Your browser is old and dusty. Try Google Chrome!

Details for ssr1736

ORF ssr1736
Accession NP_440354.1
Symbol rpl32
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L32
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -254 -268 -2.45868 0.293
NP_440795.1_7 Forward -261 -254 14.6904 0.0123
NP_440795.1_7 Reverse -254 -261 14.6904 0.0123
NP_442100.1_4 Forward -133 -114 12.585 0.258
NP_441418.1_6 Forward -262 -243 7.7676 0.00575
NP_441418.1_6 Forward -187 -168 -29.3032 0.221
NP_441480.1_1 Forward -248 -229 -0.4922 0.287
NP_441453.1_1 Reverse -171 -189 8.86816 0.18
NP_441453.1_4 Forward -262 -254 16.539 0.00633
NP_441453.1_4 Reverse -253 -261 7.8859 0.0536
NP_441453.1_4 Forward -187 -179 6.80426 0.121
NP_441453.1_4 Reverse -178 -186 6.11594 0.121
NP_441453.1_4 Reverse -55 -63 4.14932 0.264
NP_441453.1_7 Forward -197 -190 14.1988 0.175
NP_441623.1_1 Reverse -189 -207 -3.6191 0.262
NP_442151.1_6 Reverse -253 -267 17.0108 0.013
NP_441818.1_9 Forward -205 -186 -9.63698 0.291
NP_441818.1_9 Forward -395 -376 -10.227 0.292
NP_440226.1_1 Reverse -253 -272 12.6841 0.0422
NP_440226.1_1 Forward -262 -243 10.1275 0.0654
NP_440226.1_1 Reverse -148 -167 5.99764 0.139
NP_440226.1_1 Reverse -178 -197 3.53937 0.221
NP_442169.1_1 Forward -340 -321 -2.85214 0.282
NP_441630.1_3 Forward -270 -251 1.96607 0.235
NP_440150.1_2 Reverse -326 -345 7.86512 0.234
NP_440150.1_6 Reverse -175 -194 0.982764 0.295
NP_442655.1_2 Forward -355 -336 10.3242 0.104
NP_442173.1_1 Reverse -254 -262 15.4574 0.00633
NP_442173.1_1 Reverse -179 -187 12.0158 0.0316
NP_442173.1_1 Forward -261 -253 8.27922 0.101
NP_442173.1_1 Forward -186 -178 4.83764 0.241
NP_442752.1_4 Forward -262 -255 13.8055 0.0199
NP_442752.1_4 Forward -187 -180 13.8055 0.0199
NP_442752.1_4 Forward -205 -198 5.44732 0.202
NP_443027.1_4 Forward -264 -254 15.3197 0.0437
NP_441812.1_3 Reverse -252 -266 12.586 0.202
NP_442975.1_10 Reverse -249 -263 12.782 0.0459
NP_441470.1_6 Forward -171 -152 7.07928 0.201
NP_440784.1_7 Forward -261 -254 15.9687 0.0123
NP_440784.1_7 Reverse -254 -261 15.9687 0.0123
NP_440784.1_7 Forward -186 -179 6.23397 0.241
NP_440784.1_7 Reverse -179 -186 6.13563 0.241
NP_440061.1_9 Reverse -358 -372 7.17714 0.216
NP_442062.1_8 Reverse -55 -65 11.9764 0.0377
NP_442062.1_8 Forward -262 -252 11.1898 0.0493
NP_442062.1_8 Forward -205 -195 3.12662 0.285
NP_441859.1_3 Forward -263 -244 5.99684 0.185
NP_441859.1_3 Reverse -252 -271 1.17865 0.293
NP_440304.1_4 Forward -264 -254 18.9579 0.00406
NP_442242.1_4 Forward -261 -254 14.3954 0.0124
NP_442242.1_4 Reverse -254 -261 14.3954 0.0124
NP_440044.1_8 Forward -63 -44 0.294447 0.202
NP_441492.1_1 Forward -176 -157 12.7825 0.148
NP_439918.1_2 Forward -363 -344 15.1424 0.0732
NP_439918.1_2 Forward -357 -338 13.6675 0.0941
NP_439918.1_2 Forward -369 -350 5.50599 0.156
NP_439918.1_2 Forward -351 -332 -2.95047 0.251
NP_441200.1_4 Forward -196 -177 7.17762 0.272
NP_441200.1_6 Reverse -377 -394 12.3302 0.273
NP_441208.1_1 Reverse -254 -273 -4.81876 0.263
NP_442110.1_7 Forward -364 -350 -0.197071 0.276
NP_441925.1_4 Reverse -361 -380 -15.3409 0.263
NP_440273.1_3 Forward -362 -343 6.68596 0.232
NP_441083.1_5 Reverse -253 -263 10.0098 0.0214
NP_441083.1_5 Reverse -178 -188 8.73149 0.0307
NP_441083.1_5 Forward -262 -252 1.65166 0.2
NP_441083.1_5 Reverse -321 -331 0.275027 0.237
NP_441083.1_5 Forward -187 -177 -0.904945 0.283
NP_442827.1_8 Reverse -245 -264 7.4718 0.0962
NP_441738.1_2 Reverse -255 -262 15.28 0.0102
NP_441738.1_2 Reverse -180 -187 15.28 0.0102
NP_441738.1_2 Reverse -198 -205 10.2652 0.101
NP_441738.1_2 Forward -16 -9 6.03696 0.295
NP_441558.1_5 Forward -264 -245 10.2259 0.102
NP_440209.1_1 Forward -262 -254 18.1123 0.00295
NP_440209.1_1 Reverse -253 -261 15.1624 0.00583
NP_440209.1_1 Forward -187 -179 8.57422 0.0425
NP_440209.1_1 Reverse -178 -186 5.52596 0.0821
NP_440655.1_2 Forward -293 -274 5.50599 0.293
NP_442889.1_8 Reverse -333 -347 3.04726 0.291
NP_441713.1_1 Reverse -172 -191 7.17762 0.0568
NP_441713.1_1 Forward -268 -249 -16.7168 0.286
NP_441713.1_4 Reverse -250 -269 17.6007 0.125
NP_440178.1_7 Reverse -195 -214 -11.7019 0.0998
NP_442570.1_3 Forward -366 -347 0.982764 0.2
NP_442570.1_3 Forward -360 -341 -2.26216 0.212
NP_442570.1_3 Forward -354 -335 -3.24547 0.217
NP_442570.1_3 Forward -224 -205 -5.80207 0.25
NP_442570.1_3 Forward -72 -53 -9.047 0.296
NP_442570.1_3 Forward -206 -187 -9.63698 0.3
NP_441792.1_5 Reverse -348 -364 9.69497 0.234
NP_441716.1_1 Forward -262 -248 7.27608 0.173
NP_442111.1_4 Reverse -177 -191 9.43936 0.0609
NP_442111.1_4 Reverse -252 -266 3.73617 0.233
NP_441163.1_4 Reverse -349 -368 15.1471 0.255
NP_440343.1_9 Forward -197 -178 6.39097 0.3
NP_440851.1_6 Forward -226 -209 0.628827 0.288
NP_440906.1_5 Forward -261 -254 15.8704 0.0124
NP_440906.1_5 Reverse -254 -261 15.8704 0.0124
NP_440906.1_5 Forward -186 -179 6.23397 0.234
NP_440906.1_5 Reverse -179 -186 6.13563 0.241
NP_440747.1_10 Reverse -250 -262 -2.51763 0.0509
NP_440747.1_10 Forward -265 -253 -11.7607 0.142
