189 0.295
NP_440525.1_10 Forward -345 -326 12.1925 0.0835
NP_440915.1_6 Reverse -92 -106 8.75105 0.0507
NP_440915.1_6 Forward -223 -209 -1.67204 0.243
NP_440915.1_6 Forward -129 -115 -1.8687 0.251
NP_440915.1_6 Reverse -362 -376 -2.75368 0.28
NP_441179.1_9 Forward -127 -117 16.3025 0.236
NP_441704.1_8 Forward -363 -344 14.6499 0.096
NP_440748.1_5 Forward -317 -298 -3.44213 0.297
NP_440537.1_4 Reverse -348 -367 22.7139 0.0165
NP_441464.1_8 Reverse -96 -110 9.73436 0.189
NP_439985.1_7 Forward -111 -92 3.83436 0.26
NP_442993.1_1 Forward -156 -140 -0.629782 0.0783
NP_442993.1_1 Reverse -96 -112 -7.11963 0.146
NP_442386.1_9 Forward -359 -350 14.6506 0.0289
NP_442386.1_9 Reverse -95 -104 13.8639 0.0289
NP_442386.1_9 Reverse -348 -357 11.1107 0.103
NP_442386.1_9 Forward -106 -97 6.39082 0.219
NP_441340.1_5 Forward -104 -97 15.6737 0.0124
NP_441340.1_5 Reverse -97 -104 15.6737 0.0124
NP_441340.1_5 Reverse -350 -357 13.5105 0.0314
NP_441340.1_5 Forward -357 -350 6.23397 0.132
NP_441340.1_9 Reverse -268 -278 8.83366 0.256
NP_441271.1_3 Reverse -202 -220 14.768 0.143
NP_441947.1_3 Reverse -171 -189 17.3254 0.172
NP_441297.1_8 Reverse -330 -348 10.5398 0.252
NP_440161.1_3 Reverse -131 -150 10.8159 0.225
NP_441134.1_6 Forward -370 -352 6.90155 0.276
NP_440586.1_8 Forward -104 -97 13.2151 0.026
NP_440586.1_8 Reverse -97 -104 13.2151 0.026
NP_440586.1_8 Reverse -350 -357 11.3468 0.0736
NP_440586.1_8 Forward -357 -350 9.47853 0.146
NP_440586.1_8 Reverse -117 -124 5.8403 0.283
NP_440586.1_9 Reverse -360 -379 7.07928 0.273
NP_442251.1_6 Forward -104 -97 15.2804 0.0124
NP_442251.1_6 Reverse -97 -104 15.2804 0.0124
NP_440192.1_5 Reverse -348 -367 10.1275 0.176
NP_440684.1_9 Forward -111 -97 9.14437 0.221
NP_440684.1_9 Reverse -90 -104 6.98109 0.283
NP_441262.1_3 Reverse -96 -103 14.7888 0.0223
NP_441262.1_3 Forward -105 -98 14.7888 0.0223
NP_440027.1_3 Forward -368 -350 8.3765 0.193
NP_440027.1_3 Reverse -96 -114 4.63995 0.255
NP_440027.1_8 Forward -128 -109 5.2102 0.282
NP_443051.1_1 Forward -106 -97 18.0926 0.00402
NP_443051.1_1 Reverse -95 -104 10.4228 0.00754
NP_439996.1_6 Reverse -348 -367 12.675 0.169
NP_439984.1_1 Forward -281 -262 9.42666 0.292
NP_439984.1_10 Forward -369 -355 11.1104 0.253
NP_441595.1_5 Forward -112 -94 8.27895 0.222
NP_441740.2_10 Reverse -343 -362 6.58763 0.286
NP_440408.1_7 Forward -125 -106 14.4541 0.165
NP_440439.1_1 Reverse -93 -106 2.2809 0.136
NP_442239.1_8 Forward -118 -99 6.58763 0.263
NP_440372.1_2 Forward -104 -97 16.3621 0.0124
NP_440372.1_2 Reverse -97 -104 16.3621 0.0124
NP_440372.1_2 Forward -357 -350 6.62729 0.151
NP_440372.1_2 Reverse -350 -357 6.52896 0.188
NP_440574.1_7 Reverse -326 -345 10.6192 0.283
NP_440316.1_10 Forward -113 -103 6.46988 0.257
NP_441803.1_2 Reverse -91 -110 1.47442 0.23
NP_441803.1_2 Forward -98 -79 -0.295539 0.272
NP_440139.1_1 Forward -111 -92 6.78348 0.139
NP_440210.1_9 Reverse -266 -285 10.2683 0.245
NP_441572.1_7 Forward -364 -345 2.85105 0.125
NP_441572.1_7 Forward -111 -92 -0.39387 0.18
NP_441572.1_7 Forward -118 -99 -3.24547 0.208
NP_442384.1_10 Forward -105 -92 16.4406 0.00838
NP_442384.1_10 Reverse -96 -109 10.639 0.0428
NP_442384.1_10 Forward -358 -345 7.00078 0.0899
NP_442384.1_10 Forward -125 -112 6.90245 0.092
