Your browser is old and dusty. Try Google Chrome!

Details for ssr1789

ORF ssr1789
Accession NP_440269.1
Symbol hliD, scpE
Category Adaptations and atypical conditions
Definition CAB/ELIP/HLIP-related protein HliD
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -148 -162 1.96621 0.179
NP_441061.1_2 Reverse -173 -187 -1.47537 0.262
NP_440557.1_1 Reverse -319 -338 -1.27885 0.271
NP_441418.1_6 Forward -168 -149 -21.24 0.143
NP_440815.1_1 Forward -27 -10 16.8534 0.259
NP_441453.1_4 Reverse -390 -398 6.80426 0.121
NP_441453.1_4 Forward -399 -391 6.11594 0.121
NP_441453.1_4 Reverse -172 -180 4.24765 0.259
NP_440561.1_3 Forward -284 -265 20.8456 0.255
NP_440226.1_1 Forward -399 -380 9.43923 0.0726
NP_441098.1_3 Forward -35 -16 -1.52525 0.27
NP_440996.1_3 Forward -194 -176 11.0322 0.245
NP_442173.1_1 Forward -398 -390 12.0158 0.0316
NP_442173.1_1 Reverse -391 -399 10.7375 0.0611
NP_442752.1_4 Reverse -390 -397 13.8055 0.0199
NP_440784.1_7 Reverse -391 -398 6.23397 0.241
NP_440784.1_7 Forward -398 -391 6.13563 0.241
NP_442909.1_7 Forward -398 -384 6.29216 0.252
NP_441438.1_1 Forward -44 -25 9.3409 0.228
NP_440061.1_9 Reverse -170 -184 7.76712 0.194
NP_441054.1_4 Forward -391 -373 2.37909 0.169
NP_441476.1_5 Forward -161 -142 -0.39387 0.2
NP_441476.1_5 Reverse -142 -161 -0.983855 0.2
NP_441476.1_5 Forward -129 -110 -3.3438 0.235
NP_440878.1_9 Reverse -143 -162 -2.65548 0.273
NP_442062.1_3 Forward -42 -23 5.60432 0.182
NP_442062.1_8 Reverse -172 -182 9.91146 0.0554
NP_440761.1_4 Reverse -313 -332 -12.9802 0.257
NP_441859.1_3 Forward -331 -312 1.96529 0.269
NP_440304.1_4 Forward -183 -173 5.97822 0.185
NP_441492.1_2 Forward -110 -91 16.2241 0.0642
NP_441492.1_5 Forward -45 -26 3.64224 0.27
NP_441352.1_4 Forward -158 -139 11.3075 0.238
NP_441208.1_9 Reverse -327 -341 9.63603 0.207
NP_441594.1_6 Forward -165 -146 2.0644 0.256
NP_442110.1_7 Reverse -141 -155 2.94952 0.221
NP_442110.1_7 Reverse -147 -161 0.687908 0.252
NP_440856.1_7 Reverse -213 -232 -5.01543 0.224
NP_441083.1_5 Forward -399 -389 9.7148 0.0231
NP_441083.1_5 Reverse -390 -400 -1.00328 0.289
NP_441434.1_7 Forward -397 -383 2.75286 0.27
NP_441141.1_4 Forward -166 -147 9.43923 0.292
NP_441738.1_2 Forward -397 -390 15.28 0.0102
NP_440209.1_1 Reverse -390 -398 8.57422 0.0425
NP_440056.1_1 Forward -161 -142 19.174 0.0563
NP_440178.1_7 Reverse -356 -375 -22.42 0.265
NP_442570.1_3 Forward -189 -170 -3.54046 0.222
NP_441327.1_4 Reverse -383 -397 15.8309 0.282
NP_441163.1_1 Forward -157 -140 17.246 0.158
NP_440906.1_5 Reverse -391 -398 6.23397 0.234
NP_440906.1_5 Forward -398 -391 6.13563 0.241
NP_440747.1_10 Reverse -387 -399 -4.48425 0.101
NP_440747.1_10 Reverse -213 -225 -11.6624 0.131
NP_440747.1_10 Reverse -347 -359 -12.2524 0.254
NP_442145.1_4 Forward -44 -25 14.8486 0.0898
NP_442145.1_4 Reverse -24 -43 5.0129 0.265
NP_440944.1_2 Forward -291 -272 -1.7705 0.259
NP_442634.1_4 Forward -329 -315 -3.83532 0.17
NP_440403.1_10 Reverse -216 -235 8.16093 0.205
NP_440842.1_4 Reverse -25 -44 4.02695 0.207
NP_440057.1_1 Forward -161 -142 17.5024 0.13
NP_443017.1_1 Reverse -26 -45 16.7983 0.191
NP_442848.1_1 Reverse -384 -398 -2.55701 0.263
NP_442848.1_9 Reverse -141 -160 -1.27885 0.288
NP_439978.1_1 Forward -287 -271 14.4149 0.285
NP_443018.1_3 Forward -398 -391 11.7405 0.0655
NP_443018.1_3 Reverse -173 -180 10.7572 0.0907
NP_443018.1_3 Reverse -391 -398 5.44732 0.193
NP_443018.1_3 Forward -74 -67 5.34899 0.212
NP_443018.1_3 Forward -180 -173 4.56234 0.241
NP_441634.1_8 Reverse -211 -225 2.94952 0.158
NP_441634.1_8 Forward -164 -150 1.27789 0.202
NP_441634.1_9 Forward -364 -345 10.4217 0.252