NP_440747.1_10 Reverse -175 -187 -11.9574 0.178
NP_440747.1_10 Forward -190 -178 -12.0557 0.199
NP_441130.1_10 Reverse -176 -190 17.4042 0.0167
NP_441130.1_10 Reverse -251 -265 9.14437 0.128
NP_441486.1_1 Reverse -52 -66 -5.21195 0.226
NP_442634.1_4 Forward -189 -175 -0.590395 0.149
NP_442634.1_4 Reverse -251 -265 -3.63866 0.161
NP_441265.1_6 Reverse -304 -323 14.5516 0.215
NP_440842.1_5 Reverse -349 -368 12.9656 0.283
NP_440842.1_10 Reverse -212 -226 3.73617 0.255
NP_440057.1_8 Forward -178 -159 11.5042 0.298
NP_441014.1_8 Reverse -175 -194 -1.47551 0.224
NP_442848.1_5 Reverse -359 -377 2.47742 0.276
NP_443018.1_3 Forward -261 -254 14.8871 0.0123
NP_443018.1_3 Reverse -254 -261 14.8871 0.0123
NP_443018.1_3 Reverse -179 -186 11.7405 0.0655
NP_443018.1_3 Reverse -56 -63 10.7572 0.0907
NP_443018.1_3 Forward -186 -179 5.44732 0.193
NP_443018.1_3 Forward -63 -56 4.56234 0.241
NP_441316.1_7 Reverse -251 -266 7.64971 0.107
NP_441634.1_8 Forward -264 -250 -3.44199 0.295
NP_441634.1_8 Reverse -211 -225 -3.63866 0.295
NP_440376.1_1 Forward -262 -253 9.73449 0.0365
NP_440376.1_1 Reverse -253 -262 9.63616 0.0385
NP_440376.1_1 Forward -187 -178 5.99792 0.111
NP_440376.1_1 Forward -205 -196 3.7363 0.195
NP_440376.1_1 Forward -369 -360 0.786375 0.26
NP_440376.1_1 Reverse -178 -187 -0.196935 0.285
NP_442687.1_7 Reverse -252 -262 13.0581 0.0591
NP_442191.1_4 Forward -368 -354 14.0957 0.115
NP_442485.1_3 Reverse -242 -261 -1.67217 0.26
NP_442485.1_3 Forward -264 -245 -3.14714 0.272
NP_442485.1_3 Reverse -211 -230 -5.80207 0.296
NP_442946.1_7 Reverse -89 -104 11.9367 0.284
NP_441846.1_2 Reverse -351 -370 15.3382 0.19
NP_442958.1_3 Reverse -124 -143 -1.7705 0.29
NP_441013.1_2 Forward -198 -180 -4.99573 0.299
NP_441422.1_7 Reverse -251 -268 -1.63279 0.194
NP_441422.1_7 Reverse -176 -193 -5.86102 0.247
NP_440667.1_2 Forward -380 -361 -1.67217 0.232
NP_442296.1_9 Reverse -250 -269 -3.24547 0.249
NP_440360.1_10 Reverse -255 -269 3.73617 0.227
NP_442658.1_1 Forward -264 -254 15.9091 0.00966
NP_442658.1_1 Reverse -251 -261 14.9258 0.0188
NP_442658.1_1 Forward -66 -56 10.501 0.117
NP_442658.1_1 Reverse -194 -204 8.53436 0.189
NP_442198.1_7 Forward -190 -171 8.16011 0.298
NP_440446.1_9 Reverse -256 -275 17.7974 0.22
NP_442782.1_2 Forward -187 -173 10.6193 0.173
NP_442782.1_2 Forward -351 -337 1.27789 0.281
NP_442782.1_2 Reverse -77 -91 1.17956 0.282
NP_441414.1_9 Reverse -253 -272 5.89931 0.0437
NP_441414.1_9 Forward -187 -168 -9.047 0.252
NP_442937.1_5 Forward -374 -355 11.8975 0.126
NP_442937.1_5 Forward -335 -316 5.89931 0.295
NP_442321.1_4 Reverse -357 -376 -3.44213 0.276
NP_441958.1_5 Forward -263 -253 12.0747 0.00222
NP_441958.1_5 Forward -188 -178 9.81313 0.0174
NP_441958.1_5 Reverse -252 -262 2.43831 0.0422
NP_441127.1_1 Forward -225 -211 12.0943 0.215
NP_440450.1_7 Reverse -336 -350 15.8302 0.239
NP_439905.1_1 Reverse -254 -267 16.6372 0.0578
NP_439905.1_1 Reverse -179 -192 9.06573 0.224
NP_439905.1_1 Reverse -214 -227 8.86907 0.228
NP_440984.1_7 Forward -267 -253 22.1241 0.00244
NP_439990.1_5 Forward -267 -254 6.21414 0.249
NP_442911.1_2 Forward -272 -253 4.03102 0.0401
NP_440153.1_5 Forward -261 -247 0.687908 0.291
NP_442064.1_4 Reverse -87 -106 5.80018 0.264
NP_443055.1_6 Reverse -245 -263 0.0184138 0.251
NP_443055.1_6 Reverse -236 -254 -1.75153 0.284
NP_440993.1_2 Forward -267 -251 4.48343 0.255
NP_440993.1_4 Reverse -354 -371 3.97208 0.277
NP_441099.1_3 Forward -350 -331 4.52268 0.279
NP_442002.1_1 Forward -398 -380 -6.07737 0.249
NP_440809.1_9 Reverse -169 -187 -6.66736 0.225
NP_441294.1_7 Reverse -249 -263 13.2821 0.0711
NP_440411.1_10 Forward -372 -353 19.3377 0.186
NP_440411.1_10 Forward -371 -352 9.57854 0.286
NP_441646.1_1 Reverse -49 -68 1.17943 0.235
NP_441646.1_1 Forward -376 -357 -1.27885 0.281
NP_442438.1_10 Reverse -173 -187 4.91614 0.142
NP_441292.1_2 Forward -198 -179 -2.95047 0.219
NP_441000.1_6 Reverse -177 -191 12.1926 0.0468
NP_441000.1_6 Forward -263 -249 6.09611 0.0933
NP_440484.1_3 Forward -189 -175 9.93102 0.252
NP_440147.1_4 Reverse -251 -264 9.36073 0.041
NP_440147.1_4 Forward -264 -251 0.707601 0.247
NP_441295.1_4 Forward -267 -248 -1.67217 0.29
NP_441550.1_8 Forward -264 -254 17.4824 0.00754
NP_441550.1_8 Forward -189 -179 14.5325 0.0141
NP_441550.1_8 Reverse -251 -261 5.19112 0.26
NP_441550.1_8 Reverse -53 -63 4.69947 0.291
NP_441916.1_7 Reverse -253 -263 10.6981 0.0261
NP_441916.1_7 Forward -262 -252 9.12481 0.0396
NP_441916.1_7 Reverse -178 -188 1.06167 0.294
NP_441916.1_10 Reverse -230 -249 -0.0988766 0.298
NP_440206.1_4 Reverse -173 -192 -0.197979 0.29
NP_441041.1_4 Forward -369 -350 -3.54046 0.123
NP_441041.1_4 Forward -187 -168 -8.752 0.207
NP_441041.1_4 Forward -375 -356 -11.4069 0.246
NP_441041.1_7 Reverse -193 -205 12.9567 0.0549
NP_441041.1_7 Forward -265 -253 7.90349 0.154
NP_441041.1_7 Reverse -250 -262 5.95994 0.231
NP_440174.1_8 Forward -70 -51 13.3725 0.271
NP_440569.1_6 Forward -195 -176 2.0644 0.278
NP_442004.1_6 Reverse -178 -192 1.76955 0.278
NP_440703.1_9 Reverse -213 -226 6.41022 0.288