NP_442114.1_8 Forward -351 -337 9.6354 0.234
NP_441018.1_7 Reverse -345 -364 6.19431 0.297
NP_442262.1_10 Forward -104 -97 14.1988 0.0123
NP_442262.1_10 Reverse -97 -104 14.1988 0.0123
NP_442262.1_10 Forward -357 -350 13.0188 0.0314
NP_442262.1_10 Reverse -350 -357 11.6422 0.092
NP_441689.1_5 Reverse -94 -104 5.78111 0.197
NP_440163.1_10 Forward -361 -351 14.4347 0.102
NP_440344.1_10 Forward -365 -348 -10.7776 0.19
NP_440531.1_6 Forward -366 -347 2.26107 0.16
NP_440531.1_6 Forward -205 -186 0.392778 0.193
NP_440531.1_6 Forward -113 -94 -3.73712 0.27
NP_442910.1_1 Reverse -89 -108 13.8641 0.0484
NP_442910.1_1 Forward -381 -362 -8.16202 0.285
NP_441335.1_8 Reverse -324 -343 13.7658 0.175
NP_440562.1_10 Reverse -87 -105 6.41066 0.284
NP_441965.1_10 Forward -108 -92 3.40179 0.265
NP_440297.1_9 Reverse -97 -107 9.61647 0.0917
NP_440297.1_9 Reverse -350 -360 1.06167 0.282
NP_440297.1_9 Forward -357 -347 -0.118297 0.282
NP_440297.1_9 Forward -124 -114 -0.118297 0.282
NP_440297.1_9 Forward -104 -94 -0.118297 0.282
NP_441592.1_4 Forward -105 -86 3.14605 0.185
NP_440999.1_2 Reverse -73 -92 14.8474 0.163
NP_440888.1_2 Forward -105 -91 7.27547 0.202
NP_440888.1_2 Forward -213 -199 7.17714 0.205
NP_442147.1_7 Forward -114 -95 11.3075 0.233
NP_440052.1_4 Reverse -194 -213 10.3242 0.239
NP_442077.1_9 Forward -34 -15 -6.58872 0.29
NP_441543.1_2 Forward -104 -95 16.9127 0.00359
NP_441543.1_2 Reverse -350 -359 13.1761 0.0284
NP_441543.1_2 Reverse -97 -106 9.34117 0.0818
NP_441543.1_5 Reverse -105 -124 -2.26216 0.245
NP_442845.1_2 Forward -111 -97 5.40779 0.233
NP_442845.1_2 Reverse -90 -104 4.91614 0.249
NP_441178.1_6 Forward -128 -109 7.4718 0.26
NP_441178.1_6 Reverse -101 -120 5.30853 0.268
NP_441918.1_7 Forward -106 -87 0.786102 0.288
NP_440982.1_1 Reverse -104 -123 5.50519 0.294
NP_441469.1_8 Forward -106 -97 13.3727 0.073
NP_441469.1_8 Forward -359 -350 6.8829 0.227
NP_441469.1_8 Reverse -95 -104 6.48957 0.227
NP_441469.1_8 Reverse -348 -357 5.60459 0.258
NP_443064.1_6 Reverse -96 -106 13.8273 0.0796
NP_443064.1_6 Forward -105 -95 12.5669 0.0796
NP_443064.1_6 Forward -375 -365 10.7247 0.136
NP_442337.1_8 Reverse -338 -357 10.5209 0.152
NP_441306.1_10 Reverse -212 -226 11.4053 0.263
NP_442578.1_7 Forward -104 -97 14.5921 0.026
NP_442578.1_7 Reverse -97 -104 14.5921 0.026
NP_440710.1_1 Reverse -88 -106 -9.32229 0.297
NP_441462.1_2 Reverse -96 -106 20.1379 0.000967
NP_441462.1_2 Forward -105 -95 11.5831 0.00406
NP_441621.1_7 Forward -107 -93 -4.81863 0.246
NP_443062.1_1 Reverse -349 -367 7.76586 0.168
NP_443062.1_1 Reverse -293 -311 5.71821 0.22
NP_443062.1_1 Forward -105 -87 4.54812 0.258
NP_443062.1_6 Reverse -88 -107 9.43923 0.126
NP_441601.1_4 Forward -129 -110 6.78429 0.162
NP_440889.1_2 Forward -358 -339 12.9791 0.151
NP_442204.1_1 Reverse -112 -123 2.81194 0.266
NP_442204.1_1 Forward -362 -351 0.94365 0.281
NP_440516.1_8 Forward -105 -96 16.9127 0.00442
NP_440516.1_8 Reverse -96 -105 16.9127 0.00442
NP_442080.1_8 Reverse -350 -369 19.9606 0.015
NP_442428.1_5 Forward -104 -97 15.8704 0.0124
NP_442428.1_5 Reverse -97 -104 15.8704 0.0124
NP_442428.1_5 Forward -357 -350 14.1988 0.0242
NP_442428.1_5 Reverse -350 -357 6.0373 0.212
NP_441267.1_1 Reverse -90 -109 4.71934 0.227
NP_441867.1_2 Forward -122 -103 -14.5535 0.288