NP_440376.1_1 Reverse -390 -399 5.99792 0.111
NP_440376.1_1 Reverse -147 -156 5.50626 0.131
NP_440376.1_1 Reverse -350 -359 4.0313 0.182
NP_440376.1_1 Forward -399 -390 -0.196935 0.285
NP_441588.1_4 Forward -397 -387 18.1713 0.0143
NP_442687.1_7 Reverse -349 -359 8.92815 0.0994
NP_442687.1_7 Reverse -215 -225 5.87989 0.183
NP_442191.1_4 Forward -167 -153 12.8353 0.187
NP_442485.1_2 Forward -348 -329 12.4875 0.288
NP_442485.1_3 Forward -227 -208 -6.1954 0.299
NP_440642.1_10 Reverse -335 -349 6.78381 0.225
NP_441422.1_7 Reverse -170 -187 -1.14113 0.181
NP_440667.1_8 Forward -148 -129 13.3716 0.222
NP_441451.2_5 Forward -396 -377 17.2074 0.292
NP_442658.1_1 Forward -183 -173 7.15773 0.214
NP_442658.1_1 Forward -158 -148 6.37109 0.231
NP_442198.1_3 Reverse -207 -226 11.7992 0.19
NP_442198.1_3 Reverse -330 -349 4.62101 0.275
NP_442782.1_2 Forward -181 -167 6.19444 0.229
NP_442782.1_2 Forward -359 -345 0.982901 0.282
NP_442653.1_9 Reverse -41 -60 18.4848 0.128
NP_441958.1_5 Forward -400 -390 1.55333 0.095
NP_441958.1_5 Reverse -389 -399 0.865012 0.12
NP_441127.1_1 Forward -114 -100 13.7659 0.17
NP_440269.1_2 Forward -41 -27 20.4524 0.176
NP_439905.1_1 Reverse -173 -186 7.00078 0.269
NP_442690.1_1 Reverse -17 -36 -6.98204 0.172
NP_442911.1_2 Forward -166 -147 -6.09707 0.175
NP_440153.1_5 Reverse -358 -372 1.57289 0.248
NP_440153.1_8 Reverse -172 -185 5.32916 0.18
NP_440153.1_8 Forward -228 -215 -3.52063 0.295
NP_442536.1_4 Reverse -49 -67 7.4923 0.299
NP_440993.1_3 Reverse -206 -225 3.9319 0.173
NP_441348.1_3 Forward -364 -345 12.9791 0.138
NP_441129.1_3 Forward -79 -60 -7.86702 0.162
NP_441099.1_5 Reverse -362 -381 1.27776 0.0673
NP_441099.1_5 Reverse -203 -222 0.687771 0.0744
NP_441099.1_5 Forward -358 -339 -10.0303 0.24
NP_440809.1_9 Forward -368 -350 -7.45401 0.225
NP_441294.1_7 Reverse -386 -400 8.86667 0.274
NP_441646.1_1 Reverse -140 -159 -0.4922 0.266
NP_442438.1_3 Reverse -167 -186 9.53756 0.258
NP_442438.1_10 Forward -161 -147 -0.492064 0.264
NP_441752.1_6 Reverse -113 -132 0.786102 0.26
NP_442771.1_1 Forward -158 -140 -10.6989 0.279
NP_440147.1_4 Reverse -170 -183 5.23083 0.132
NP_441550.1_8 Reverse -388 -398 13.3526 0.0252
NP_441916.1_7 Forward -181 -171 3.91327 0.198
NP_440016.1_3 Forward -357 -338 13.6675 0.235
NP_441725.1_5 Reverse -173 -183 4.89658 0.115
NP_439966.1_7 Reverse -292 -302 8.63269 0.132
NP_442941.1_3 Forward -398 -388 1.25834 0.15
NP_440674.1_3 Reverse -100 -119 4.81767 0.246
NP_441076.1_1 Forward -295 -276 11.4536 0.209
NP_441678.1_6 Reverse -59 -78 11.2092 0.235
NP_442281.1_1 Reverse -385 -399 7.07881 0.108
NP_442281.1_1 Reverse -179 -193 2.94893 0.249
NP_441334.1_7 Forward -170 -151 -10.522 0.12
NP_441644.1_6 Reverse -172 -182 9.321 0.0799
NP_441644.1_6 Forward -399 -389 7.74772 0.117
NP_441644.1_6 Reverse -390 -400 6.96107 0.141
NP_443049.1_6 Reverse -389 -399 11.8361 0.24
NP_442215.1_2 Forward -227 -211 0.451859 0.151
NP_442029.1_6 Reverse -135 -154 2.94938 0.286
NP_440929.1_8 Forward -399 -390 14.651 0.0105
NP_440929.1_8 Reverse -390 -399 7.66954 0.0624
NP_440929.1_8 Forward -156 -147 5.60459 0.125
NP_442933.1_10 Forward -181 -172 4.52295 0.24
NP_442926.1_1 Forward -120 -101 -4.22878 0.278
NP_442926.1_3 Reverse -173 -192 3.83436 0.279
NP_442926.1_3 Forward -192 -173 2.0644 0.296
NP_442554.1_8 Reverse -173 -183 7.74818 0.0846
NP_442554.1_8 Forward -398 -388 5.48657 0.146
NP_442554.1_8 Forward -167 -157 3.12662 0.239
NP_442970.1_1 Reverse -274 -288 9.08335 0.287
NP_441762.1_7 Reverse -146 -158 -4.9759 0.185
NP_441762.1_7 Reverse -171 -183 -6.05754 0.268
NP_441762.1_7 Forward -157 -145 -6.94252 0.284