NP_441725.1_5 Reverse -254 -264 8.92815 0.0553
NP_441725.1_5 Reverse -56 -66 6.37155 0.115
NP_441725.1_5 Forward -261 -251 0.0783647 0.215
NP_441725.1_5 Forward -186 -176 -0.41329 0.251
NP_439966.1_7 Reverse -251 -261 18.6624 0.00473
NP_439966.1_7 Reverse -176 -186 18.1707 0.00631
NP_439966.1_7 Forward -264 -254 13.8442 0.0234
NP_439966.1_7 Forward -189 -179 4.60114 0.265
NP_439966.1_9 Reverse -251 -260 9.83282 0.215
NP_439966.1_9 Forward -207 -198 5.3096 0.253
NP_439966.1_9 Forward -264 -255 0.983037 0.253
NP_440202.1_8 Reverse -245 -264 10.4872 0.297
NP_442941.1_3 Reverse -254 -264 10.9931 0.0116
NP_442941.1_3 Reverse -179 -189 9.41981 0.0319
NP_442941.1_3 Forward -261 -251 1.35667 0.15
NP_440289.1_2 Reverse -250 -263 4.05085 0.0718
NP_440289.1_2 Reverse -244 -257 -4.7006 0.294
NP_440289.1_2 Reverse -175 -188 -5.19226 0.3
NP_440983.1_9 Forward -196 -177 0.786102 0.292
NP_440260.1_8 Forward -207 -189 2.96908 0.178
NP_442281.1_1 Reverse -248 -262 3.44058 0.231
NP_442281.1_1 Reverse -191 -205 2.5556 0.263
NP_442256.1_2 Reverse -251 -269 3.06741 0.107
NP_442256.1_2 Forward -264 -246 -9.81395 0.292
NP_440647.1_9 Reverse -251 -269 18.6037 0.0678
NP_442012.1_1 Reverse -49 -68 0.392778 0.241
NP_441457.1_7 Forward -264 -245 8.55425 0.146
NP_440375.1_8 Forward -197 -178 -1.37718 0.288
NP_441644.1_6 Reverse -253 -263 16.4008 0.00405
NP_441644.1_6 Reverse -178 -188 16.1058 0.0048
NP_441644.1_6 Reverse -55 -65 7.55106 0.123
NP_441644.1_6 Forward -262 -252 6.37109 0.161
NP_441644.1_6 Reverse -360 -370 4.20782 0.245
NP_443049.1_6 Forward -188 -178 12.3241 0.24
NP_443049.1_6 Forward -263 -253 11.7385 0.24
NP_441071.1_3 Forward -126 -107 5.70185 0.276
NP_442215.1_2 Reverse -53 -69 4.97508 0.0812
NP_442215.1_2 Forward -207 -191 -3.28472 0.213
NP_442215.1_2 Forward -218 -202 -7.51295 0.297
NP_442029.1_6 Forward -374 -355 10.0292 0.182
NP_442029.1_6 Forward -368 -349 8.45592 0.207
NP_442247.1_8 Reverse -251 -265 8.45605 0.272
NP_440253.1_2 Forward -262 -244 15.3588 0.0163
NP_440253.1_2 Reverse -148 -166 0.805796 0.176
NP_440929.1_8 Forward -262 -253 9.93116 0.0249
NP_440929.1_8 Reverse -253 -262 9.83282 0.0254
NP_440929.1_8 Reverse -178 -187 7.07956 0.0713
NP_442933.1_10 Forward -262 -253 9.04618 0.063
NP_442933.1_10 Reverse -253 -262 8.94785 0.0643
NP_441751.2_8 Reverse -254 -268 -4.4253 0.173
NP_441751.2_8 Reverse -179 -193 -4.4253 0.173
NP_442554.1_8 Reverse -254 -264 19.1546 0.00369
NP_442554.1_8 Reverse -179 -189 7.45319 0.092
NP_442554.1_8 Forward -261 -251 4.60159 0.18
NP_442554.1_8 Forward -63 -53 4.0116 0.2
NP_442554.1_8 Forward -368 -358 2.92996 0.249
NP_442554.1_8 Forward -186 -176 1.94665 0.288
NP_441762.1_7 Forward -263 -251 5.15219 0.0443
NP_441762.1_7 Reverse -252 -264 4.26721 0.0518
NP_441762.1_7 Forward -188 -176 -4.68091 0.181
NP_442142.1_4 Reverse -175 -188 11.8184 0.0518
NP_442142.1_4 Reverse -250 -263 9.26181 0.0998
NP_442142.1_4 Forward -265 -252 2.96866 0.269
NP_442292.1_1 Reverse -254 -263 17.5026 0.00435
NP_442292.1_1 Reverse -179 -188 7.66954 0.0634
NP_442292.1_1 Forward -261 -252 0.786375 0.23
NP_440919.1_7 Forward -233 -215 7.08985 0.229
NP_442476.1_6 Reverse -254 -268 5.99778 0.13
NP_442476.1_6 Reverse -179 -193 1.67122 0.207
NP_442381.1_8 Forward -265 -246 -3.3438 0.126
NP_443009.1_5 Reverse -195 -206 15.2994 0.0152
NP_443009.1_5 Reverse -54 -65 10.9729 0.0699
NP_443009.1_5 Forward -263 -252 10.9729 0.0699
NP_441715.1_4 Forward -261 -251 9.7148 0.097
NP_441715.1_4 Reverse -254 -264 7.25653 0.108
NP_441715.1_4 Reverse -179 -189 6.96153 0.121
NP_440183.1_9 Forward -229 -210 -3.73712 0.194
NP_440183.1_9 Forward -260 -241 -13.6686 0.26
NP_441198.1_8 Forward -264 -254 15.4199 0.0427
NP_441198.1_8 Reverse -194 -204 10.8298 0.239
NP_441468.1_1 Forward -261 -254 15.8704 0.0124
NP_441468.1_1 Reverse -254 -261 15.8704 0.0124
NP_441468.1_1 Forward -186 -179 6.13563 0.209
NP_441468.1_1 Reverse -179 -186 6.0373 0.223
NP_441468.1_1 Forward -63 -56 4.07068 0.263
NP_441020.2_6 Forward -264 -247 9.57695 0.168
NP_441020.2_6 Reverse -251 -268 6.82368 0.251
NP_441015.1_10 Forward -192 -173 -3.83545 0.194
NP_441015.1_10 Forward -382 -363 -10.817 0.288
NP_441015.1_10 Forward -374 -355 -11.0136 0.29
NP_441673.1_1 Forward -262 -253 11.1111 0.0121
NP_441673.1_1 Reverse -253 -262 11.0128 0.018
NP_441673.1_1 Forward -187 -178 1.37636 0.114
NP_441673.1_1 Reverse -178 -187 1.1797 0.163
NP_441826.1_2 Reverse -49 -63 -3.24533 0.284
NP_441826.1_5 Reverse -105 -124 0.982764 0.298
NP_442868.1_6 Reverse -251 -261 10.0098 0.038
NP_442868.1_6 Forward -264 -254 8.63316 0.0555
NP_442868.1_6 Reverse -194 -204 0.865012 0.205
NP_442868.1_6 Forward -189 -179 0.668351 0.213
NP_442719.1_2 Reverse -82 -100 -11.9779 0.299
NP_442227.1_2 Reverse -381 -400 4.03102 0.208
NP_442227.1_2 Forward -124 -105 0.196116 0.252
NP_442808.1_1 Reverse -177 -187 19.449 0.00201
NP_442808.1_1 Reverse -252 -262 18.8591 0.00201
NP_442808.1_1 Reverse -379 -389 1.35624 0.287
NP_440145.1_4 Reverse -369 -379 15.4175 0.214
NP_442542.1_2 Reverse -108 -121 4.93583 0.29