NP_440673.1_3 Reverse -351 -358 13.2155 0.0426
NP_440673.1_3 Forward -103 -96 12.4288 0.0426
NP_440673.1_3 Reverse -98 -105 12.4288 0.0426
NP_440673.1_3 Reverse -306 -313 7.51227 0.252
NP_441052.1_2 Forward -105 -95 19.9412 0.00106
NP_441052.1_2 Reverse -96 -106 10.4031 0.0285
NP_441052.1_2 Reverse -150 -160 -0.118297 0.266
NP_442219.1_9 Forward -104 -95 17.7976 0.00718
NP_442219.1_9 Reverse -97 -106 8.25953 0.0681
NP_440592.1_2 Forward -325 -306 -0.4922 0.271
NP_440436.1_4 Forward -104 -95 17.2072 0.00233
NP_440436.1_4 Reverse -97 -106 15.9289 0.00508
NP_440436.1_4 Reverse -350 -359 13.9623 0.0193
NP_441884.1_8 Reverse -348 -367 -13.0786 0.276
NP_441884.1_9 Forward -108 -89 -24.8783 0.29
NP_442086.1_3 Forward -104 -85 6.58763 0.285
NP_442864.1_3 Forward -166 -147 11.2092 0.181
NP_440314.1_9 Reverse -97 -116 10.2259 0.0289
NP_442577.1_1 Reverse -333 -352 -3.24547 0.292
NP_441719.1_4 Forward -104 -97 16.3621 0.0124
NP_441719.1_4 Reverse -97 -104 16.3621 0.0124
NP_441719.1_4 Forward -357 -350 6.62729 0.151
NP_441719.1_4 Reverse -350 -357 6.52896 0.188
NP_441733.1_10 Reverse -93 -106 5.62415 0.21
NP_441733.1_10 Forward -217 -204 3.5592 0.295
NP_441004.1_1 Reverse -110 -129 -5.50708 0.176
NP_441004.1_1 Forward -118 -99 -14.2585 0.265
NP_442813.1_4 Reverse -347 -366 -6.88371 0.299
NP_442366.1_3 Reverse -115 -133 3.06741 0.117
NP_442366.1_3 Forward -106 -88 1.78911 0.141
NP_442366.1_3 Reverse -51 -69 0.117479 0.178
NP_442366.1_5 Forward -108 -98 17.2858 0.0141
NP_442366.1_5 Reverse -93 -103 14.0409 0.0497
NP_442366.1_5 Reverse -386 -396 10.6976 0.245
NP_442366.1_5 Reverse -202 -212 10.6976 0.245
NP_440129.1_10 Forward -365 -351 4.03116 0.185
NP_441115.1_4 Forward -359 -341 7.78652 0.272
NP_442206.1_4 Reverse -97 -116 6.68596 0.259
NP_442206.1_10 Forward -105 -90 6.27308 0.178
NP_442206.1_10 Reverse -349 -364 3.71647 0.181
NP_440328.1_4 Forward -111 -92 6.98095 0.126
NP_440328.1_4 Reverse -90 -109 -1.18052 0.299
NP_443054.1_2 Forward -114 -100 2.16287 0.245
NP_443054.1_2 Reverse -94 -108 -0.590395 0.299
NP_442308.1_4 Reverse -90 -109 2.16274 0.267
NP_440864.1_9 Reverse -372 -391 0.687771 0.139
NP_441851.1_7 Reverse -328 -347 4.916 0.292
NP_441851.1_10 Forward -106 -96 17.4829 0.0027
NP_441851.1_10 Reverse -95 -105 15.8113 0.00552
NP_441851.1_10 Reverse -364 -374 9.91146 0.109
NP_441851.1_10 Reverse -348 -358 5.5849 0.207
NP_441851.1_10 Forward -359 -349 5.09324 0.227
NP_441851.1_10 Reverse -204 -214 4.79825 0.247
NP_442814.1_2 Reverse -343 -362 3.93269 0.299
NP_442622.1_8 Reverse -96 -114 -18.8604 0.285
NP_442011.1_1 Reverse -95 -114 10.4225 0.16
NP_442856.1_7 Forward -114 -95 1.27776 0.172
NP_441668.1_4 Forward -250 -231 -2.45882 0.288
NP_442515.1_1 Reverse -95 -109 12.6843 0.0333
NP_442515.1_1 Forward -68 -54 -3.83532 0.298
NP_442515.1_1 Forward -106 -92 -5.01529 0.298
NP_441396.1_5 Reverse -199 -208 9.24284 0.21
NP_441396.1_5 Reverse -359 -368 8.65285 0.21
NP_442689.1_8 Forward -277 -260 5.54538 0.155
NP_440940.1_7 Forward -368 -350 3.65664 0.274
NP_441349.1_10 Forward -115 -96 -1.08219 0.0988
NP_441349.1_10 Reverse -86 -105 -5.70374 0.21
NP_442314.1_4 Forward -118 -100 8.57394 0.267
NP_442843.1_1 Forward -124 -105 -10.9153 0.282
NP_442843.1_1 Reverse -359 -378 -11.7019 0.291