NP_442292.1_1 Forward -398 -389 8.65285 0.0335
NP_442292.1_1 Reverse -391 -400 7.17789 0.0777
NP_442292.1_1 Reverse -173 -182 5.70292 0.135
NP_443009.1_5 Forward -182 -171 6.64635 0.154
NP_443009.1_5 Reverse -389 -400 3.69644 0.282
NP_442301.1_2 Reverse -149 -168 7.96345 0.23
NP_441715.1_4 Forward -138 -128 4.3066 0.29
NP_440881.1_3 Reverse -148 -167 13.9616 0.28
NP_441198.1_5 Forward -397 -384 12.7034 0.216
NP_440379.1_5 Forward -363 -344 -9.34199 0.263
NP_441468.1_1 Reverse -391 -398 6.13563 0.209
NP_441468.1_1 Forward -398 -391 6.0373 0.223
NP_441468.1_1 Forward -180 -173 4.07068 0.263
NP_441020.2_6 Forward -158 -141 8.98696 0.182
NP_441015.1_10 Forward -186 -167 -7.27704 0.265
NP_441015.1_10 Forward -167 -148 -9.83364 0.282
NP_441015.1_10 Forward -227 -208 -11.4069 0.296
NP_441673.1_1 Reverse -390 -399 1.37636 0.114
NP_441673.1_1 Forward -399 -390 1.1797 0.163
NP_441673.1_1 Forward -156 -147 -7.76842 0.168
NP_441673.1_1 Forward -225 -216 -7.86675 0.187
NP_441673.1_1 Reverse -216 -225 -7.96508 0.206
NP_441673.1_1 Reverse -147 -156 -8.06341 0.254
NP_441320.1_4 Reverse -152 -171 19.3707 0.194
NP_441330.1_1 Reverse -167 -186 -6.09707 0.143
NP_442490.1_9 Forward -168 -149 -2.36049 0.21
NP_442868.1_6 Forward -183 -173 4.50326 0.174
NP_442868.1_6 Reverse -388 -398 0.0783647 0.248
NP_442868.1_6 Reverse -214 -224 -0.118297 0.264
NP_442719.1_2 Reverse -330 -348 -1.55487 0.175
NP_441251.1_8 Forward -40 -27 11.2343 0.27
NP_442427.1_8 Reverse -163 -182 5.211 0.274
NP_442808.1_1 Reverse -349 -359 4.60114 0.195
NP_442808.1_1 Reverse -359 -369 3.71617 0.227
NP_442808.1_1 Forward -12 -2 2.5362 0.263
NP_442775.1_6 Forward -192 -173 14.5524 0.267
NP_442692.1_1 Reverse -362 -381 12.0942 0.0502
NP_440145.1_3 Reverse -380 -399 1.27776 0.129
NP_442542.1_9 Forward -112 -98 12.6836 0.11
NP_442050.1_1 Forward -157 -138 6.09597 0.299
NP_442050.1_5 Forward -11 -1 7.94438 0.243
NP_442050.1_8 Forward -155 -136 11.9452 0.282
NP_442903.1_2 Forward -277 -258 3.867 0.24
NP_440558.1_2 Reverse -169 -188 2.45773 0.168
NP_440558.1_2 Reverse -111 -130 -3.14714 0.234
NP_441518.1_3 Reverse -380 -399 -14.0619 0.267
NP_441878.1_6 Forward -182 -172 -7.59145 0.245
NP_441878.1_6 Forward -360 -350 -7.68978 0.255
NP_441878.1_6 Reverse -215 -225 -7.98478 0.285
NP_441036.1_3 Forward -292 -273 -0.000545616 0.181
NP_441036.1_8 Forward -400 -390 5.38824 0.287
NP_441557.1_5 Forward -399 -390 7.57121 0.049
NP_441557.1_5 Reverse -390 -399 1.08137 0.0794
NP_441557.1_5 Forward -181 -172 -0.786921 0.239
NP_441557.1_5 Reverse -147 -156 -1.6719 0.291
NP_441445.1_1 Forward -368 -349 3.93269 0.204
NP_441445.1_1 Forward -171 -152 3.73603 0.208
NP_441590.1_4 Reverse -346 -365 5.80018 0.268
NP_441433.1_8 Forward -326 -307 -1.96717 0.263
NP_441433.1_8 Forward -352 -333 -3.04881 0.276
NP_442241.1_9 Reverse -367 -386 8.35759 0.286
NP_440101.1_3 Forward -173 -154 1.17943 0.282
NP_441458.1_10 Reverse -169 -188 3.34271 0.251
NP_442469.1_2 Forward -294 -276 15.8504 0.246
NP_440356.1_2 Reverse -368 -387 2.75272 0.263
NP_441116.1_9 Forward -280 -266 13.1759 0.239
NP_442347.1_2 Forward -398 -389 10.3245 0.058
NP_442645.1_2 Reverse -88 -107 -16.6185 0.237
NP_442965.1_2 Forward -297 -278 -3.63879 0.255
NP_441037.1_4 Forward -158 -148 5.85583 0.296
NP_441633.1_3 Reverse -145 -158 3.26421 0.0709
NP_440136.1_2 Reverse -391 -398 6.23397 0.171
NP_440136.1_2 Forward -398 -391 6.13563 0.193
NP_442590.1_10 Forward -366 -347 7.57094 0.223
NP_441728.2_4 Forward -36 -17 16.6629 0.164
NP_442998.1_10 Forward -397 -390 15.5754 0.0102
NP_442998.1_10 Forward -357 -350 4.16902 0.259
NP_440899.1_8 Forward -389 -370 -8.16202 0.254