NP_442542.1_9 Reverse -246 -260 5.21053 0.27
NP_442050.1_5 Forward -264 -254 17.1874 0.00812
NP_441114.1_3 Reverse -57 -66 7.96454 0.231
NP_440558.1_2 Forward -67 -48 -5.31042 0.256
NP_440111.2_2 Forward -198 -179 1.57275 0.201
NP_441048.1_4 Reverse -189 -208 15.6341 0.183
NP_441878.1_6 Forward -65 -55 2.24165 0.0462
NP_441878.1_6 Reverse -54 -64 1.25834 0.108
NP_441878.1_6 Forward -263 -253 0.766681 0.134
NP_441878.1_6 Reverse -252 -262 0.57002 0.14
NP_441036.1_8 Reverse -252 -262 15.418 0.00944
NP_441036.1_8 Forward -263 -253 6.07655 0.242
NP_441036.1_8 Reverse -177 -187 6.07655 0.242
NP_441557.1_4 Forward -308 -294 11.3077 0.291
NP_441557.1_5 Forward -262 -253 10.8161 0.00464
NP_441557.1_5 Reverse -253 -262 10.4228 0.00915
NP_441557.1_5 Forward -187 -178 1.08137 0.0794
NP_441557.1_5 Reverse -178 -187 0.589713 0.134
NP_441557.1_8 Reverse -386 -396 10.9926 0.269
NP_441590.1_4 Reverse -376 -395 3.44025 0.29
NP_442066.2_9 Forward -266 -253 19.7838 0.00844
NP_441433.1_8 Reverse -121 -140 -4.6221 0.294
NP_441739.1_2 Reverse -329 -345 2.7128 0.288
NP_441308.1_8 Forward -264 -254 12.4681 0.218
NP_440101.1_3 Forward -192 -173 6.68596 0.181
NP_440101.1_3 Forward -227 -208 5.80098 0.19
NP_440101.1_10 Forward -369 -350 6.58763 0.197
NP_442183.1_1 Forward -262 -248 8.06273 0.124
NP_442183.1_1 Forward -187 -173 5.21113 0.226
NP_442183.1_3 Reverse -379 -398 14.5516 0.243
NP_440979.1_3 Forward -261 -243 13.0972 0.234
NP_441574.1_1 Forward -375 -356 -4.81876 0.254
NP_442170.1_5 Forward -262 -243 1.67108 0.192
NP_442347.1_2 Reverse -254 -263 3.34298 0.284
NP_441037.1_4 Forward -264 -254 16.5761 0.0168
NP_442508.1_8 Forward -398 -381 9.47861 0.289
NP_440151.1_5 Forward -369 -350 4.71934 0.262
NP_441633.1_3 Reverse -251 -264 7.88576 0.0411
NP_441633.1_3 Forward -66 -53 -5.38892 0.236
NP_440136.1_2 Forward -261 -254 15.9687 0.0123
NP_440136.1_2 Reverse -254 -261 15.9687 0.0123
NP_440136.1_2 Forward -186 -179 6.23397 0.171
NP_440136.1_2 Reverse -179 -186 6.13563 0.193
NP_442998.1_5 Forward -166 -156 7.15819 0.299
NP_442998.1_10 Reverse -255 -262 15.5754 0.0102
NP_442998.1_10 Reverse -180 -187 15.5754 0.0102
NP_442998.1_10 Forward -260 -253 5.84064 0.235
NP_440899.1_5 Reverse -186 -205 21.3373 0.0171
NP_440299.1_1 Reverse -93 -106 3.36198 0.247
NP_440299.1_1 Reverse -362 -375 2.87033 0.269
NP_441799.1_1 Forward -266 -252 14.5519 0.0228
NP_441799.1_1 Reverse -249 -263 11.602 0.0558
NP_441799.1_1 Forward -191 -177 8.55376 0.112
NP_441799.1_1 Reverse -174 -188 5.89884 0.19
NP_441007.1_10 Forward -267 -254 20.3738 0.0153
NP_440256.1_1 Forward -265 -246 -0.787193 0.0961
NP_440256.1_1 Forward -190 -171 -3.54046 0.135
NP_440256.1_1 Reverse -175 -194 -3.83545 0.14
NP_441229.1_10 Reverse -46 -65 -0.39387 0.288
NP_441559.1_8 Forward -209 -195 -6.88358 0.281
NP_441559.1_8 Reverse -248 -262 -6.98191 0.281
NP_441559.1_8 Reverse -201 -215 -6.98191 0.281
NP_441559.1_8 Reverse -77 -91 -7.76856 0.299
NP_440915.1_6 Forward -266 -252 1.86788 0.131
NP_440915.1_6 Forward -191 -177 -1.47537 0.236
NP_440717.1_1 Forward -221 -202 6.68596 0.265
NP_440717.1_1 Forward -204 -185 4.916 0.286
NP_442069.1_3 Forward -337 -318 17.404 0.236
NP_440748.1_5 Reverse -351 -370 0.982764 0.24
NP_441464.1_8 Reverse -366 -380 6.48943 0.232
NP_440026.1_4 Forward -190 -171 10.2259 0.239
NP_441939.1_3 Reverse -254 -273 5.40766 0.276
NP_441199.1_6 Reverse -249 -268 5.40766 0.153
NP_441199.1_6 Forward -136 -117 0.0977854 0.254
NP_441199.1_6 Forward -209 -190 -0.000545616 0.255
NP_441494.1_6 Forward -267 -254 6.70579 0.276
NP_442386.1_9 Reverse -252 -261 17.6988 0.0144
NP_442386.1_9 Reverse -177 -186 13.8639 0.0289
NP_442386.1_9 Forward -263 -254 6.39082 0.219
NP_442386.1_10 Forward -187 -174 6.1158 0.262
NP_440570.1_5 Reverse -203 -222 -2.36049 0.278
NP_441340.1_5 Forward -261 -254 15.6737 0.0124
NP_441340.1_5 Reverse -254 -261 15.6737 0.0124
NP_441340.1_5 Forward -186 -179 13.5105 0.0314
NP_441340.1_5 Reverse -179 -186 5.84064 0.208
NP_441340.1_5 Reverse -56 -63 3.97235 0.274
NP_442791.1_5 Forward -195 -176 -9.53865 0.279
NP_440168.1_9 Reverse -205 -224 -0.000545616 0.273
NP_440327.1_6 Forward -369 -350 11.0125 0.188
NP_440327.1_6 Forward -357 -338 2.26107 0.298
NP_440194.1_3 Forward -28 -9 6.4893 0.271
NP_442506.1_9 Forward -357 -338 10.9142 0.229
NP_440211.1_1 Forward -140 -121 11.995 0.224
NP_440586.1_1 Forward -194 -175 0.884433 0.237
NP_440586.1_8 Forward -261 -254 13.2151 0.026
NP_440586.1_8 Reverse -254 -261 13.2151 0.026
NP_440586.1_8 Reverse -179 -186 9.47853 0.146
NP_440586.1_8 Forward -186 -179 5.74197 0.283
NP_442251.1_6 Forward -261 -254 15.2804 0.0124
NP_442251.1_6 Reverse -254 -261 15.2804 0.0124
NP_441262.1_3 Forward -262 -255 14.7888 0.0223
NP_441262.1_3 Forward -187 -180 14.7888 0.0223
NP_441262.1_3 Reverse -253 -260 6.52896 0.0809
NP_440027.1_3 Reverse -189 -207 6.1149 0.23
NP_440027.1_8 Reverse -175 -194 6.78348 0.27
NP_443051.1_1 Forward -263 -254 19.5676 0.00335
NP_443051.1_1 Forward -188 -179 16.6177 0.00754