NP_439960.1_4 Reverse -109 -128 17.6982 0.125
NP_439960.1_4 Reverse -348 -367 16.3215 0.153
NP_442450.1_5 Forward -107 -97 17.3846 0.0267
NP_442450.1_5 Reverse -94 -104 7.55152 0.13
NP_440588.1_2 Reverse -87 -106 -0.197208 0.15
NP_440588.1_2 Reverse -340 -359 -4.6221 0.223
NP_440588.1_2 Forward -114 -95 -5.9004 0.264
NP_440588.1_2 Forward -134 -115 -6.68705 0.289
NP_440195.1_5 Forward -111 -92 2.55606 0.276
NP_442006.1_2 Forward -114 -97 -16.7758 0.264
NP_441003.1_9 Forward -128 -109 9.93088 0.213
NP_441570.1_1 Reverse -349 -367 -7.35568 0.0887
NP_441570.1_1 Forward -105 -87 -8.83064 0.122
NP_441078.1_4 Forward -105 -96 19.6659 0.0007
NP_441078.1_4 Reverse -96 -105 19.6659 0.0007
NP_441078.1_4 Forward -358 -349 -2.06522 0.295
NP_442729.1_5 Reverse -115 -125 8.4365 0.248
NP_442443.1_1 Forward -120 -101 -6.1954 0.293
NP_440526.1_3 Forward -104 -93 8.02298 0.126
NP_440526.1_3 Reverse -97 -108 1.6315 0.267
NP_441432.1_8 Reverse -95 -104 16.8143 0.00595
NP_441432.1_8 Forward -106 -97 8.35786 0.0755
NP_442320.1_8 Forward -364 -350 -5.40861 0.225
NP_442344.1_7 Reverse -97 -116 4.32602 0.0638
NP_441732.1_2 Reverse -92 -108 -7.51295 0.0859
NP_441732.1_2 Forward -109 -93 -7.61128 0.0861
NP_441732.1_2 Forward -362 -346 -16.4611 0.167
NP_441732.1_2 Forward -97 -81 -16.7561 0.195
NP_440497.1_6 Reverse -111 -130 1.27776 0.239
NP_440629.1_6 Reverse -90 -109 14.75 0.162
NP_442003.1_4 Reverse -97 -116 10.3242 0.288
NP_440760.1_1 Forward -302 -283 -17.7001 0.203
NP_440760.1_1 Reverse -96 -115 -20.2567 0.222
NP_442797.1_7 Forward -220 -202 -1.45582 0.299
NP_440578.1_10 Reverse -335 -354 12.1925 0.246
NP_440461.1_3 Forward -113 -94 17.3057 0.145
NP_441945.1_10 Reverse -109 -128 12.3892 0.216
NP_441945.1_10 Reverse -348 -367 7.37428 0.284
NP_442353.1_4 Forward -111 -92 1.86696 0.24
NP_443011.1_4 Reverse -318 -337 17.404 0.0608
NP_442400.1_10 Forward -73 -60 8.0831 0.279
NP_440713.1_4 Reverse -349 -368 1.37609 0.287
NP_442489.1_7 Forward -105 -96 20.1576 0.000695
NP_442489.1_7 Reverse -96 -105 20.1576 0.000695
NP_442489.1_7 Forward -358 -349 -1.57357 0.213
NP_440757.1_7 Forward -221 -203 -0.275845 0.269
NP_440565.1_2 Reverse -99 -113 15.4196 0.292
NP_442079.1_7 Reverse -350 -369 0.196116 0.286
NP_440559.1_1 Forward -104 -95 17.4043 0.00658
NP_440559.1_1 Reverse -97 -106 17.306 0.00658
NP_440559.1_1 Forward -357 -348 6.78456 0.128
NP_441659.2_8 Reverse -96 -106 19.3512 0.000966
NP_441659.2_8 Forward -105 -95 18.1713 0.00133
NP_441659.2_8 Forward -358 -348 2.83163 0.187
NP_441659.2_8 Reverse -103 -113 1.35667 0.242
NP_442913.1_10 Forward -114 -95 16.9124 0.0136
NP_442849.1_1 Reverse -138 -152 16.8142 0.198
NP_442008.1_2 Forward -108 -89 5.11266 0.228
NP_442776.1_6 Reverse -148 -167 13.5691 0.138
NP_442346.1_5 Forward -106 -96 17.9746 0.00128
NP_442346.1_5 Reverse -95 -105 16.6963 0.00248
NP_442346.1_5 Reverse -115 -125 14.1397 0.0164
NP_442346.1_5 Reverse -348 -358 5.5849 0.238
NP_442346.1_5 Forward -359 -349 4.79825 0.272
NP_440545.1_3 Reverse -92 -109 6.52869 0.0551
NP_440545.1_3 Reverse -345 -362 6.23369 0.0568
NP_440545.1_3 Forward -109 -92 4.6604 0.0679
NP_440831.1_3 Forward -114 -95 8.13453 0.233
NP_440831.1_3 Reverse -93 -112 5.41637 0.28
NP_441923.1_6 Reverse -350 -364 7.76774 0.298