NP_440299.1_1 Reverse -143 -156 6.11523 0.152
NP_440299.1_1 Reverse -346 -359 4.44361 0.207
NP_441007.1_10 Forward -186 -173 0.215946 0.241
NP_441007.1_10 Forward -308 -295 -0.177378 0.268
NP_441007.1_10 Forward -173 -160 -0.669033 0.287
NP_440709.1_1 Reverse -23 -42 15.6332 0.0302
NP_441559.1_8 Reverse -278 -292 -5.60527 0.267
NP_441559.1_8 Reverse -110 -124 -7.47356 0.294
NP_440717.1_2 Forward -158 -139 -9.53865 0.238
NP_442866.1_1 Forward -365 -346 -9.63698 0.296
NP_440748.1_5 Reverse -68 -87 -3.24547 0.293
NP_441464.1_1 Reverse -116 -135 8.06259 0.261
NP_440026.1_8 Forward -308 -290 14.6705 0.223
NP_440695.1_6 Forward -392 -378 10.7022 0.265
NP_441939.1_3 Reverse -148 -167 7.96426 0.186
NP_441199.1_6 Reverse -152 -171 1.86774 0.207
NP_441494.1_6 Reverse -154 -167 8.47575 0.23
NP_442386.1_9 Forward -182 -173 8.06244 0.209
NP_442386.1_9 Reverse -171 -180 5.70251 0.241
NP_441340.1_5 Reverse -391 -398 13.5105 0.0314
NP_441340.1_5 Reverse -351 -358 8.8889 0.084
NP_441340.1_5 Forward -398 -391 5.84064 0.208
NP_441340.1_5 Reverse -173 -180 3.97235 0.274
NP_440168.1_2 Reverse -145 -164 -4.72043 0.291
NP_441952.1_9 Forward -292 -273 16.1284 0.263
NP_442240.1_2 Reverse -319 -338 -20.945 0.3
NP_441027.1_1 Forward -24 -10 18.4851 0.169
NP_441134.1_7 Reverse -238 -257 20.059 0.151
NP_440586.1_8 Forward -398 -391 9.47853 0.146
NP_440586.1_8 Reverse -391 -398 5.74197 0.283
NP_440684.1_9 Forward -231 -217 8.16106 0.235
NP_441262.1_3 Reverse -390 -397 14.7888 0.0223
NP_443051.1_1 Forward -400 -391 7.66954 0.0571
NP_443051.1_1 Reverse -389 -398 7.47288 0.0571
NP_439937.1_8 Reverse -145 -164 -1.57384 0.249
NP_439937.1_9 Reverse -212 -229 -2.51845 0.152
NP_439937.1_9 Reverse -171 -188 -9.99156 0.22
NP_439937.1_9 Reverse -349 -366 -10.1882 0.224
NP_442239.1_8 Forward -142 -123 5.99764 0.266
NP_440372.1_2 Reverse -391 -398 13.8055 0.0214
NP_440372.1_2 Forward -398 -391 6.52896 0.188
NP_441138.1_5 Forward -387 -374 3.3085 0.297
NP_440316.1_10 Forward -115 -105 7.25653 0.251
NP_439977.1_5 Reverse -288 -307 -2.16383 0.272
NP_440139.1_1 Reverse -166 -185 6.68515 0.139
NP_441572.1_7 Reverse -344 -363 4.22769 0.103
NP_442384.1_10 Forward -359 -346 5.42749 0.13
NP_442384.1_10 Forward -149 -136 2.87088 0.21
NP_442339.1_1 Forward -278 -259 13.5683 0.204
NP_441877.1_6 Forward -81 -62 9.93088 0.284
NP_441877.1_7 Reverse -61 -80 3.63691 0.218
NP_441877.1_7 Forward -161 -142 1.17865 0.242
NP_441877.1_9 Forward -44 -27 5.44704 0.284
NP_441018.1_7 Forward -197 -178 12.5858 0.157
NP_441018.1_7 Reverse -136 -155 8.45592 0.246
NP_442790.1_2 Forward -305 -286 15.6341 0.265
NP_442262.1_10 Forward -398 -391 13.2155 0.0213
NP_442262.1_10 Reverse -173 -180 9.87221 0.164
NP_442262.1_10 Forward -74 -67 7.6106 0.274
NP_440163.1_10 Forward -165 -155 12.7631 0.154
NP_440282.1_10 Forward -153 -134 -8.45701 0.263
NP_440531.1_6 Reverse -208 -227 -0.590531 0.216
NP_442280.1_10 Reverse -340 -358 6.42843 0.275
NP_440894.1_10 Reverse -122 -141 2.26107 0.292
NP_440999.1_2 Forward -113 -94 9.53756 0.275
NP_440888.1_2 Reverse -172 -186 15.0436 0.013
NP_440600.1_5 Reverse -63 -82 19.1731 0.162
NP_440491.1_1 Forward -225 -206 7.11193 0.28
NP_441949.1_5 Reverse -14 -33 11.8368 0.25
NP_441543.1_2 Forward -398 -389 7.07956 0.131
NP_441543.1_2 Reverse -173 -182 5.01461 0.209
NP_442845.1_2 Forward -187 -173 7.17775 0.198
NP_443064.1_6 Reverse -372 -382 9.94905 0.187
NP_442578.1_7 Reverse -391 -398 6.0373 0.18
NP_441462.1_2 Reverse -390 -400 9.61647 0.0154
NP_441462.1_2 Forward -225 -215 -0.511621 0.236
NP_441621.1_7 Reverse -145 -159 5.70279 0.0751
NP_441621.1_7 Reverse -148 -162 -4.7203 0.242
