Your browser is old and dusty. Try Google Chrome!

Details for ssr1765

ORF ssr1765
Accession NP_440250.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -324 -310 1.96621 0.179
NP_441061.1_2 Forward -141 -127 -1.5737 0.265
NP_441061.1_3 Forward -310 -291 13.47 0.292
NP_440557.1_1 Forward -348 -329 -2.45882 0.289
NP_440795.1_7 Reverse -128 -135 11.3472 0.0978
NP_441418.1_6 Reverse -292 -311 -28.3199 0.204
NP_441418.1_6 Reverse -229 -248 -30.7781 0.296
NP_440897.1_6 Reverse -315 -334 1.6703 0.17
NP_441453.1_4 Reverse -127 -135 7.19758 0.0757
NP_441453.1_4 Forward -136 -128 4.93597 0.224
NP_441453.1_4 Forward -54 -46 4.34598 0.257
NP_441453.1_7 Forward -305 -298 12.1338 0.295
NP_441623.1_6 Forward -45 -26 11.7008 0.298
NP_441960.1_3 Reverse -112 -131 18.5709 0.116
NP_442151.1_6 Forward -136 -122 15.2409 0.0251
NP_442151.1_6 Forward -316 -302 9.2427 0.155
NP_442151.1_6 Reverse -321 -335 7.47274 0.197
NP_440226.1_1 Reverse -127 -146 7.17762 0.111
NP_442623.1_1 Reverse -304 -323 -17.7985 0.292
NP_442173.1_1 Forward -135 -127 5.62429 0.206
NP_442173.1_1 Reverse -128 -136 4.73931 0.258
NP_442752.1_4 Reverse -127 -134 10.8555 0.0846
NP_443027.1_4 Forward -138 -128 13.4514 0.0521
NP_441812.1_8 Forward -228 -209 16.8651 0.284
NP_441225.1_4 Forward -329 -310 -3.54046 0.246
NP_440784.1_7 Forward -135 -128 12.4288 0.0475
NP_440784.1_7 Reverse -128 -135 6.23397 0.241
NP_440784.1_7 Forward -315 -308 5.84064 0.248
NP_442000.2_6 Reverse -46 -65 17.0107 0.151
NP_441476.1_5 Reverse -335 -354 1.67108 0.188
NP_441476.1_5 Reverse -224 -243 -0.197208 0.2
NP_442062.1_8 Forward -136 -126 4.79825 0.198
NP_441859.1_5 Forward -237 -218 2.65439 0.295
NP_440304.1_4 Reverse -125 -135 8.23984 0.0845
NP_441781.1_7 Forward -142 -123 3.53937 0.188
NP_441208.1_9 Forward -117 -103 8.25939 0.219
NP_441208.1_9 Reverse -124 -138 7.86607 0.219
NP_441208.1_9 Forward -234 -220 4.71948 0.291
NP_441925.1_4 Forward -323 -304 -4.91784 0.177
NP_441083.1_5 Reverse -384 -394 0.865012 0.218
NP_441083.1_5 Forward -136 -126 0.176696 0.241
NP_441558.1_5 Reverse -319 -338 5.80098 0.24
NP_440209.1_1 Reverse -127 -135 8.37755 0.0576
NP_441713.1_1 Reverse -121 -140 -2.75381 0.113
NP_440178.1_7 Reverse -126 -145 -12.2919 0.118
NP_442570.1_3 Reverse -299 -318 -5.70374 0.248
NP_441716.1_1 Reverse -127 -141 5.70279 0.22
NP_442111.1_4 Forward -137 -123 7.37441 0.0975
NP_442111.1_4 Reverse -126 -140 2.45787 0.276
NP_441163.1_1 Forward -350 -333 9.37954 0.226
NP_440906.1_5 Reverse -128 -135 6.23397 0.234
NP_440906.1_5 Forward -135 -128 6.0373 0.262
NP_440747.1_10 Reverse -124 -136 -4.18925 0.0817
NP_442973.1_5 Reverse -319 -338 10.7175 0.27
NP_441486.1_1 Forward -139 -125 9.93102 0.0235
NP_441486.1_1 Reverse -42 -56 -0.688726 0.16
NP_440944.1_2 Reverse -328 -347 4.03102 0.211
NP_442634.1_1 Reverse -338 -357 15.8307 0.247
NP_442634.1_4 Reverse -125 -139 3.93283 0.0923
NP_440403.1_10 Reverse -118 -137 7.27595 0.208
NP_441014.1_5 Reverse -211 -229 14.0805 0.2
NP_442848.1_5 Forward -131 -113 1.78911 0.276
NP_443018.1_3 Reverse -128 -135 13.8055 0.024
NP_443018.1_3 Forward -135 -128 13.6088 0.0352
NP_443018.1_3 Forward -53 -46 12.5271 0.0523
NP_443018.1_3 Reverse -46 -53 12.5271 0.0523
NP_441634.1_8 Reverse -285 -299 0.687908 0.219