NP_440459.1_2 Forward -127 -110 14.1002 0.119
NP_440459.1_2 Reverse -101 -118 7.61033 0.285
NP_440010.1_10 Forward -117 -98 6.39097 0.226
NP_442603.1_7 Forward -337 -323 6.78381 0.23
NP_441888.1_7 Forward -363 -349 2.06454 0.229
NP_441833.1_4 Forward -104 -97 15.9687 0.0124
NP_441833.1_4 Reverse -97 -104 15.9687 0.0124
NP_441833.1_4 Forward -357 -350 6.23397 0.163
NP_441833.1_4 Reverse -350 -357 6.13563 0.198
NP_441329.1_6 Reverse -165 -184 2.24364 0.231
NP_442162.1_9 Forward -104 -97 16.2637 0.0124
NP_442162.1_9 Reverse -97 -104 16.2637 0.0124
NP_442162.1_9 Forward -357 -350 6.62729 0.142
NP_442162.1_9 Reverse -350 -357 6.43063 0.208
NP_440671.1_4 Forward -364 -350 10.521 0.155
NP_442943.1_1 Reverse -262 -277 6.83807 0.202
NP_440830.1_3 Reverse -260 -279 13.47 0.284
NP_442140.1_3 Reverse -97 -107 13.5497 0.0542
NP_442140.1_3 Forward -357 -347 12.2714 0.0632
NP_442140.1_3 Forward -104 -94 12.2714 0.0632
NP_442140.1_3 Reverse -117 -127 7.64985 0.133
NP_442140.1_3 Reverse -350 -360 4.20827 0.254
NP_441813.1_5 Forward -107 -97 8.82982 0.0367
NP_441813.1_5 Reverse -94 -104 8.63316 0.0367
NP_441813.1_5 Forward -360 -350 6.66654 0.0826
NP_441227.1_3 Reverse -203 -222 12.8808 0.0683
NP_440590.1_4 Reverse -97 -110 1.29759 0.127
NP_440590.1_4 Forward -104 -91 -5.97891 0.296
NP_440567.1_1 Forward -104 -90 14.2576 0.0187
NP_440567.1_1 Reverse -97 -111 7.07942 0.0779
NP_440567.1_1 Reverse -350 -364 2.94952 0.157
NP_442497.1_10 Reverse -97 -106 19.8626 0.00532
NP_442497.1_10 Forward -104 -95 10.4228 0.0087
NP_442497.1_10 Forward -357 -348 -1.18024 0.256
NP_440821.1_4 Forward -107 -97 10.9931 0.0146
NP_440821.1_4 Reverse -94 -104 9.41981 0.0286
NP_440821.1_4 Forward -360 -350 0.57002 0.169
NP_441239.1_9 Forward -107 -95 10.7571 0.0723
NP_441239.1_9 Forward -360 -348 7.11881 0.169
NP_441239.1_9 Forward -127 -115 7.02048 0.173
NP_441239.1_9 Reverse -94 -106 6.92215 0.173
NP_441951.1_9 Forward -21 -2 5.211 0.254
NP_441892.1_1 Forward -114 -97 5.84037 0.0995
NP_441892.1_1 Forward -367 -350 4.95539 0.105
NP_441892.1_1 Reverse -107 -124 2.89044 0.133
NP_440604.1_6 Forward -105 -86 -4.03212 0.236
NP_442193.1_1 Reverse -349 -367 8.47561 0.272
NP_442270.1_9 Forward -116 -97 -11.0136 0.266
NP_440219.1_4 Reverse -18 -31 18.256 0.157
NP_442643.1_3 Reverse -110 -129 7.07928 0.0976
NP_440833.1_6 Forward -30 -16 8.94708 0.267
NP_440949.1_7 Forward -366 -347 12.3883 0.214
NP_440354.1_5 Reverse -93 -112 1.37609 0.279
NP_442052.1_8 Forward -107 -97 12.7631 0.253
NP_440546.1_4 Reverse -96 -106 12.8578 0.0572
NP_440546.1_4 Forward -105 -95 10.046 0.109
NP_440546.1_4 Reverse -116 -126 9.27034 0.146
NP_440546.1_4 Forward -219 -209 6.45857 0.296
NP_440462.1_6 Forward -360 -350 4.99491 0.175
NP_440462.1_6 Forward -107 -97 1.455 0.294
NP_440462.1_6 Reverse -94 -104 1.35667 0.294
NP_440868.1_4 Reverse -92 -104 13.2153 0.022
NP_440868.1_4 Forward -109 -97 8.79043 0.0582
NP_441582.1_5 Reverse -94 -113 10.9134 0.154
NP_441474.1_1 Forward -368 -349 1.57197 0.247
NP_442402.1_4 Reverse -142 -161 3.24359 0.153
NP_442402.1_4 Forward -382 -363 -7.57277 0.276
NP_442402.1_9 Forward -116 -97 8.35759 0.291
NP_442258.1_2 Forward -123 -104 6.09597 0.0613
NP_442258.1_2 Forward -117 -98 -4.6221 0.27
NP_440696.1_3 Reverse -345 -363 -3.81576 0.29