NP_443051.1_1 Reverse -252 -261 0.983037 0.125
NP_441232.1_10 Forward -198 -179 1.0811 0.289
NP_439984.1_2 Forward -261 -248 15.2606 0.147
NP_439937.1_8 Forward -264 -245 -4.91709 0.286
NP_439937.1_9 Reverse -177 -194 -9.30325 0.184
NP_439937.1_9 Forward -65 -48 -14.4164 0.287
NP_439937.1_9 Reverse -195 -212 -17.1697 0.294
NP_440439.1_1 Forward -190 -177 9.95071 0.0413
NP_440439.1_1 Reverse -250 -263 9.55739 0.0454
NP_440439.1_1 Reverse -175 -188 3.16588 0.119
NP_440439.1_1 Forward -208 -195 2.67422 0.13
NP_440439.1_1 Forward -265 -252 2.08423 0.138
NP_440439.1_1 Forward -399 -386 -0.177378 0.209
NP_440372.1_2 Forward -261 -254 16.3621 0.0124
NP_440372.1_2 Reverse -254 -261 16.3621 0.0124
NP_440372.1_2 Forward -186 -179 13.8055 0.0214
NP_440372.1_2 Reverse -179 -186 6.52896 0.188
NP_440316.1_10 Forward -188 -178 12.4681 0.214
NP_440316.1_10 Forward -263 -253 12.1731 0.214
NP_441803.1_2 Reverse -361 -380 5.80098 0.163
NP_441803.1_10 Reverse -206 -220 16.4209 0.295
NP_440139.1_1 Forward -193 -174 16.3215 0.0474
NP_440139.1_1 Reverse -247 -266 2.6536 0.225
NP_440139.1_1 Reverse -49 -68 1.17865 0.269
NP_441572.1_7 Reverse -172 -191 5.01433 0.0903
NP_442384.1_10 Reverse -178 -191 7.39411 0.0822
NP_442384.1_10 Forward -262 -249 2.08423 0.237
NP_442114.1_4 Reverse -253 -264 11.1701 0.142
NP_441877.1_7 Reverse -248 -267 5.99684 0.218
NP_441018.1_7 Forward -191 -172 7.27595 0.273
NP_442790.1_4 Forward -271 -252 -8.16202 0.164
NP_442790.1_4 Reverse -244 -263 -14.6519 0.278
NP_442262.1_10 Forward -261 -254 14.1988 0.0123
NP_442262.1_10 Reverse -254 -261 14.1988 0.0123
NP_442262.1_10 Reverse -179 -186 13.2155 0.0213
NP_442262.1_10 Reverse -56 -63 9.87221 0.164
NP_441689.1_5 Forward -264 -254 8.43603 0.132
NP_441689.1_5 Forward -189 -179 5.78111 0.197
NP_440163.1_10 Reverse -63 -73 10.6981 0.198
NP_440344.1_10 Reverse -171 -188 -6.25434 0.113
NP_440344.1_10 Reverse -246 -263 -9.99092 0.163
NP_440531.1_6 Forward -270 -251 -5.01543 0.291
NP_442910.1_1 Reverse -48 -67 -6.49039 0.254
NP_441335.1_8 Forward -323 -304 9.63589 0.228
NP_442750.1_6 Forward -359 -340 14.9458 0.285
NP_440297.1_9 Reverse -56 -66 7.64985 0.108
NP_440297.1_9 Forward -63 -53 0.865012 0.282
NP_440297.1_9 Reverse -254 -264 -0.314959 0.282
NP_442187.1_3 Forward -263 -253 15.0247 0.12
NP_442187.1_3 Forward -188 -178 13.4514 0.245
NP_442280.1_10 Reverse -179 -197 14.9023 0.115
NP_441896.1_3 Reverse -244 -263 -0.39387 0.239
NP_440894.1_10 Forward -83 -64 11.9958 0.135
NP_440999.1_9 Reverse -249 -263 6.88276 0.0932
NP_440888.1_2 Reverse -253 -267 14.7486 0.0152
NP_440888.1_2 Reverse -178 -192 11.4053 0.0681
NP_440600.1_4 Reverse -245 -263 4.83737 0.11
NP_442147.1_6 Reverse -176 -190 14.9452 0.274
NP_440491.1_1 Reverse -250 -269 8.0865 0.251
NP_441748.1_3 Forward -230 -211 12.7098 0.247
NP_442948.1_2 Forward -263 -244 7.27595 0.229
NP_442948.1_2 Forward -188 -169 2.75272 0.3
NP_440237.1_5 Reverse -83 -97 12.487 0.212
NP_442277.1_4 Reverse -244 -263 12.0933 0.0703
NP_441759.1_8 Forward -114 -95 8.55343 0.211
NP_441543.1_2 Reverse -254 -263 15.9293 0.00518
NP_441543.1_2 Forward -261 -252 8.94785 0.0968
NP_441543.1_2 Reverse -179 -188 6.09625 0.153
NP_442845.1_2 Forward -193 -179 7.9644 0.195
NP_442845.1_2 Forward -268 -254 6.58777 0.207
NP_442845.1_2 Forward -187 -173 5.40779 0.233
NP_441551.1_5 Reverse -174 -190 17.1674 0.0528
NP_441551.1_5 Forward -262 -246 10.1859 0.196
NP_441551.1_5 Reverse -249 -265 7.43266 0.247
NP_441319.1_6 Reverse -251 -270 16.1257 0.197
NP_441469.1_8 Reverse -252 -261 15.4377 0.0124
NP_441469.1_8 Forward -65 -56 10.0295 0.227
NP_441469.1_8 Forward -263 -254 6.5879 0.227
NP_441469.1_8 Reverse -177 -186 5.60459 0.258
NP_442578.1_7 Forward -261 -254 14.5921 0.026
NP_442578.1_7 Reverse -254 -261 14.5921 0.026
NP_442578.1_7 Forward -186 -179 6.0373 0.18
NP_441462.1_2 Reverse -253 -263 10.4031 0.011
NP_441462.1_2 Forward -262 -252 9.32148 0.0234
NP_441462.1_2 Forward -187 -177 7.55152 0.0543
NP_441462.1_2 Reverse -178 -188 0.57002 0.144
NP_441621.1_7 Reverse -251 -265 4.22782 0.0934
NP_441621.1_7 Forward -264 -250 -1.67204 0.184
NP_443062.1_1 Reverse -253 -271 5.23067 0.235
NP_440519.1_3 Reverse -44 -63 8.75091 0.282
NP_442204.1_1 Forward -191 -180 9.59678 0.0736
NP_442204.1_5 Forward -232 -213 2.26107 0.214
NP_440516.1_8 Forward -262 -253 18.9776 0.00442
NP_440516.1_8 Forward -187 -178 18.9776 0.00442
NP_440516.1_8 Reverse -253 -262 7.07956 0.0867
NP_440516.1_8 Reverse -178 -187 5.01461 0.118
NP_442428.1_4 Forward -370 -351 4.12936 0.238
NP_442428.1_5 Forward -261 -254 15.8704 0.0124
NP_442428.1_5 Reverse -254 -261 15.8704 0.0124
NP_442428.1_5 Forward -186 -179 6.13563 0.209
NP_442428.1_5 Reverse -179 -186 6.0373 0.212
NP_442428.1_5 Forward -63 -56 4.46401 0.267
NP_440673.1_3 Forward -260 -253 13.1171 0.0426
NP_440673.1_3 Reverse -255 -262 12.4288 0.0426
NP_440673.1_3 Reverse -180 -187 12.4288 0.0426
NP_440673.1_7 Forward -273 -254 6.29264 0.157
NP_441052.1_2 Reverse -253 -263 10.9931 0.0285
NP_441052.1_2 Forward -222 -212 4.60159 0.154