NP_443062.1_1 Forward -399 -381 5.42569 0.229
NP_442204.1_1 Reverse -62 -73 0.746988 0.281
NP_441351.1_7 Forward -332 -313 19.8614 0.125
NP_441351.1_8 Forward -158 -139 8.16093 0.192
NP_442487.1_3 Reverse -179 -198 18.4857 0.19
NP_440516.1_8 Reverse -390 -399 9.53783 0.0136
NP_440516.1_8 Forward -399 -390 5.01461 0.118
NP_442428.1_5 Reverse -391 -398 6.13563 0.209
NP_442428.1_5 Forward -398 -391 6.0373 0.212
NP_442428.1_5 Forward -180 -173 4.46401 0.267
NP_441443.1_2 Reverse -164 -183 -6.29373 0.29
NP_442823.1_8 Forward -339 -320 10.1275 0.298
NP_440673.1_2 Reverse -140 -159 9.70673 0.238
NP_440673.1_3 Forward -397 -390 12.4288 0.0426
NP_440673.1_3 Reverse -174 -181 8.98723 0.203
NP_440673.1_3 Forward -325 -318 8.29892 0.221
NP_440673.1_3 Reverse -98 -105 6.72562 0.277
NP_440673.1_7 Reverse -98 -117 -0.000545616 0.28
NP_440865.1_9 Forward -171 -152 -7.67036 0.248
NP_441052.1_2 Reverse -339 -349 3.61828 0.177
NP_441052.1_2 Forward -399 -389 1.55333 0.238
NP_442219.1_9 Forward -398 -389 7.96454 0.0696
NP_440436.1_4 Reverse -173 -182 11.0124 0.0655
NP_440436.1_4 Forward -398 -389 7.57079 0.124
NP_442086.1_6 Reverse -172 -191 8.55425 0.274
NP_442412.1_5 Forward -126 -107 1.67108 0.295
NP_442412.1_5 Forward -183 -164 1.37609 0.295
NP_442902.1_7 Reverse -138 -157 13.5691 0.24
NP_441719.1_4 Reverse -391 -398 6.82395 0.0855
NP_441719.1_4 Forward -398 -391 6.52896 0.188
NP_441004.1_1 Forward -174 -155 0.294447 0.117
NP_441004.1_1 Forward -297 -278 -8.752 0.202
NP_441004.1_1 Forward -285 -266 -9.93197 0.214
NP_441004.1_1 Reverse -141 -160 -11.0136 0.231
NP_441004.1_1 Reverse -207 -226 -16.3235 0.284
NP_441004.1_2 Forward -192 -173 -1.47551 0.259
NP_441004.1_2 Forward -302 -283 -2.16383 0.263
NP_441004.1_4 Forward -184 -174 10.1081 0.254
NP_441004.1_5 Forward -185 -171 9.2427 0.262
NP_442366.1_5 Reverse -387 -397 14.8275 0.0375
NP_441729.1_1 Reverse -179 -198 13.0775 0.297
NP_441115.1_4 Reverse -317 -335 7.49153 0.286
NP_440328.1_4 Reverse -351 -370 7.37428 0.124
NP_441851.1_10 Reverse -389 -399 5.97822 0.19
NP_441851.1_10 Forward -182 -172 5.78156 0.2
NP_441668.1_5 Reverse -10 -29 10.4225 0.225
NP_441273.1_9 Forward -46 -27 15.8929 0.24
NP_442515.1_1 Forward -226 -212 -5.01529 0.298
NP_440593.1_3 Reverse -142 -161 -1.7705 0.215
NP_440593.1_3 Forward -161 -142 -6.68705 0.28
NP_440593.1_3 Forward -173 -154 -7.57203 0.297
NP_441540.1_4 Reverse -27 -46 17.234 0.191
NP_442689.1_8 Reverse -262 -279 -7.04099 0.292
NP_441349.1_10 Reverse -380 -399 -5.11376 0.192
NP_441349.1_10 Forward -238 -219 -5.80207 0.212
NP_442843.1_1 Forward -180 -161 -10.7186 0.28
NP_439960.1_10 Reverse -209 -227 -2.43913 0.255
NP_440396.1_1 Reverse -100 -119 -5.9004 0.272
NP_440396.1_10 Reverse -271 -287 10.2842 0.236
NP_440726.1_2 Reverse -347 -366 8.65258 0.194
NP_440431.1_3 Reverse -171 -190 -5.50708 0.182
NP_442168.1_6 Reverse -353 -372 18.1907 0.097
NP_440588.1_2 Forward -357 -338 -4.91709 0.233
NP_440588.1_2 Reverse -341 -360 -7.08038 0.299
NP_441031.1_1 Reverse -21 -40 6.14789 0.278
NP_441031.1_1 Forward -47 -28 5.08742 0.288
NP_441031.1_1 Forward -37 -18 4.31617 0.292
NP_439950.1_1 Reverse -11 -20 14.5527 0.212
NP_440023.1_7 Forward -290 -271 8.94757 0.265
NP_442335.1_8 Reverse -361 -380 14.0599 0.278
NP_442006.1_2 Forward -114 -97 21.8683 0.00714
NP_442006.1_2 Forward -162 -145 -14.3175 0.203
NP_442006.1_2 Forward -144 -127 -15.3008 0.221
NP_441570.1_1 Forward -399 -381 -9.61729 0.142
NP_440078.1_8 Forward -20 -1 3.73603 0.257
NP_441078.1_4 Forward -359 -350 5.99792 0.0932
NP_441078.1_4 Reverse -390 -399 0.196389 0.205
NP_441078.1_4 Forward -399 -390 -0.000272808 0.205