NP_440376.1_1 Reverse -127 -136 6.48957 0.0963
NP_440376.1_1 Reverse -333 -342 1.47469 0.251
NP_440376.1_1 Forward -136 -127 -0.196935 0.285
NP_442687.1_7 Reverse -228 -238 11.2881 0.0994
NP_442687.1_7 Reverse -104 -114 10.1081 0.0994
NP_441846.1_10 Reverse -292 -311 -22.42 0.259
NP_441846.1_10 Reverse -117 -136 -23.6983 0.295
NP_441013.1_2 Reverse -296 -314 -4.40575 0.298
NP_441682.1_2 Forward -129 -110 1.57275 0.241
NP_441422.1_7 Forward -318 -301 -3.20608 0.23
NP_441950.1_6 Forward -322 -303 25.073 0.00402
NP_442296.1_5 Forward -145 -126 1.27776 0.286
NP_441763.1_5 Forward -134 -115 -1.67217 0.234
NP_442658.1_1 Reverse -125 -135 13.9425 0.0293
NP_440141.1_8 Reverse -301 -320 5.01433 0.278
NP_442782.1_2 Reverse -328 -342 1.57289 0.281
NP_440669.1_3 Reverse -200 -219 18.9238 0.237
NP_441414.1_9 Reverse -127 -146 -6.68705 0.201
NP_440607.1_1 Forward -69 -50 9.73422 0.272
NP_442300.1_10 Reverse -118 -137 8.84924 0.294
NP_442937.1_5 Reverse -224 -243 10.9142 0.151
NP_441958.1_5 Reverse -126 -136 1.65166 0.0872
NP_441958.1_5 Forward -137 -127 1.55333 0.095
NP_440203.1_5 Forward -133 -123 16.3025 0.0611
NP_440203.1_5 Forward -139 -129 11.5826 0.185
NP_440203.1_5 Reverse -260 -270 8.73102 0.288
NP_439905.1_1 Forward -315 -302 6.4108 0.288
NP_440984.1_7 Reverse -217 -231 6.3911 0.217
NP_442911.1_2 Forward -146 -127 6.68596 0.0279
NP_441591.1_10 Reverse -100 -119 13.4708 0.104
NP_441591.1_10 Forward -318 -299 5.11266 0.297
NP_442064.1_1 Reverse -122 -141 -13.4719 0.289
NP_440993.1_3 Forward -323 -304 7.37347 0.144
NP_440993.1_3 Forward -359 -340 5.70185 0.149
NP_440827.1_1 Reverse -304 -323 14.6508 0.24
NP_440602.1_4 Forward -324 -305 12.7825 0.112
NP_440138.1_6 Forward -230 -211 1.47364 0.284
NP_439975.1_3 Forward -178 -165 16.1456 0.231
NP_441348.1_3 Forward -141 -122 7.47261 0.256
NP_441294.1_7 Forward -140 -126 9.05865 0.263
NP_441646.1_1 Reverse -120 -139 1.0811 0.237
NP_442431.1_10 Reverse -301 -319 11.8189 0.0948
NP_442431.1_10 Reverse -304 -322 10.1472 0.12
NP_441550.1_8 Reverse -125 -135 7.94438 0.14
NP_441550.1_8 Forward -138 -128 6.66608 0.198
NP_441916.1_7 Reverse -127 -137 6.8632 0.0816
NP_440206.1_4 Forward -125 -106 5.40686 0.242
NP_441041.1_4 Reverse -127 -146 -2.95047 0.118
NP_441041.1_4 Reverse -316 -335 -10.6203 0.235
NP_441041.1_4 Forward -342 -323 -12.4886 0.266
NP_441041.1_4 Reverse -115 -134 -13.0786 0.28
NP_441041.1_4 Reverse -292 -311 -13.2752 0.285
NP_441041.1_7 Forward -250 -238 4.98816 0.282
NP_442004.1_6 Forward -142 -128 1.47456 0.288
NP_441725.1_5 Forward -135 -125 9.22315 0.0553
NP_441725.1_5 Reverse -128 -138 0.668351 0.156
NP_441725.1_5 Reverse -46 -56 0.176696 0.206
NP_439966.1_7 Forward -27 -17 11.1893 0.0709
NP_439966.1_7 Forward -138 -128 8.63269 0.132
NP_442941.1_3 Reverse -128 -138 0.766681 0.171
NP_440260.1_8 Forward -339 -321 -6.37237 0.29
NP_441678.1_9 Forward -366 -347 -4.22878 0.292
NP_442281.1_1 Reverse -122 -136 8.25877 0.0832
NP_442281.1_1 Forward -59 -45 5.50552 0.155
NP_442012.1_1 Forward -130 -111 0.491109 0.237
NP_440498.1_1 Forward -145 -127 -2.73412 0.245
NP_443030.1_4 Forward -148 -129 0.687771 0.222
NP_441644.1_6 Reverse -127 -137 14.9258 0.00847
NP_441644.1_6 Forward -54 -44 9.12434 0.084