NP_441843.2_9 Forward -88 -70 12.7291 0.205
NP_442923.1_4 Reverse -189 -208 0.392778 0.196
NP_442039.1_4 Forward -104 -97 15.1821 0.0124
NP_442039.1_4 Reverse -97 -104 15.1821 0.0124
NP_442039.1_4 Forward -357 -350 6.3323 0.289
NP_442039.1_7 Forward -356 -346 14.3364 0.211
NP_442039.1_7 Reverse -170 -180 6.96153 0.286
NP_440825.1_7 Forward -104 -94 12.9096 0.152
NP_440825.1_7 Reverse -305 -315 11.8361 0.2
NP_440825.1_7 Reverse -97 -107 11.8361 0.2
NP_442696.1_6 Forward -348 -329 -4.72043 0.174
NP_442837.1_3 Forward -104 -97 15.7721 0.0124
NP_442837.1_3 Reverse -97 -104 15.7721 0.0124
NP_442837.1_3 Forward -357 -350 6.0373 0.25
NP_442837.1_3 Reverse -350 -357 5.93897 0.265
NP_442053.1_1 Forward -105 -96 18.3876 0.0007
NP_442053.1_1 Reverse -96 -105 18.3876 0.0007
NP_440505.1_3 Reverse -94 -104 9.22315 0.122
NP_440505.1_7 Forward -112 -93 11.3075 0.146
NP_440505.1_7 Reverse -78 -97 -2.95047 0.298
NP_441102.1_10 Reverse -358 -377 5.50599 0.289
NP_441203.1_2 Reverse -349 -368 -5.99873 0.265
NP_440914.1_1 Forward -105 -95 17.5935 0.000537
NP_440914.1_1 Forward -358 -348 12.9091 0.0435
NP_440914.1_1 Reverse -96 -106 8.51751 0.186
NP_441011.1_8 Reverse -97 -106 14.356 0.0249
NP_441011.1_8 Reverse -350 -359 8.55452 0.144
NP_441011.1_8 Forward -104 -95 8.25953 0.144
NP_442533.1_6 Forward -105 -96 17.2076 0.00137
NP_442533.1_6 Reverse -96 -105 17.2076 0.00137
NP_442533.1_6 Reverse -349 -358 5.60459 0.137
NP_442533.1_6 Reverse -116 -125 4.62128 0.179
NP_442533.1_6 Reverse -110 -119 1.57302 0.294
NP_442322.1_4 Reverse -102 -119 -8.8116 0.286
NP_442229.1_1 Reverse -347 -361 9.53707 0.184
NP_442229.1_1 Reverse -94 -108 7.47213 0.196
NP_443016.1_1 Reverse -90 -109 16.6174 0.0218
NP_441482.1_7 Reverse -90 -104 -10.7185 0.213
NP_441482.1_7 Forward -364 -350 -11.3085 0.254
NP_439944.1_9 Forward -104 -94 10.5014 0.0887
NP_439944.1_9 Reverse -97 -107 8.82982 0.101
NP_439944.1_9 Forward -357 -347 5.78156 0.221
NP_441028.1_6 Forward -182 -172 4.7978 0.277
NP_441028.1_6 Forward -89 -79 4.10949 0.278
NP_440116.1_5 Forward -108 -91 2.89044 0.252
NP_440116.1_8 Reverse -97 -116 2.75272 0.0854
NP_440115.1_6 Reverse -93 -103 9.32148 0.115
NP_440115.1_6 Forward -108 -98 8.63316 0.128
NP_440007.1_9 Forward -362 -348 4.52282 0.267
NP_441680.1_4 Forward -127 -108 2.85105 0.224
NP_441059.1_2 Reverse -73 -92 -6.88371 0.268
NP_443045.1_9 Reverse -103 -121 9.55647 0.239
NP_441602.1_4 Forward -369 -350 12.1925 0.278
NP_441972.1_5 Forward -369 -350 5.89931 0.0873
NP_441106.1_1 Forward -359 -350 14.1594 0.0265
NP_441106.1_1 Forward -106 -97 9.73449 0.0311
NP_441106.1_1 Reverse -95 -104 9.63616 0.0311
NP_441420.1_1 Reverse -95 -114 -2.75381 0.288
NP_440429.1_4 Forward -112 -93 14.5524 0.25
NP_442704.1_6 Forward -367 -348 17.1451 0.266
NP_441286.1_1 Reverse -95 -107 15.4769 0.00418
NP_441286.1_1 Forward -106 -94 3.48056 0.0467
NP_441286.1_1 Reverse -348 -360 -5.86088 0.229
NP_442674.1_3 Forward -366 -347 3.73524 0.294
NP_440670.1_8 Forward -105 -96 18.3876 0.000699
NP_440670.1_8 Reverse -96 -105 18.3876 0.000699
NP_442463.1_10 Reverse -335 -353 9.85225 0.279
NP_441930.1_2 Forward -113 -103 14.828 0.19
NP_440886.1_7 Forward -106 -96 8.04271 0.0805
NP_440886.1_7 Reverse -95 -105 7.94438 0.0805