NP_441078.1_4 Forward -181 -172 -1.6719 0.266
NP_441078.1_4 Reverse -350 -359 -1.96689 0.282
NP_442443.1_1 Forward -176 -157 -4.81876 0.278
NP_442443.1_1 Reverse -208 -227 -5.50708 0.282
NP_440526.1_3 Reverse -116 -127 6.35136 0.205
NP_440526.1_3 Reverse -173 -184 0.943182 0.267
NP_440526.1_3 Forward -398 -387 0.64819 0.273
NP_441432.1_8 Forward -182 -173 15.0444 0.0182
NP_441432.1_8 Reverse -389 -398 14.0611 0.0258
NP_442320.1_8 Forward -187 -173 -3.24533 0.113
NP_442320.1_8 Reverse -166 -180 -5.21195 0.209
NP_442320.1_8 Reverse -384 -398 -5.9986 0.261
NP_442344.1_7 Forward -155 -136 -4.03212 0.168
NP_440760.1_1 Forward -156 -137 -22.9117 0.274
NP_442797.1_7 Reverse -171 -189 6.31233 0.21
NP_440131.1_2 Reverse -344 -363 5.70265 0.279
NP_440199.1_10 Reverse -387 -397 7.25653 0.231
NP_441057.1_3 Reverse -164 -183 -12.4886 0.255
NP_442489.1_7 Forward -399 -390 0.688044 0.152
NP_442489.1_7 Reverse -390 -399 0.688044 0.152
NP_442489.1_7 Forward -359 -350 -1.57357 0.213
NP_442489.1_7 Forward -181 -172 -1.6719 0.235
NP_442489.1_7 Reverse -172 -181 -1.96689 0.28
NP_441830.1_2 Forward -123 -104 7.37428 0.143
NP_440559.1_1 Forward -398 -389 7.76787 0.0918
NP_440559.1_1 Reverse -391 -400 5.01461 0.161
NP_441659.2_8 Reverse -390 -400 8.04317 0.0508
NP_441659.2_8 Forward -399 -389 5.48657 0.106
NP_441659.2_8 Reverse -172 -182 4.0116 0.146
NP_441040.1_2 Reverse -164 -183 -2.55715 0.139
NP_442776.1_1 Reverse -288 -307 3.93269 0.279
NP_442346.1_5 Forward -182 -172 12.6647 0.0375
NP_442346.1_5 Reverse -389 -399 6.27322 0.208
NP_442346.1_5 Reverse -317 -327 5.87989 0.225
NP_440545.1_3 Reverse -155 -172 -4.09106 0.218
NP_440545.1_3 Forward -172 -155 -5.76269 0.259
NP_440025.1_3 Reverse -189 -203 10.998 0.29
NP_441126.1_8 Forward -117 -104 6.01747 0.291
NP_440010.1_3 Forward -117 -98 -8.55534 0.297
NP_441943.1_2 Forward -29 -10 14.8474 0.223
NP_442900.1_1 Forward -309 -290 -8.85033 0.293
NP_442311.1_5 Forward -126 -107 0.392778 0.276
NP_442603.1_7 Forward -222 -208 12.8803 0.0937
NP_441888.1_7 Reverse -125 -139 1.67122 0.241
NP_441888.1_7 Reverse -61 -75 1.47456 0.249
NP_441888.1_7 Reverse -167 -181 1.08123 0.267
NP_441358.1_2 Forward -352 -333 5.50599 0.275
NP_441833.1_4 Forward -398 -391 6.52896 0.0924
NP_441833.1_4 Reverse -391 -398 6.23397 0.163
NP_440912.1_3 Forward -390 -371 13.3716 0.254
NP_442699.1_8 Forward -355 -336 -12.6852 0.255
NP_442162.1_9 Forward -398 -391 12.9205 0.0282
NP_442162.1_9 Reverse -391 -398 12.9205 0.0282
NP_442796.1_10 Forward -162 -143 10.7175 0.249
NP_440671.1_4 Reverse -178 -192 8.25939 0.202
NP_440671.1_5 Reverse -339 -353 14.9452 0.236
NP_442199.1_5 Reverse -164 -183 -5.40875 0.245
NP_442140.1_3 Forward -398 -388 10.2065 0.0902
NP_442021.1_3 Reverse -141 -160 -7.17871 0.265
NP_440875.1_9 Forward -357 -347 7.496 0.262
NP_442547.1_7 Forward -373 -354 11.877 0.243
NP_441813.1_2 Forward -159 -145 19.2725 0.228
NP_440590.1_4 Reverse -148 -161 -5.58558 0.283
NP_440590.1_4 Reverse -214 -227 -6.07724 0.299
NP_440567.1_1 Reverse -148 -162 4.91614 0.109
NP_440567.1_1 Reverse -173 -187 1.08123 0.219
NP_442497.1_10 Reverse -391 -400 5.99792 0.095
NP_442497.1_10 Forward -398 -389 0.589713 0.153
NP_440821.1_4 Forward -158 -148 -0.118297 0.229
NP_440821.1_4 Reverse -388 -398 -0.314959 0.251
NP_441239.1_9 Forward -170 -158 10.9537 0.0695
NP_441239.1_9 Forward -305 -293 6.23383 0.197
NP_441239.1_9 Forward -361 -349 5.74217 0.21
NP_441239.1_9 Reverse -170 -182 4.16888 0.26
NP_441239.1_9 Forward -183 -171 3.18557 0.292
NP_442568.1_8 Forward -48 -34 15.8309 0.192
NP_442629.1_3 Forward -197 -178 0.392778 0.294
NP_441541.1_1 Reverse -15 -33 2.29379 0.199