NP_441644.1_6 Forward -136 -126 4.60114 0.233
NP_441644.1_6 Forward -231 -221 3.12618 0.297
NP_443049.1_6 Reverse -126 -136 11.7385 0.24
NP_442215.1_2 Reverse -103 -119 1.5335 0.132
NP_442215.1_2 Forward -138 -122 -3.08806 0.209
NP_442215.1_2 Forward -63 -47 -6.33298 0.268
NP_440929.1_8 Reverse -127 -136 7.66954 0.0624
NP_440929.1_8 Forward -136 -127 7.57121 0.0706
NP_442933.1_10 Reverse -127 -136 5.70292 0.165
NP_441751.2_8 Forward -135 -121 -3.24533 0.137
NP_442554.1_8 Forward -135 -125 13.1564 0.0193
NP_442554.1_8 Reverse -128 -138 12.5664 0.0248
NP_442554.1_8 Forward -53 -43 10.6981 0.0438
NP_442554.1_8 Reverse -46 -56 3.02829 0.245
NP_441762.1_7 Reverse -15 -27 -3.50094 0.11
NP_442142.1_4 Forward -313 -300 6.0169 0.175
NP_442292.1_1 Reverse -128 -137 7.17789 0.0777
NP_442292.1_1 Forward -135 -126 6.5879 0.101
NP_442292.1_1 Forward -53 -44 5.21127 0.152
NP_443009.1_5 Reverse -126 -137 6.05637 0.177
NP_443009.1_5 Forward -137 -126 5.36805 0.206
NP_443009.1_5 Reverse -291 -302 4.8764 0.226
NP_443009.1_5 Forward -301 -290 3.49977 0.292
NP_441715.1_4 Reverse -220 -230 5.78156 0.18
NP_441448.1_1 Forward -249 -230 8.35759 0.206
NP_441448.1_1 Forward -371 -352 6.19431 0.251
NP_440183.1_9 Reverse -113 -132 -19.8634 0.282
NP_441198.1_8 Forward -138 -128 11.2205 0.217
NP_441198.1_8 Reverse -130 -140 10.3415 0.28
NP_441198.1_8 Reverse -125 -135 10.2438 0.289
NP_440379.1_5 Reverse -306 -325 -8.06369 0.25
NP_441468.1_1 Reverse -128 -135 13.8055 0.0242
NP_441468.1_1 Forward -135 -128 6.0373 0.223
NP_441468.1_1 Reverse -46 -53 3.97235 0.277
NP_441468.1_1 Forward -53 -46 3.97235 0.277
NP_441015.1_10 Reverse -302 -321 0.786102 0.165
NP_441015.1_10 Reverse -7 -26 -10.4236 0.284
NP_441015.1_10 Reverse -299 -318 -10.817 0.288
NP_441673.1_1 Reverse -127 -136 1.37636 0.114
NP_441673.1_1 Forward -136 -127 1.1797 0.163
NP_441826.1_2 Reverse -121 -135 -3.73699 0.286
NP_442719.1_2 Reverse -159 -177 -10.3063 0.272
NP_441251.1_7 Forward -368 -355 13.884 0.266
NP_441056.1_1 Forward -136 -117 -7.67036 0.275
NP_442227.1_2 Forward -317 -298 2.75272 0.223
NP_442227.1_2 Forward -323 -304 -3.14714 0.289
NP_442808.1_1 Forward -127 -117 1.84789 0.281
NP_442808.1_1 Reverse -256 -266 1.45457 0.285
NP_442050.1_5 Forward -138 -128 8.04271 0.243
NP_442050.1_5 Forward -326 -316 7.0594 0.27
NP_441114.1_3 Forward -134 -125 7.57121 0.231
NP_440558.1_2 Forward -340 -321 1.57275 0.178
NP_440558.1_2 Forward -139 -120 -3.04881 0.232
NP_440558.1_2 Forward -145 -126 -4.72043 0.248
NP_440558.1_2 Forward -241 -222 -6.98204 0.284
NP_442576.1_2 Reverse -28 -47 9.0459 0.255
NP_441878.1_6 Reverse -126 -136 11.4848 0.0176
NP_441878.1_6 Forward -55 -45 0.766681 0.134
NP_441878.1_6 Forward -137 -127 -0.314959 0.174
NP_440614.1_1 Forward -86 -67 11.9958 0.239
NP_441557.1_5 Forward -136 -127 7.57121 0.049
NP_441557.1_5 Reverse -127 -136 1.08137 0.0794
NP_442183.1_1 Reverse -16 -30 9.73436 0.094
NP_441549.1_9 Forward -31 -13 -10.5023 0.279
NP_442347.1_10 Forward -119 -105 15.5352 0.224
NP_442645.1_2 Forward -144 -125 -14.6519 0.177
NP_442645.1_2 Reverse -331 -350 -18.2901 0.27
NP_442965.1_2 Reverse -317 -336 -5.80207 0.255
NP_442965.1_3 Forward -144 -125 -0.295539 0.218
NP_440547.1_1 Reverse -110 -129 7.76679 0.281