NP_441052.1_2 Reverse -178 -188 1.16001 0.25
NP_441052.1_2 Forward -262 -252 0.766681 0.256
NP_440992.1_5 Reverse -251 -270 12.2776 0.297
NP_442219.1_8 Forward -226 -207 14.4483 0.136
NP_442219.1_9 Forward -261 -252 8.94785 0.0681
NP_442219.1_9 Reverse -254 -263 8.25953 0.0681
NP_440436.1_4 Reverse -254 -263 9.24241 0.0871
NP_440436.1_4 Forward -261 -252 9.04574 0.092
NP_441884.1_8 Reverse -177 -196 -2.55715 0.14
NP_441884.1_9 Forward -265 -246 -12.1936 0.138
NP_441884.1_9 Reverse -250 -269 -24.19 0.284
NP_440648.1_1 Reverse -253 -272 10.7175 0.159
NP_442414.1_2 Reverse -117 -136 8.65258 0.276
NP_440041.1_2 Forward -329 -310 -0.688862 0.196
NP_442907.1_9 Reverse -173 -192 14.1591 0.0789
NP_441719.1_4 Forward -261 -254 16.3621 0.0124
NP_441719.1_4 Reverse -254 -261 16.3621 0.0124
NP_441719.1_4 Forward -186 -179 6.82395 0.0855
NP_441719.1_4 Reverse -179 -186 6.52896 0.188
NP_441733.1_10 Forward -265 -252 17.6205 0.0371
NP_441004.1_1 Forward -221 -202 -0.885524 0.124
NP_441004.1_1 Forward -196 -177 -11.3086 0.237
NP_441004.1_1 Reverse -117 -136 -15.5368 0.275
NP_441004.1_1 Forward -395 -376 -16.0285 0.281
NP_441004.1_1 Forward -106 -87 -17.4051 0.291
NP_441004.1_5 Forward -219 -205 10.7177 0.243
NP_442366.1_3 Forward -206 -188 -3.42244 0.247
NP_442139.1_7 Forward -233 -214 9.53756 0.245
NP_439949.1_7 Reverse -66 -80 10.816 0.291
NP_440296.1_10 Forward -265 -246 -15.2418 0.29
NP_441115.1_4 Reverse -252 -270 8.76983 0.237
NP_442854.1_4 Reverse -184 -203 10.9134 0.278
NP_442586.1_6 Forward -400 -381 10.1275 0.227
NP_441851.1_10 Reverse -252 -262 6.66654 0.159
NP_441851.1_10 Reverse -54 -64 5.78156 0.2
NP_441851.1_10 Forward -65 -55 4.69992 0.254
NP_442208.1_8 Forward -150 -132 17.4237 0.235
NP_442622.1_1 Forward -263 -244 -2.45882 0.177
NP_442622.1_8 Reverse -178 -196 -8.92897 0.138
NP_442622.1_8 Forward -262 -244 -19.0571 0.296
NP_442515.1_1 Reverse -252 -266 -2.75368 0.279
NP_441349.1_10 Forward -197 -178 -9.93197 0.3
NP_441394.1_10 Reverse -351 -369 8.96649 0.263
NP_442314.1_1 Reverse -211 -229 -5.38906 0.272
NP_440389.1_5 Forward -229 -210 14.4398 0.226
NP_440432.1_9 Reverse -254 -269 7.74804 0.0427
NP_440432.1_9 Forward -261 -246 -1.10174 0.167
NP_440474.1_8 Reverse -254 -268 14.5519 0.0617
NP_440726.1_2 Reverse -246 -265 -0.787193 0.295
NP_440588.1_2 Reverse -46 -65 4.42435 0.0817
NP_440588.1_2 Forward -196 -177 -2.0655 0.16
NP_440588.1_2 Reverse -169 -188 -4.13045 0.207
NP_442006.1_2 Reverse -213 -230 -6.54933 0.164
NP_441003.1_9 Forward -231 -212 3.6377 0.291
NP_440483.1_10 Reverse -233 -252 26.1555 0.00261
NP_440483.1_10 Reverse -131 -150 19.2723 0.104
NP_442243.1_1 Reverse -183 -201 -3.02983 0.298
NP_441570.1_1 Forward -262 -244 -6.86402 0.0823
NP_441570.1_1 Reverse -178 -196 -6.96235 0.0829
NP_441570.1_1 Forward -187 -169 -17.0904 0.264
NP_441078.1_4 Forward -262 -253 9.93116 0.0203
NP_441078.1_4 Reverse -253 -262 9.83282 0.0226
NP_441078.1_4 Forward -187 -178 0.196389 0.205
NP_441078.1_4 Reverse -178 -187 -0.000272808 0.205
NP_441078.1_4 Forward -64 -55 -1.6719 0.266
NP_441078.1_4 Reverse -196 -205 -1.86856 0.272
NP_442388.1_3 Forward -265 -246 5.30933 0.282
NP_441663.1_8 Reverse -247 -266 -3.83545 0.298
NP_442348.1_2 Forward -205 -196 13.2744 0.198
NP_442348.1_2 Forward -254 -245 10.1278 0.27
NP_442443.1_1 Forward -385 -366 -3.73712 0.267
NP_441091.1_5 Reverse -350 -369 13.3725 0.115
NP_442906.1_9 Forward -151 -132 7.07928 0.207
NP_440526.1_3 Reverse -254 -265 2.41814 0.267
NP_441432.1_8 Forward -263 -254 16.8143 0.00595
NP_441432.1_8 Forward -188 -179 14.0611 0.0258
NP_442320.1_8 Forward -268 -254 -3.24533 0.113
NP_441732.1_2 Reverse -356 -372 -16.5594 0.174
NP_442815.1_10 Reverse -134 -152 18.3079 0.193
NP_440685.1_8 Forward -375 -356 11.5042 0.281
NP_440760.1_1 Reverse -253 -272 -22.9117 0.274
NP_441072.1_2 Forward -198 -179 10.5209 0.2
NP_440713.1_4 Forward -197 -178 17.0107 0.0566
NP_442489.1_2 Reverse -242 -261 0.982764 0.296
NP_442489.1_7 Forward -262 -253 10.4228 0.0151
NP_442489.1_7 Reverse -253 -262 10.3245 0.0193
NP_442489.1_7 Forward -187 -178 0.688044 0.152
NP_442489.1_7 Reverse -178 -187 0.688044 0.152
NP_442489.1_7 Forward -64 -55 -1.6719 0.235
NP_442489.1_7 Forward -205 -196 -1.96689 0.28
NP_442489.1_7 Reverse -55 -64 -1.96689 0.28
NP_440559.1_1 Reverse -254 -263 8.65285 0.0586
NP_440559.1_1 Forward -63 -54 4.32629 0.288
NP_441659.2_8 Reverse -253 -263 11.3864 0.0184
NP_441659.2_8 Reverse -178 -188 8.23984 0.0462
NP_441659.2_8 Reverse -55 -65 4.10993 0.144
NP_441659.2_8 Forward -262 -252 2.43831 0.2
NP_442913.1_10 Reverse -187 -206 -2.75381 0.192
NP_441040.1_2 Forward -231 -212 -16.5201 0.3
NP_442008.1_2 Forward -397 -378 7.47261 0.209
NP_440708.1_6 Reverse -375 -394 -10.4236 0.278
NP_441800.1_7 Reverse -322 -340 -3.81576 0.281
NP_440779.1_5 Reverse -253 -270 -5.66436 0.152
NP_442346.1_1 Forward -339 -320 9.93088 0.275
NP_442346.1_5 Forward -263 -253 7.84651 0.156
NP_442346.1_5 Reverse -54 -64 6.37155 0.205
NP_442346.1_5 Reverse -252 -262 5.19158 0.256
NP_442346.1_5 Forward -65 -55 4.99491 0.267