NP_440886.1_7 Forward -129 -119 7.15773 0.103
NP_440886.1_7 Forward -368 -358 5.38779 0.185
NP_440886.1_7 Reverse -102 -112 5.38779 0.185
NP_442614.1_2 Reverse -96 -110 7.17775 0.275
NP_442614.1_2 Forward -105 -91 7.07942 0.275
NP_442072.1_9 Forward -106 -88 -10.9939 0.0789
NP_442072.1_9 Forward -113 -95 -22.6953 0.253
NP_442401.1_2 Reverse -95 -114 7.96345 0.254
NP_440907.2_8 Reverse -97 -107 16.2041 0.0161
NP_440907.2_8 Forward -104 -94 7.64939 0.117
NP_440907.2_8 Reverse -206 -216 4.10949 0.278
NP_441021.1_1 Forward -104 -85 -9.44032 0.216
NP_441463.1_3 Reverse -86 -105 -1.96717 0.147
NP_442893.1_4 Forward -281 -262 2.45694 0.192
NP_441626.1_2 Forward -104 -97 15.7721 0.0124
NP_441626.1_2 Reverse -97 -104 15.7721 0.0124
NP_441626.1_2 Forward -357 -350 6.52896 0.137
NP_441626.1_2 Reverse -350 -357 5.93897 0.231
NP_442362.1_7 Forward -116 -98 14.2771 0.22
NP_440107.1_5 Reverse -203 -222 1.0811 0.178
NP_442794.1_1 Reverse -92 -104 12.232 0.0721
NP_442615.1_1 Reverse -87 -105 9.36059 0.0254
NP_442615.1_1 Forward -114 -96 5.52568 0.0379
NP_442615.1_1 Reverse -340 -358 -4.99573 0.201
NP_442615.1_1 Forward -228 -210 -7.45401 0.291
NP_440387.1_1 Forward -105 -89 21.593 0.00219
NP_440387.1_1 Reverse -96 -112 -0.138127 0.135
NP_441431.1_2 Forward -108 -94 14.6503 0.061
NP_441431.1_2 Reverse -207 -221 10.5204 0.159
NP_441431.1_2 Reverse -93 -107 8.55376 0.211
NP_441431.1_2 Forward -361 -347 8.06211 0.226
NP_441488.1_2 Reverse -84 -103 19.0757 0.0685
NP_441836.1_2 Forward -131 -112 -1.7705 0.223
NP_440634.1_8 Forward -364 -345 3.44025 0.285
NP_441993.1_1 Forward -111 -92 4.38312 0.221
NP_441993.1_1 Reverse -110 -129 0.874656 0.29
NP_441993.1_7 Forward -104 -90 18.0925 0.247
NP_440114.1_10 Reverse -96 -110 15.5359 0.0249
NP_440754.1_7 Reverse -282 -300 17.5725 0.261
NP_441510.2_7 Forward -364 -350 11.1104 0.28
NP_440287.1_5 Forward -373 -354 6.09517 0.298
NP_440293.1_3 Forward -121 -102 1.67108 0.207
NP_440422.1_10 Reverse -55 -74 8.17758 0.212
NP_441237.1_9 Reverse -97 -107 17.188 0.00445
NP_441237.1_9 Forward -104 -94 14.828 0.0242
NP_439911.1_1 Forward -390 -371 4.12936 0.271
NP_440457.1_1 Forward -116 -104 4.16888 0.171
NP_440457.1_1 Forward -109 -97 2.98891 0.204
NP_440457.1_1 Reverse -92 -104 2.10393 0.217
NP_440457.1_1 Forward -218 -206 1.51394 0.236
NP_440798.1_6 Reverse -97 -110 23.2254 0.00412
NP_440798.1_6 Forward -104 -91 3.26421 0.151
NP_440801.1_10 Reverse -112 -131 3.93269 0.297
NP_440473.1_1 Reverse -93 -112 16.4634 0.106
NP_440473.1_9 Forward -116 -97 -4.13045 0.177
NP_442509.1_9 Reverse -96 -106 17.3841 0.00128
NP_442509.1_9 Forward -105 -95 8.14104 0.192
NP_441253.1_8 Reverse -91 -105 16.7557 0.119
NP_442514.1_5 Reverse -102 -121 -9.14605 0.294
NP_440554.1_4 Reverse -350 -360 13.7464 0.0245
NP_441885.1_5 Forward -105 -95 20.9245 0.000538
NP_441885.1_5 Reverse -96 -106 11.3864 0.00668
NP_440628.1_1 Forward -348 -338 13.8734 0.279
NP_442341.1_7 Reverse -95 -109 6.6861 0.12
NP_442341.1_7 Forward -106 -92 4.12949 0.2
NP_442341.1_9 Forward -107 -93 10.8154 0.133
NP_442341.1_9 Reverse -94 -108 8.3571 0.171
NP_441173.1_9 Reverse -70 -78 10.9338 0.242
NP_440423.1_4 Forward -369 -350 11.6025 0.296
NP_443000.1_7 Reverse -94 -104 10.3048 0.0345
NP_443000.1_7 Forward -107 -97 2.04498 0.226