NP_441037.1_4 Reverse -125 -135 16.0889 0.0175
NP_441633.1_3 Reverse -227 -240 0.117615 0.132
NP_441633.1_3 Forward -318 -305 -5.68391 0.236
NP_440136.1_2 Reverse -128 -135 6.52896 0.116
NP_440136.1_2 Forward -135 -128 6.13563 0.193
NP_442998.1_5 Forward -291 -281 9.7148 0.236
NP_442998.1_5 Forward -258 -248 9.51814 0.238
NP_442998.1_10 Forward -236 -229 10.4622 0.0819
NP_442998.1_10 Forward -134 -127 6.13563 0.181
NP_440299.1_1 Forward -140 -127 4.34528 0.209
NP_441007.1_10 Reverse -302 -315 0.117615 0.25
NP_442334.1_2 Reverse -117 -134 -13.7275 0.297
NP_442201.1_10 Reverse -116 -135 -14.6519 0.285
NP_441229.1_2 Reverse -251 -270 20.8447 0.195
NP_441229.1_10 Forward -40 -21 -1.47551 0.288
NP_441362.1_5 Reverse -29 -47 16.8831 0.144
NP_441512.1_4 Forward -140 -121 11.5042 0.237
NP_441559.1_8 Reverse -287 -301 2.94952 0.143
NP_441559.1_8 Forward -199 -185 -5.70361 0.27
NP_441559.1_8 Reverse -286 -300 -6.19526 0.275
NP_441559.1_8 Forward -330 -316 -6.68692 0.279
NP_440915.1_6 Reverse -123 -137 4.62115 0.0953
NP_442785.1_7 Reverse -331 -345 8.84938 0.285
NP_441866.1_3 Forward -93 -80 17.9155 0.176
NP_441464.1_10 Forward -268 -254 8.16106 0.287
NP_441494.1_6 Forward -342 -329 5.52582 0.3
NP_439985.1_7 Forward -142 -123 7.17762 0.19
NP_442386.1_9 Reverse -44 -53 9.04574 0.175
NP_442386.1_9 Reverse -315 -324 5.60418 0.245
NP_441340.1_5 Forward -135 -128 13.5105 0.0314
NP_441340.1_5 Reverse -322 -329 8.8889 0.084
NP_441340.1_5 Reverse -128 -135 6.23397 0.132
NP_441340.1_5 Reverse -46 -53 4.07068 0.239
NP_441340.1_5 Forward -53 -46 4.07068 0.239
NP_442791.1_5 Reverse -299 -318 -5.60541 0.279
NP_440251.1_8 Forward -60 -46 19.5675 0.142
NP_441160.1_9 Forward -324 -305 10.9142 0.193
NP_440586.1_8 Forward -135 -128 11.3468 0.0736
NP_440586.1_8 Reverse -128 -135 9.47853 0.146
NP_440586.1_8 Forward -53 -46 7.61025 0.227
NP_440586.1_8 Reverse -46 -53 7.61025 0.227
NP_441262.1_3 Reverse -127 -134 5.25066 0.215
NP_443051.1_1 Reverse -126 -135 8.35786 0.0371
NP_443051.1_1 Forward -137 -128 7.66954 0.0571
NP_443039.1_7 Forward -211 -197 5.40719 0.227
NP_440439.1_1 Forward -139 -126 0.805932 0.175
NP_440372.1_2 Reverse -128 -135 6.62729 0.151
NP_440372.1_2 Forward -135 -128 6.52896 0.188
NP_440316.1_10 Reverse -126 -136 7.25653 0.251
NP_441803.1_2 Forward -119 -100 1.86774 0.223
NP_441572.1_7 Reverse -121 -140 6.88262 0.0785
NP_442887.1_5 Forward -344 -325 -6.09707 0.264
NP_442384.1_10 Reverse -127 -140 5.52582 0.127
NP_442384.1_10 Reverse -307 -320 2.77255 0.213
NP_441877.1_7 Forward -321 -302 6.1935 0.218
NP_442262.1_2 Forward -61 -42 19.2142 0.184
NP_442262.1_10 Reverse -128 -135 13.0188 0.0314
NP_442262.1_10 Forward -135 -128 11.6422 0.092
NP_442262.1_10 Forward -53 -46 10.4622 0.145
NP_442262.1_10 Reverse -46 -53 10.4622 0.145
NP_440344.1_10 Forward -32 -15 -13.1375 0.276
NP_441060.1_1 Reverse -229 -248 13.4473 0.294
NP_440189.1_10 Forward -40 -21 3.53937 0.279
NP_440297.1_9 Reverse -46 -56 10.5014 0.0917
NP_440297.1_9 Forward -135 -125 9.91146 0.0917
NP_440297.1_9 Reverse -128 -138 9.22315 0.0917
NP_440297.1_9 Forward -53 -43 0.176696 0.282
NP_440894.1_10 Reverse -227 -246 2.65439 0.286
NP_440937.1_5 Forward -244 -225 17.404 0.249