NP_440545.1_3 Reverse -51 -68 2.89044 0.0923
NP_440545.1_3 Forward -68 -51 0.825489 0.131
NP_440545.1_3 Forward -191 -174 -5.1727 0.242
NP_441856.1_3 Reverse -250 -269 -2.26216 0.258
NP_441786.1_10 Forward -196 -177 16.8141 0.121
NP_441943.1_8 Reverse -186 -205 -5.31042 0.258
NP_442603.1_7 Reverse -253 -267 7.96378 0.191
NP_442828.1_5 Forward -285 -266 11.405 0.289
NP_441888.1_7 Reverse -248 -262 11.0127 0.0977
NP_440449.1_6 Forward -270 -252 11.9518 0.123
NP_441948.1_4 Reverse -246 -264 -0.472507 0.139
NP_441948.1_4 Forward -269 -251 -3.71743 0.203
NP_441833.1_4 Forward -261 -254 15.9687 0.0124
NP_441833.1_4 Reverse -254 -261 15.9687 0.0124
NP_441833.1_4 Reverse -179 -186 6.52896 0.0924
NP_441833.1_4 Forward -186 -179 6.23397 0.163
NP_440751.1_9 Reverse -44 -63 4.22769 0.245
NP_441329.1_6 Forward -101 -82 -0.430137 0.275
NP_442162.1_9 Forward -261 -254 16.2637 0.0124
NP_442162.1_9 Reverse -254 -261 16.2637 0.0124
NP_442162.1_9 Forward -186 -179 12.9205 0.0282
NP_442162.1_9 Reverse -179 -186 12.9205 0.0282
NP_440671.1_4 Reverse -172 -186 14.9459 0.0532
NP_440224.1_1 Forward -198 -179 -0.4922 0.143
NP_440772.1_6 Forward -261 -242 6.4893 0.292
NP_442199.1_5 Reverse -245 -264 -3.24547 0.201
NP_442140.1_3 Forward -261 -251 16.008 0.0287
NP_442140.1_3 Reverse -254 -264 7.94484 0.124
NP_442021.1_3 Forward -357 -338 12.8808 0.0395
NP_441696.1_6 Reverse -179 -198 2.3594 0.285
NP_441671.1_10 Forward -198 -179 6.4893 0.205
NP_440875.1_9 Reverse -180 -190 13.5309 0.0677
NP_440875.1_9 Reverse -255 -265 8.66404 0.233
NP_440875.1_9 Reverse -198 -208 7.496 0.262
NP_441813.1_5 Reverse -251 -261 19.4496 0.00647
NP_441813.1_5 Reverse -176 -186 14.0414 0.0172
NP_441813.1_5 Forward -264 -254 8.73149 0.0367
NP_441813.1_5 Forward -189 -179 8.4365 0.0432
NP_440594.1_6 Forward -150 -131 20.7464 0.169
NP_440594.1_8 Reverse -254 -267 9.75346 0.18
NP_441227.1_7 Reverse -56 -75 12.3759 0.275
NP_442089.1_1 Reverse -210 -229 1.86774 0.226
NP_440590.1_4 Reverse -254 -267 1.39592 0.125
NP_440590.1_4 Forward -261 -248 -4.60227 0.263
NP_440567.1_1 Reverse -254 -268 14.8476 0.0186
NP_440567.1_1 Forward -186 -172 11.6026 0.0277
NP_440567.1_1 Reverse -179 -193 4.22782 0.126
NP_440567.1_1 Forward -261 -247 2.5562 0.17
NP_442497.1_10 Reverse -254 -263 17.601 0.00813
NP_442497.1_10 Reverse -179 -188 7.76787 0.0731
NP_442497.1_10 Forward -261 -252 1.37636 0.111
NP_442497.1_10 Forward -63 -54 0.393051 0.175
NP_440821.1_4 Forward -264 -254 10.7964 0.0146
NP_440821.1_4 Reverse -251 -261 7.84651 0.0626
NP_440821.1_4 Reverse -176 -186 6.8632 0.0814
NP_441239.1_9 Reverse -251 -263 13.9036 0.0335
NP_441239.1_9 Forward -66 -54 11.937 0.0529
NP_441239.1_9 Reverse -176 -188 11.7404 0.0551
NP_441239.1_9 Forward -264 -252 7.90546 0.147
NP_441951.1_9 Forward -230 -211 1.27776 0.254
NP_442691.1_2 Reverse -346 -365 8.45592 0.161
NP_440400.1_1 Reverse -321 -340 -1.37794 0.285
NP_440400.1_1 Reverse -377 -396 -3.04956 0.29
NP_442193.1_1 Forward -395 -377 10.3439 0.232
NP_441698.1_7 Reverse -126 -144 18.8004 0.126
NP_441017.1_8 Forward -208 -193 6.9614 0.287
NP_440949.1_7 Reverse -320 -339 9.43841 0.264
NP_440354.1_1 Forward -43 -25 27.0602 0.000182
NP_440354.1_4 Forward -140 -121 20.7473 0.127
NP_440354.1_7 Forward -268 -250 16.1454 0.167
NP_442138.1_9 Reverse -348 -367 7.37347 0.299
NP_442138.1_10 Forward -262 -243 -5.40875 0.269
NP_440391.1_8 Forward -263 -244 10.2259 0.187
NP_442052.1_8 Reverse -53 -63 12.7631 0.253
NP_440546.1_2 Forward -357 -338 14.3558 0.219
NP_440546.1_4 Forward -187 -177 14.0213 0.0459
NP_440546.1_4 Forward -262 -252 13.0517 0.0572
NP_440546.1_4 Reverse -253 -263 10.8217 0.104
NP_440546.1_4 Reverse -178 -188 8.20381 0.199
NP_441230.1_5 Forward -192 -173 4.71934 0.185
NP_440675.1_3 Forward -262 -243 9.14423 0.194
NP_440462.1_6 Forward -264 -254 19.4496 0.00371
NP_440462.1_6 Reverse -251 -261 16.303 0.0113
NP_440462.1_6 Reverse -176 -186 11.4848 0.0396
NP_440462.1_6 Forward -189 -179 9.22315 0.049
NP_442611.1_1 Forward -187 -168 2.3594 0.221
NP_440868.1_4 Reverse -249 -261 21.1801 0.00781
NP_440868.1_4 Forward -191 -179 15.0836 0.0164
NP_440868.1_4 Forward -266 -254 9.38042 0.049
NP_440868.1_4 Reverse -174 -186 7.70879 0.0648
NP_441497.1_2 Forward -243 -224 8.65258 0.233
NP_441868.1_4 Forward -194 -180 16.5192 0.258
NP_440341.1_7 Reverse -331 -345 18.1908 0.2
NP_442402.1_4 Forward -138 -119 -9.63771 0.292
NP_441084.1_6 Forward -173 -159 14.192 0.106
NP_442460.1_7 Reverse -166 -185 -1.08219 0.292
NP_442039.1_4 Forward -261 -254 15.1821 0.0124
NP_442039.1_4 Reverse -254 -261 15.1821 0.0124
NP_442039.1_4 Forward -186 -179 11.6422 0.0747
NP_442696.1_6 Reverse -324 -343 -3.44213 0.149
NP_442837.1_3 Forward -261 -254 15.7721 0.0124
NP_442837.1_3 Reverse -254 -261 15.7721 0.0124
NP_442837.1_3 Forward -186 -179 6.0373 0.25
NP_442837.1_3 Reverse -179 -186 6.0373 0.25
NP_442053.1_1 Forward -262 -253 17.601 0.00138
NP_442053.1_1 Reverse -253 -262 16.2243 0.00451
NP_442053.1_1 Reverse -178 -187 14.4544 0.0114
NP_442053.1_1 Forward -187 -178 7.86621 0.0863