NP_440354.1_5 Reverse -156 -175 5.89931 0.191
NP_441617.1_6 Reverse -330 -349 -4.42544 0.265
NP_442809.1_6 Reverse -172 -191 0.982764 0.277
NP_440546.1_4 Reverse -350 -360 8.39772 0.192
NP_440546.1_4 Reverse -390 -400 7.62206 0.23
NP_442340.1_3 Forward -160 -141 -3.44213 0.205
NP_440868.1_4 Reverse -386 -398 3.38223 0.136
NP_442402.1_4 Reverse -276 -295 -5.01617 0.234
NP_442402.1_10 Reverse -273 -283 13.2542 0.204
NP_440036.1_10 Forward -286 -274 12.527 0.284
NP_441848.1_7 Reverse -279 -298 -2.16459 0.262
NP_441084.1_6 Forward -116 -102 9.15021 0.292
NP_440653.1_10 Reverse -173 -192 2.75272 0.288
NP_440696.1_3 Forward -369 -351 1.10079 0.22
NP_442023.1_2 Forward -113 -94 3.44104 0.296
NP_442039.1_4 Reverse -391 -398 11.6422 0.0747
NP_441811.1_4 Reverse -170 -189 -0.688862 0.295
NP_442679.1_1 Forward -294 -275 -2.45882 0.24
NP_441926.1_3 Reverse -331 -347 6.05672 0.17
NP_440825.1_7 Forward -398 -388 10.9578 0.278
NP_442837.1_3 Forward -398 -391 6.0373 0.25
NP_442837.1_3 Reverse -391 -398 6.0373 0.25
NP_440160.1_1 Forward -46 -27 19.4339 0.0272
NP_442053.1_1 Forward -399 -390 7.07956 0.105
NP_440505.1_3 Reverse -388 -398 7.64985 0.151
NP_440505.1_3 Forward -183 -173 5.87989 0.206
NP_440505.1_7 Forward -373 -354 -1.18052 0.271
NP_440207.2_7 Reverse -1 -20 17.0107 0.238
NP_441252.1_6 Forward -283 -276 11.6422 0.288
NP_442532.1_1 Forward -29 -15 10.5995 0.237
NP_441408.2_7 Forward -158 -139 -4.91709 0.288
NP_440914.1_1 Reverse -390 -400 9.88379 0.167
NP_440914.1_1 Forward -399 -389 6.56569 0.273
NP_441011.1_8 Reverse -391 -400 5.40793 0.263
NP_441011.1_8 Reverse -340 -349 5.3096 0.271
NP_441011.1_8 Forward -180 -171 5.11294 0.283
NP_442533.1_6 Forward -181 -172 5.60459 0.137
NP_442533.1_6 Forward -359 -350 4.62128 0.179
NP_442533.1_6 Forward -399 -390 4.42462 0.179
NP_442533.1_6 Forward -225 -216 2.65466 0.246
NP_442541.1_10 Reverse -172 -186 4.12889 0.252
NP_442322.1_4 Reverse -337 -354 -3.69841 0.251
NP_441028.1_6 Forward -247 -237 6.46942 0.23
NP_441028.1_6 Reverse -341 -351 6.0761 0.232
NP_441059.1_2 Forward -292 -273 -6.78538 0.268
NP_440903.1_2 Reverse -50 -60 16.303 0.247
NP_441602.1_3 Reverse -154 -173 -5.11376 0.278
NP_441602.1_3 Reverse -142 -161 -5.11376 0.278
NP_441972.1_5 Forward -167 -148 2.3594 0.121
NP_441106.1_6 Reverse -156 -175 15.3382 0.252
NP_440429.1_2 Reverse -173 -192 8.55425 0.272
NP_439903.1_6 Forward -330 -311 -0.39464 0.282
NP_442588.1_6 Forward -146 -127 -2.26216 0.291
NP_442306.1_10 Forward -119 -100 -20.3551 0.208
NP_440670.1_8 Reverse -390 -399 16.0277 0.00443
NP_440670.1_8 Forward -399 -390 12.5861 0.0253
NP_441479.1_1 Forward -173 -154 6.58763 0.292
NP_441886.1_6 Forward -131 -112 14.6508 0.221
NP_440886.1_7 Forward -226 -216 6.76441 0.114
NP_440886.1_7 Forward -360 -350 6.17443 0.141
NP_440886.1_7 Reverse -338 -348 4.69947 0.22
NP_440828.1_4 Forward -169 -150 1.6703 0.167
NP_440828.1_4 Reverse -143 -162 -7.6711 0.291
NP_442614.1_2 Forward -225 -211 13.4709 0.124
NP_442401.1_2 Reverse -278 -297 12.585 0.159
NP_441753.1_10 Reverse -234 -253 1.76941 0.257
NP_441808.1_8 Forward -126 -107 10.3242 0.236
NP_440907.2_8 Forward -398 -388 5.87944 0.184
NP_442264.1_4 Reverse -357 -371 16.4209 0.232
NP_441021.1_1 Reverse -173 -192 -0.885524 0.107
NP_441021.1_8 Forward -374 -356 1.98577 0.253
NP_440841.1_4 Forward -183 -164 1.86774 0.119
NP_441463.1_3 Forward -191 -172 -5.50708 0.229
NP_441626.1_2 Reverse -391 -398 12.2322 0.0511
NP_441626.1_2 Forward -398 -391 5.93897 0.231
NP_442211.1_3 Forward -135 -116 7.37474 0.283
NP_442238.1_1 Forward -135 -116 4.62101 0.202
NP_442615.1_1 Forward -190 -172 -5.38906 0.212