NP_441894.1_1 Forward -223 -204 -2.95047 0.155
NP_440999.1_9 Reverse -101 -115 5.21113 0.113
NP_440999.1_9 Forward -320 -306 -1.47537 0.239
NP_440888.1_2 Reverse -291 -305 7.86545 0.179
NP_440888.1_2 Forward -114 -100 6.39049 0.236
NP_440888.1_2 Reverse -315 -329 5.01387 0.298
NP_440491.1_1 Forward -316 -297 8.86616 0.226
NP_439969.1_3 Reverse -122 -141 1.96607 0.249
NP_441917.1_2 Reverse -313 -331 4.83737 0.288
NP_441543.1_2 Forward -135 -126 7.07956 0.131
NP_442845.1_2 Reverse -105 -119 5.89945 0.22
NP_442845.1_2 Forward -60 -46 5.70279 0.225
NP_442845.1_2 Reverse -216 -230 5.01447 0.247
NP_442845.1_2 Reverse -121 -135 4.42448 0.259
NP_442845.1_6 Forward -219 -200 12.9783 0.248
NP_441469.1_8 Reverse -126 -135 12.1928 0.123
NP_441469.1_8 Forward -137 -128 5.70292 0.257
NP_442578.1_7 Reverse -103 -110 6.72562 0.18
NP_440710.1_1 Reverse -69 -87 -7.06068 0.232
NP_440071.1_5 Reverse -298 -317 8.94757 0.276
NP_440220.1_4 Reverse -32 -51 -1.57461 0.264
NP_441462.1_2 Reverse -127 -137 1.65166 0.0831
NP_441462.1_2 Forward -136 -126 0.471689 0.148
NP_443062.1_1 Reverse -127 -145 8.54592 0.152
NP_443062.1_1 Forward -136 -118 7.76586 0.168
NP_441601.1_4 Forward -308 -289 0.786102 0.262
NP_442204.1_1 Reverse -123 -134 9.79344 0.0736
NP_442204.1_5 Reverse -219 -238 3.53937 0.187
NP_441351.1_8 Forward -240 -221 11.8975 0.141
NP_440516.1_8 Reverse -127 -136 -0.196935 0.185
NP_442428.1_5 Reverse -128 -135 14.1988 0.0242
NP_442428.1_5 Forward -135 -128 6.0373 0.212
NP_442428.1_5 Forward -53 -46 4.36568 0.271
NP_442428.1_5 Reverse -46 -53 4.36568 0.271
NP_441790.1_3 Reverse -128 -147 1.57275 0.181
NP_442120.1_10 Reverse -334 -353 -13.1769 0.28
NP_441867.1_2 Reverse -331 -350 -12.9802 0.276
NP_440673.1_2 Forward -242 -223 9.80428 0.234
NP_440673.1_3 Forward -134 -127 11.6422 0.0724
NP_441052.1_2 Forward -316 -306 12.1731 0.0285
NP_440992.1_2 Forward -354 -335 9.43923 0.273
NP_440436.1_4 Forward -135 -126 12.979 0.0276
NP_440436.1_4 Forward -120 -111 6.09583 0.172
NP_440314.1_9 Forward -135 -116 -9.14533 0.26
NP_441719.1_4 Reverse -128 -135 6.62729 0.151
NP_441719.1_4 Forward -135 -128 6.52896 0.188
NP_442813.1_4 Forward -275 -256 -2.65548 0.279
NP_442366.1_3 Forward -137 -119 -4.70074 0.275
NP_442873.1_3 Forward -137 -118 5.70185 0.248
NP_443029.1_8 Forward -355 -336 10.7175 0.293
NP_441228.1_2 Forward -132 -113 20.8447 0.0199
NP_441851.1_7 Reverse -110 -129 6.78429 0.286
NP_441851.1_10 Reverse -126 -136 15.8113 0.00552
NP_441851.1_10 Reverse -44 -54 4.10993 0.287
NP_441668.1_4 Reverse -117 -136 6.09597 0.163
NP_441668.1_4 Reverse -318 -337 -0.295539 0.251
NP_441661.1_1 Forward -194 -175 9.93088 0.181
NP_440389.1_5 Reverse -215 -234 12.126 0.277
NP_442843.1_1 Forward -53 -34 -2.45882 0.203
NP_439960.1_4 Reverse -44 -63 12.4867 0.28
NP_440474.1_8 Reverse -128 -142 13.1753 0.0735
NP_441524.1_3 Reverse -189 -208 7.7676 0.0794
NP_440431.1_3 Forward -137 -118 -1.27885 0.155
NP_442450.1_5 Reverse -125 -135 7.64985 0.13
NP_442168.1_5 Forward -140 -121 -2.26216 0.264
NP_441873.1_6 Forward -167 -148 10.3242 0.257
NP_441570.1_1 Reverse -127 -145 -7.55234 0.0914
NP_441078.1_4 Reverse -127 -136 7.66954 0.052
NP_441078.1_4 Forward -136 -127 0.491382 0.188
NP_441078.1_4 Forward -238 -229 -0.983583 0.213