NP_443059.1_10 Forward -336 -317 1.57197 0.239
NP_441842.1_1 Forward -356 -343 11.3267 0.257
NP_441842.1_10 Forward -112 -98 6.09611 0.299
NP_440275.1_3 Forward -107 -97 9.91146 0.046
NP_440275.1_3 Reverse -94 -104 8.04317 0.0602
NP_442932.1_9 Forward -111 -92 5.211 0.268
NP_440091.1_1 Reverse -92 -104 1.41561 0.197
NP_440679.1_10 Reverse -351 -370 -16.1268 0.251
NP_442451.1_2 Forward -332 -313 -10.7186 0.278
NP_441635.1_1 Reverse -28 -47 8.92807 0.236
NP_441122.1_1 Reverse -92 -107 4.89645 0.28
NP_439962.1_4 Forward -120 -101 -8.55534 0.296
NP_442234.1_1 Forward -360 -341 6.78429 0.267
NP_442495.1_4 Forward -121 -111 14.1397 0.173
NP_440149.1_8 Reverse -343 -362 -0.590531 0.151
NP_440149.1_8 Reverse -349 -368 -7.76869 0.292
NP_441105.1_3 Forward -136 -117 -0.885524 0.143
NP_441105.1_3 Reverse -105 -124 -1.27885 0.147
NP_442373.1_2 Forward -121 -102 2.16274 0.162
NP_440216.1_1 Reverse -96 -110 16.5192 0.00277
NP_440216.1_1 Forward -105 -91 -1.18038 0.0301
NP_440216.1_9 Reverse -15 -24 14.0611 0.184
NP_440216.1_9 Forward -356 -347 7.17789 0.286
NP_440172.1_1 Reverse -96 -106 16.303 0.00854
NP_440172.1_1 Forward -105 -95 15.0247 0.00945
NP_440172.1_1 Reverse -311 -321 2.53664 0.277
NP_442015.1_10 Forward -109 -96 11.4257 0.0372
NP_442015.1_10 Reverse -92 -105 10.1474 0.0402
NP_442015.1_10 Forward -362 -349 -0.0790467 0.25
NP_442329.1_8 Reverse -104 -123 9.53756 0.17
NP_441226.1_7 Forward -104 -97 14.4934 0.0123
NP_441226.1_7 Reverse -97 -104 14.4934 0.0123
NP_441226.1_7 Reverse -350 -357 14.1984 0.024
NP_441757.1_3 Reverse -95 -114 2.0644 0.159
NP_441111.1_7 Forward -104 -96 18.7023 0.00294
NP_441111.1_7 Reverse -97 -105 18.7023 0.00294
NP_442379.1_10 Reverse -89 -106 17.8367 0.0226
NP_439971.2_3 Forward -324 -305 17.9879 0.134
NP_441766.1_2 Forward -105 -96 17.5026 0.00297
NP_441766.1_2 Reverse -96 -105 17.5026 0.00297
NP_441766.1_2 Reverse -349 -358 6.78456 0.0896
NP_442417.1_5 Reverse -349 -363 9.34103 0.134
NP_440416.1_9 Reverse -89 -108 2.26107 0.0409
NP_440416.1_9 Reverse -342 -361 -3.54046 0.0746
NP_440416.1_9 Reverse -109 -128 -11.8986 0.155
NP_440416.1_9 Forward -132 -113 -15.0452 0.184
NP_443052.1_8 Forward -115 -96 -0.197208 0.0684
NP_442116.1_6 Reverse -262 -279 5.3042 0.299
NP_442154.1_1 Reverse -350 -368 -7.749 0.148
NP_440261.1_5 Reverse -97 -110 7.09911 0.0316
NP_440261.1_5 Forward -124 -111 -4.60227 0.158
NP_440261.1_5 Forward -104 -91 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATTTGATAGCCCAAAGGAATACCAGTGGATTCCCCCACCACAGCGATGGCAAACCAGAAAAAGCCCAGCAGCACCAGGAATACATCGGCAATCAAAATACGATCCAGCCAGGTTAGTAATAAAGTTTTCATACAATTTGCACACAATCCAGATACTCAGGTCGGGGACTGATTTCTGCTCAGCGGTGGGGTCCCCCATTAATACCTATGCCAGGTACTTGTTTCCCATCTTAATCCTTTGGTGGATGACCTCTGTTAACCAATCGTTTGTCCCCAACCATGGCCCGGGGCAGTGGGCGATCGCCAAGCTGTTAACCCCCGGTTTGGTAAATTGACAATAACGCTCTAAGTTGAAAAAACTAATGTCTTGCTCAAACTTTCCTTGGAGAAACTAACCACA

CDS

ATGGATACCATCAAACAAATTAGCTATTTTCTGGCCGGTGTGGTACTGATGGAAATGACCCTCACAGCGGCGATCGCCAGGGCCGATGACCGGGATGTAACGGCCCAGGAAAGACAGAGAATTGTCCAAGCCCTCAATGCCCTGGGCTGTAGTTCCTTTGATGATGCAGAGTACGAAATCGACAAAAGACGGTTTGAAATTGACGACGCGATTTGTGCCGATGGGCGGAAATATGAAATTTATCTAGATGCTAACTATCAGCTGATCAAGAAGGAATTAGAGGACTAA

Protein

MDTIKQISYFLAGVVLMEMTLTAAIARADDRDVTAQERQRIVQALNALGCSSFDDAEYEIDKRRFEIDDAICADGRKYEIYLDANYQLIKKELED