NP_441962.1_4 Forward -186 -167 -11.6036 0.243
NP_440387.1_1 Forward -156 -140 3.79511 0.0519
NP_440387.1_1 Reverse -216 -232 1.04184 0.114
NP_441431.1_2 Forward -159 -145 7.27547 0.244
NP_441431.1_2 Reverse -156 -170 7.27547 0.244
NP_441993.1_1 Forward -187 -168 5.06532 0.208
NP_441993.1_4 Forward -369 -350 9.34008 0.285
NP_440143.1_9 Reverse -18 -37 -0.984623 0.188
NP_440467.1_3 Reverse -173 -192 18.7761 0.0418
NP_440114.1_10 Forward -181 -167 6.78443 0.258
NP_442323.1_7 Forward -332 -313 3.34192 0.245
NP_441510.2_7 Reverse -384 -398 11.7987 0.28
NP_440293.1_3 Forward -189 -170 -3.73712 0.252
NP_440293.1_3 Reverse -103 -122 -6.39206 0.288
NP_439988.1_3 Reverse -100 -114 5.60446 0.28
NP_441237.1_9 Reverse -173 -183 11.7798 0.156
NP_441979.1_5 Reverse -141 -160 -11.1119 0.228
NP_442743.1_5 Forward -167 -148 6.29264 0.191
NP_442867.1_8 Forward -227 -208 5.211 0.276
NP_442680.1_5 Forward -281 -262 -0.0254614 0.273
NP_442784.1_3 Forward -186 -167 14.2574 0.264
NP_441885.1_5 Forward -399 -389 1.25834 0.11
NP_441885.1_5 Reverse -390 -400 -0.0199663 0.186
NP_440478.1_10 Forward -227 -213 6.19444 0.294
NP_440649.2_8 Forward -155 -141 11.111 0.265
NP_442341.1_7 Reverse -349 -363 2.16287 0.267
NP_441173.1_9 Reverse -275 -283 12.507 0.206
NP_442395.2_4 Forward -157 -138 10.6184 0.096
NP_440409.1_1 Forward -176 -157 5.50599 0.171
NP_440191.1_4 Forward -237 -227 14.2146 0.266
NP_440423.1_6 Reverse -224 -243 -20.1584 0.252
NP_443000.1_7 Reverse -388 -398 0.57002 0.294
NP_442122.1_7 Reverse -130 -149 -1.47551 0.271
NP_440275.1_3 Reverse -388 -398 5.48657 0.145
NP_440091.1_1 Reverse -386 -398 -0.846001 0.293
NP_439962.1_4 Reverse -151 -170 0.196116 0.197
NP_439962.1_4 Reverse -139 -158 -4.32711 0.269
NP_439962.1_4 Forward -227 -208 -9.14533 0.299
NP_440149.1_8 Forward -168 -149 -7.37537 0.283
NP_441105.1_3 Forward -167 -148 -0.000545616 0.131
NP_440216.1_1 Forward -181 -167 -4.32697 0.107
NP_440216.1_1 Forward -359 -345 -4.4253 0.111
NP_440216.1_1 Forward -225 -211 -11.3085 0.178
NP_440216.1_1 Reverse -360 -374 -12.6851 0.296
NP_440216.1_6 Forward -229 -213 0.353528 0.251
NP_440172.1_1 Forward -181 -171 4.99491 0.157
NP_440172.1_1 Forward -399 -389 2.24165 0.279
NP_442371.1_1 Forward -173 -163 15.2208 0.173
NP_441226.1_7 Reverse -391 -398 12.7234 0.0312
NP_441226.1_7 Forward -398 -391 11.5435 0.0757
NP_441226.1_7 Forward -155 -148 8.88855 0.165
NP_441111.1_7 Forward -398 -390 8.86921 0.0589
NP_441111.1_7 Reverse -148 -156 -0.373903 0.0721
NP_441766.1_2 Forward -399 -390 12.6844 0.0158
NP_442417.1_5 Forward -156 -142 4.91614 0.283
NP_440416.1_9 Reverse -343 -362 -10.6203 0.143
NP_440416.1_9 Reverse -139 -158 -20.5517 0.286
NP_443052.1_8 Forward -235 -216 -10.6203 0.212
NP_443052.1_9 Reverse -155 -174 -5.11376 0.265
NP_442403.1_8 Forward -397 -378 9.53756 0.142
NP_440261.1_5 Forward -224 -211 -2.73398 0.0924
NP_440988.1_10 Forward -164 -150 6.06058 0.234
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCGATCGCCAATTTTCGGGTGATTCAGCAGGAGTTGGACGCCTATGGCCGGGGGATAACGGAAAAACCCCAGATCATTGCTTTGAATAAAATTGATGCGCTGGACGGGGAAATGATTGGGGAAATTGAAACGGAATTAAAACGATTCAGTACTGCTCCCTGTTTGCACATTTCGGCGGCCACCCGGAGAGGCTTAGATGATTTGATGCAATTGGTGTGGCAATGGCTGGATGAAATGGCCGCGGCGGACGCAGAAGCCCAGAGGTTACTGGAGTTGGAATTGCAGGCCCAGGCGGCAATGAATAATCCTTTCAACTCTGACGTACCCATTGACGGGGTAACTTACTCAAGCTAAAAGGTAAAGAATTGTAAACTAAGTTAATTATCCCAGGAAATCCC

CDS

ATGAGTGAAGAACTACAACCGAACCAAACCCCCGTGCAGGAAGATCCCAAATTTGGCTTCAACAACTACGCGGAAAAGCTCAATGGCCGGGCTGCCATGGTGGGATTTCTCCTCATCCTGGTGATCGAATATTTCACTAACCAAGGGGTGTTGGCCTGGTTGGGACTGCGCTAG

Protein

MSEELQPNQTPVQEDPKFGFNNYAEKLNGRAAMVGFLLILVIEYFTNQGVLAWLGLR