NP_441078.1_4 Reverse -229 -238 -1.96689 0.282
NP_440539.1_9 Forward -230 -211 -5.70374 0.286
NP_441528.1_2 Reverse -117 -136 7.96345 0.292
NP_440526.1_3 Forward -135 -124 8.71129 0.116
NP_441432.1_8 Reverse -126 -135 5.60459 0.147
NP_441432.1_8 Forward -325 -316 5.40793 0.158
NP_441732.1_2 Reverse -123 -139 -16.2644 0.165
NP_441030.1_6 Reverse -125 -144 12.0813 0.248
NP_441945.1_10 Reverse -291 -310 14.3558 0.168
NP_440913.1_3 Forward -313 -300 14.4739 0.246
NP_440713.1_4 Reverse -323 -342 0.884433 0.3
NP_442489.1_7 Reverse -127 -136 8.1612 0.0294
NP_442489.1_7 Forward -136 -127 0.491382 0.178
NP_442489.1_7 Forward -238 -229 -1.77023 0.247
NP_441830.1_2 Reverse -112 -131 -2.36049 0.275
NP_440559.1_1 Forward -135 -126 7.66954 0.0999
NP_441659.2_8 Reverse -127 -137 7.84651 0.054
NP_441659.2_8 Forward -136 -126 7.74818 0.0566
NP_441659.2_8 Forward -54 -44 0.766681 0.258
NP_440363.1_9 Reverse -112 -130 13.7855 0.249
NP_441040.1_5 Reverse -122 -141 2.26107 0.287
NP_441800.1_3 Forward -135 -117 4.05072 0.289
NP_442346.1_5 Reverse -126 -136 15.9097 0.00378
NP_442346.1_5 Forward -55 -45 12.5664 0.0394
NP_442346.1_5 Forward -137 -127 5.68323 0.234
NP_442346.1_5 Reverse -44 -54 4.79825 0.272
NP_440545.1_3 Reverse -123 -140 17.9351 0.0107
NP_440545.1_3 Forward -140 -123 5.05372 0.0646
NP_440545.1_3 Forward -334 -317 -6.25434 0.273
NP_441856.1_1 Forward -275 -256 6.98095 0.263
NP_441856.1_6 Reverse -227 -241 15.2409 0.265
NP_440831.1_3 Reverse -9 -28 10.8527 0.166
NP_440250.1_1 Forward -64 -46 24.8969 0.0116
NP_440250.1_3 Forward -296 -277 24.483 0.0219
NP_440250.1_4 Forward -374 -355 22.418 0.0222
NP_440459.1_2 Reverse -103 -120 7.512 0.288
NP_442027.1_5 Reverse -203 -222 10.4225 0.283
NP_442551.1_4 Forward -259 -244 -2.38005 0.259
NP_440847.1_3 Forward -280 -266 15.3386 0.18
NP_440170.1_6 Forward -342 -323 14.8474 0.184
NP_441833.1_4 Reverse -128 -135 6.23397 0.163
NP_441833.1_4 Forward -135 -128 6.13563 0.198
NP_441329.1_6 Reverse -364 -383 -1.28956 0.292
NP_441895.1_10 Forward -181 -162 -27.4349 0.282
NP_442699.1_3 Forward -37 -18 4.916 0.177
NP_442162.1_9 Reverse -128 -135 6.62729 0.142
NP_442162.1_9 Forward -135 -128 6.43063 0.208
NP_440671.1_4 Reverse -121 -135 8.75105 0.191
NP_442140.1_3 Forward -135 -125 9.7148 0.103
NP_442140.1_3 Forward -53 -43 6.46988 0.168
NP_442723.1_1 Reverse -241 -260 3.14526 0.278
NP_441813.1_5 Forward -138 -128 5.28991 0.138
NP_442254.1_1 Forward -66 -47 0.392778 0.249
NP_440590.1_4 Forward -237 -224 -2.63565 0.247
NP_440590.1_4 Reverse -223 -236 -4.89726 0.269
NP_440590.1_4 Forward -135 -122 -5.29059 0.277
NP_442497.1_10 Forward -135 -126 10.0295 0.0222
NP_442497.1_10 Reverse -128 -137 5.99792 0.095
NP_440821.1_4 Reverse -125 -135 1.25834 0.139
NP_440821.1_4 Forward -138 -128 0.668351 0.159
NP_441239.1_9 Forward -138 -126 16.2636 0.0175
NP_441239.1_9 Forward -56 -44 6.1355 0.2
NP_441239.1_9 Reverse -125 -137 6.1355 0.2
NP_441239.1_9 Reverse -43 -55 4.75886 0.243
NP_441009.1_4 Reverse -316 -335 13.5691 0.209
NP_441892.1_1 Reverse -118 -135 8.7903 0.0763
NP_441017.1_6 Forward -58 -44 14.7486 0.138
NP_442052.1_8 Reverse -125 -135 14.0414 0.253
NP_442809.1_6 Reverse -315 -334 1.76941 0.27
NP_442809.1_6 Reverse -328 -347 1.47442 0.272
NP_442479.1_9 Reverse -355 -374 -8.94866 0.266
NP_440905.1_1 Forward -29 -11 1.88744 0.259
NP_442402.1_4 Forward -234 -215 -5.90115 0.249
NP_442402.1_10 Forward -225 -215 10.796 0.282
NP_441084.1_6 Forward -186 -172 10.0228 0.255
NP_440653.1_10 Reverse -121 -140 6.78429 0.203
NP_440653.1_10 Forward -336 -317 4.62101 0.249
NP_439942.1_7 Reverse -279 -298 -3.73712 0.248
NP_440696.1_6 Forward -243 -224 3.04771 0.292
NP_442923.1_4 Reverse -223 -242 9.43923 0.0739
NP_442039.1_4 Reverse -128 -135 6.3323 0.289
NP_441811.1_8 Reverse -301 -315 10.1277 0.22
NP_441811.1_8 Reverse -121 -135 6.78443 0.263
NP_442837.1_3 Reverse -128 -135 6.0373 0.25
NP_442837.1_3 Forward -135 -128 5.93897 0.265
NP_439994.1_4 Reverse -43 -62 11.1109 0.239
NP_440505.1_3 Reverse -290 -300 8.33817 0.145
NP_440505.1_7 Reverse -73 -92 -1.18052 0.271
NP_441252.1_6 Reverse -337 -344 11.6422 0.288
NP_441408.2_7 Reverse -103 -122 -5.50708 0.295
NP_440914.1_1 Reverse -127 -137 12.9091 0.0435
NP_440914.1_1 Forward -342 -332 9.49342 0.186
NP_440914.1_1 Reverse -316 -326 6.17532 0.293
NP_441011.1_8 Reverse -128 -137 5.40793 0.263
NP_442533.1_1 Reverse -6 -25 -17.5035 0.289
NP_442533.1_6 Forward -136 -127 7.66954 0.0897
NP_442533.1_6 Reverse -127 -136 6.8829 0.101
NP_442533.1_6 Reverse -45 -54 4.62128 0.179
NP_442533.1_6 Forward -342 -333 3.34298 0.216
NP_442533.1_6 Forward -231 -222 2.75299 0.241
NP_442541.1_10 Forward -130 -116 1.37564 0.287
NP_442232.1_3 Reverse -299 -318 -9.93197 0.264
NP_442232.1_3 Reverse -124 -143 -10.227 0.266
NP_442322.1_9 Reverse -162 -180 12.3097 0.251
NP_442229.1_1 Forward -138 -124 7.27547 0.196
NP_441482.1_7 Reverse -121 -135 -8.75187 0.193
NP_439944.1_9 Reverse -128 -138 12.9597 0.0776
NP_441028.1_6 Reverse -170 -180 17.1874 0.132
NP_440116.1_8 Forward -135 -116 -5.60541 0.194
NP_441527.1_4 Reverse -367 -386 -10.6478 0.272
NP_440007.1_9 Reverse -123 -137 14.4542 0.163
NP_441059.1_7 Forward -339 -320 16.0274 0.139
NP_441602.1_3 Forward -243 -224 2.55606 0.198
NP_441106.1_1 Reverse -126 -135 6.5879 0.0893
NP_439903.1_6 Forward -340 -321 -0.689632 0.284
NP_442588.1_6 Reverse -109 -128 -2.45882 0.294
NP_442588.1_9 Reverse -15 -29 19.1741 0.271
NP_441286.1_1 Reverse -278 -290 1.12062 0.0972
NP_441286.1_1 Forward -137 -125 -5.07423 0.188
NP_441286.1_1 Reverse -44 -56 -6.15587 0.251
NP_440670.1_8 Reverse -127 -136 6.78456 0.099
NP_440670.1_8 Forward -136 -127 5.3096 0.167
NP_440670.1_8 Forward -238 -229 3.44131 0.267
NP_440886.1_7 Forward -317 -307 7.0594 0.106
NP_440828.1_1 Forward -314 -295 4.12856 0.219
NP_440828.1_4 Forward -137 -118 -8.26108 0.296
NP_442614.1_2 Reverse -127 -141 5.80112 0.297
NP_442382.1_9 Forward -198 -179 9.43841 0.281
NP_442072.1_9 Forward -115 -97 -22.9903 0.271
NP_440907.2_8 Forward -135 -125 6.56775 0.161
NP_442264.1_2 Reverse -306 -323 6.62702 0.251
NP_441021.1_1 Forward -53 -34 -0.983855 0.108
NP_441021.1_1 Reverse -46 -65 -3.83545 0.162
NP_441626.1_2 Reverse -128 -135 6.52896 0.137
NP_441626.1_2 Forward -135 -128 5.93897 0.231
NP_442794.1_1 Forward -334 -322 13.6087 0.0721
NP_442794.1_1 Reverse -123 -135 9.97041 0.0742
NP_442615.1_1 Reverse -220 -238 -6.56903 0.252
NP_441962.1_4 Reverse -302 -321 -14.6519 0.291
NP_440387.1_1 Reverse -127 -143 -3.38305 0.158
NP_441431.1_2 Forward -340 -326 7.27547 0.244
NP_441488.1_8 Reverse -122 -136 10.422 0.146
NP_440114.1_4 Reverse -332 -351 18.6823 0.11
NP_440114.1_10 Reverse -127 -141 11.6026 0.107
NP_440293.1_3 Reverse -119 -138 -1.57384 0.239
NP_441237.1_9 Forward -135 -125 16.893 0.01
NP_442743.1_1 Reverse -165 -184 7.57013 0.264
NP_441311.1_4 Forward -31 -14 7.11867 0.298
NP_442103.1_2 Forward -310 -292 9.94979 0.246
NP_439911.1_2 Forward -111 -92 9.53756 0.217
NP_440457.1_1 Reverse -123 -135 6.82381 0.11
NP_440457.1_1 Forward -140 -128 -1.14099 0.294
NP_441801.1_4 Forward -202 -192 2.63497 0.29
NP_442680.1_5 Reverse -23 -42 8.66899 0.163
NP_440801.1_9 Forward -332 -318 13.9988 0.262
NP_440801.1_10 Reverse -12 -31 4.62101 0.289
NP_440942.1_6 Reverse -249 -268 6.78348 0.259
NP_442297.1_4 Reverse -123 -142 13.9886 0.214
NP_440554.1_4 Reverse -128 -138 7.64985 0.101
NP_442341.1_7 Reverse -228 -242 2.5562 0.252
NP_442341.1_7 Forward -115 -101 1.86788 0.278
NP_442341.1_9 Forward -138 -124 17.4035 0.0269
NP_442341.1_9 Reverse -331 -345 4.62054 0.296
NP_441173.1_9 Reverse -250 -258 11.7204 0.226
NP_441173.1_9 Reverse -171 -179 11.3271 0.226
NP_441173.1_9 Forward -380 -372 10.9338 0.242
NP_442395.2_4 Reverse -257 -276 -0.00131823 0.28
NP_440275.1_3 Forward -149 -139 1.84832 0.282
NP_440679.1_7 Forward -353 -334 16.7157 0.274
NP_440679.1_10 Reverse -300 -319 -3.54046 0.143
NP_440149.1_8 Reverse -3 -22 -7.57203 0.288
NP_441105.1_3 Reverse -116 -135 4.03102 0.0844
NP_441105.1_3 Reverse -40 -59 -10.0303 0.3
NP_440216.1_1 Reverse -127 -141 -11.8001 0.219
NP_440216.1_9 Forward -52 -43 15.4377 0.132
NP_440216.1_9 Forward -294 -285 12.7828 0.223
NP_440216.1_9 Reverse -323 -332 5.50626 0.292
NP_440172.1_1 Reverse -127 -137 8.23984 0.0653
NP_442015.1_10 Reverse -123 -136 8.47575 0.0654
NP_441226.1_7 Forward -135 -128 14.1984 0.024
NP_442222.1_3 Reverse -212 -231 15.6341 0.198
NP_441111.1_7 Forward -135 -127 8.86921 0.0589
NP_442379.1_10 Forward -143 -126 -2.81276 0.245
NP_441766.1_2 Forward -136 -127 6.39124 0.0993
NP_440416.1_9 Forward -143 -124 -15.9302 0.204
NP_440416.1_9 Forward -131 -112 -19.9617 0.281
NP_443052.1_9 Forward -317 -298 6.39097 0.138
NP_440072.1_5 Reverse -298 -316 -1.35749 0.258
NP_442154.1_1 Reverse -299 -317 -11.3872 0.214
NP_440261.1_5 Forward -135 -122 -2.93064 0.0983
NP_440988.1_5 Forward -293 -274 18.8059 0.16
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGTCAGGCTGATCTGTTTATTCTGCCCACCTTTAGTGAAAACTTTGGCGTCGTAGTTGCCGAAGCCCTTTCCTATGGCATTCCCGTCATCACCACCACTGGGACTCCCTGGCAAGATCTCCAAACTTACCGTTGTGGTTGGTGGGTAGAACCGACAGTTGCGACTATTGCCGATGCTCTCCAGCAAGCAACAATTCTACATCCCCAGGAATTACGAACTATGGGGGAAAGAGGTAGAGCATACGTCAAATGCTACGACTGGAATGCCATCGCCCAGGACACCCTTGCCGTTTACCGCTGGATTCTGAATCAGGGACCAAAACCTGACTGCGTTATCTTGGACTAGAGCCATGGCAAGTTTTCTAGCTTTACTGCCCCGCTCCCTGACGACGTTTCCCTT

CDS

ATGAAAAAAGTAACCATGACAGTCACTCCCAAGCAAATTTATAACTATACTGTTCTTCTAGAAAAAGAGCTTGATGGCGGTTATCACGCCTTTTGCCCAATGCTCAAAGGATGCCATTCCCAAGGAGACACCTTTGAAGAAGCCATACAAAACATTACAGAGGCTATTGAACTATACATTGAAAGCTTGATAGCCGAACATCAGCCCGTTCCTAAGGAAGATTTAATTGTCAAACCATTGAGTATTTTGGTGTGA

Protein

MKKVTMTVTPKQIYNYTVLLEKELDGGYHAFCPMLKGCHSQGDTFEEAIQNITEAIELYIESLIAEHQPVPKEDLIVKPLSILV