NP_440505.1_3 Forward -189 -179 15.6147 0.0106
NP_440505.1_3 Forward -264 -254 15.418 0.0114
NP_440505.1_3 Forward -207 -197 9.02648 0.128
NP_440505.1_3 Reverse -251 -261 6.07655 0.197
NP_441102.1_2 Forward -311 -292 6.29264 0.298
NP_441203.1_1 Reverse -254 -273 -15.5368 0.233
NP_440013.1_1 Reverse -157 -176 8.16011 0.266
NP_442532.1_7 Forward -262 -248 11.6026 0.122
NP_441408.2_7 Reverse -352 -371 -2.85214 0.272
NP_441408.2_7 Reverse -340 -359 -3.44213 0.272
NP_440914.1_1 Reverse -253 -263 13.7874 0.0256
NP_440914.1_1 Reverse -178 -188 11.8356 0.0767
NP_440914.1_1 Forward -262 -252 7.34642 0.241
NP_441011.1_8 Reverse -254 -263 16.6177 0.00602
NP_441011.1_8 Forward -261 -252 15.3394 0.012
NP_441011.1_8 Forward -186 -177 11.7994 0.0629
NP_441011.1_8 Reverse -179 -188 6.78456 0.184
NP_442533.1_1 Forward -395 -376 -3.63879 0.14
NP_442533.1_1 Forward -386 -367 -13.0786 0.236
NP_442533.1_1 Reverse -105 -124 -14.0619 0.239
NP_442533.1_6 Forward -262 -253 7.86621 0.0862
NP_442533.1_6 Reverse -253 -262 7.37455 0.0898
NP_442533.1_6 Reverse -178 -187 4.42462 0.179
NP_442533.1_6 Reverse -360 -369 4.32629 0.184
NP_442541.1_10 Reverse -360 -374 8.55376 0.218
NP_442232.1_3 Forward -270 -251 -12.4886 0.282
NP_442322.1_4 Reverse -175 -192 0.431468 0.21
NP_442322.1_4 Reverse -379 -396 -7.92662 0.286
NP_441219.1_6 Reverse -212 -230 12.9005 0.185
NP_441482.1_7 Reverse -172 -186 -11.1118 0.237
NP_439944.1_9 Reverse -254 -264 17.7779 0.00341
NP_440816.1_7 Forward -266 -247 12.7825 0.202
NP_441028.1_6 Forward -140 -130 5.48612 0.255
NP_441028.1_6 Reverse -86 -96 5.48612 0.255
NP_442202.1_10 Reverse -367 -381 3.53951 0.278
NP_441527.1_4 Reverse -313 -332 -6.15965 0.215
NP_440115.1_6 Forward -190 -180 13.0581 0.0818
NP_440115.1_6 Forward -265 -255 7.74818 0.146
NP_439965.1_1 Reverse -169 -188 12.3892 0.0279
NP_441602.1_3 Forward -210 -191 -4.52377 0.268
NP_441972.1_3 Reverse -273 -292 15.9291 0.146
NP_441106.1_1 Forward -263 -254 18.486 0.0028
NP_441106.1_1 Reverse -252 -261 9.04618 0.0371
NP_441106.1_1 Forward -188 -179 8.75118 0.0469
NP_442306.1_10 Reverse -355 -374 -20.4534 0.21
NP_442306.1_10 Forward -192 -173 -20.5517 0.213
NP_441286.1_1 Reverse -252 -264 -4.09092 0.149
NP_441286.1_1 Forward -263 -251 -4.38592 0.156
NP_441286.1_1 Forward -188 -176 -5.36923 0.197
NP_442674.1_2 Forward -249 -230 11.6025 0.208
NP_440670.1_8 Forward -262 -253 9.04618 0.0606
NP_440670.1_8 Reverse -253 -262 8.75118 0.0606
NP_440670.1_8 Forward -187 -178 8.75118 0.0606
NP_440670.1_8 Reverse -178 -187 6.19458 0.124
NP_440670.1_8 Reverse -55 -64 3.24465 0.29
NP_440886.1_7 Reverse -252 -262 17.7774 0.0011
NP_440886.1_7 Reverse -177 -187 16.4991 0.0104
NP_440886.1_7 Forward -263 -253 6.76441 0.114
NP_440886.1_7 Forward -124 -114 3.71617 0.267
NP_442614.1_2 Forward -187 -173 8.45605 0.255
NP_442614.1_2 Reverse -55 -69 6.09611 0.293
NP_440907.2_8 Reverse -254 -264 19.1541 0.00362
NP_440907.2_8 Reverse -179 -189 7.84605 0.117
NP_441021.1_1 Forward -204 -185 -2.26216 0.135
NP_441463.1_3 Reverse -168 -187 7.17762 0.0545
NP_441463.1_3 Reverse -243 -262 4.12936 0.0942
NP_441463.1_5 Forward -263 -249 12.4876 0.188
NP_441626.1_2 Forward -261 -254 15.7721 0.0124
NP_441626.1_2 Reverse -254 -261 15.7721 0.0124
NP_441626.1_2 Forward -186 -179 12.2322 0.0511
NP_441626.1_2 Reverse -179 -186 5.93897 0.231
NP_442365.1_7 Reverse -174 -193 -1.86883 0.196
NP_441401.1_4 Reverse -229 -242 16.9322 0.131
NP_442615.1_1 Forward -271 -253 13.2938 0.0118
NP_442615.1_1 Reverse -169 -187 0.117479 0.107
NP_440387.1_1 Reverse -253 -269 -2.79306 0.15
NP_441431.1_2 Reverse -250 -264 15.3386 0.0501
NP_441431.1_2 Reverse -52 -66 9.73373 0.18
NP_441431.1_3 Forward -369 -350 1.96607 0.299
NP_441488.1_7 Forward -268 -249 11.1109 0.113
NP_441993.1_1 Forward -375 -356 4.67549 0.215
NP_441993.1_1 Forward -380 -361 1.65431 0.273
NP_441993.1_1 Forward -204 -185 1.06957 0.285
NP_440358.1_2 Reverse -377 -394 8.5929 0.294
NP_440114.1_10 Reverse -253 -267 13.5693 0.0531
NP_440114.1_10 Reverse -178 -192 13.4709 0.0561
NP_440114.1_10 Forward -262 -248 11.6026 0.107
NP_442323.1_7 Forward -124 -105 0.785326 0.299
NP_441510.2_2 Reverse -174 -193 3.24359 0.272
NP_440287.1_6 Forward -264 -245 2.3594 0.244
NP_440293.1_3 Forward -371 -352 4.22769 0.192
NP_440766.1_4 Forward -191 -177 2.16287 0.197
NP_439988.1_3 Forward -227 -213 5.21113 0.288
NP_439988.1_7 Reverse -255 -269 12.782 0.292
NP_441237.1_9 Reverse -56 -66 13.5497 0.0769
NP_441237.1_9 Forward -204 -194 9.7148 0.272
NP_442743.1_5 Forward -186 -167 5.211 0.206
NP_441311.1_2 Forward -268 -254 20.2551 0.0709
NP_440643.1_6 Reverse -348 -367 1.67108 0.267
NP_439910.1_2 Reverse -245 -262 -21.3973 0.183
NP_442867.1_8 Forward -229 -210 6.68596 0.257
NP_440457.1_1 Forward -191 -179 13.117 0.092
NP_440457.1_1 Forward -399 -387 5.34885 0.141
NP_440798.1_6 Reverse -179 -192 2.2809 0.182
NP_440798.1_6 Reverse -254 -267 2.08423 0.186
NP_440798.1_6 Reverse -56 -69 1.59258 0.211
NP_442509.1_9 Forward -262 -252 14.7292 0.0242
NP_442509.1_9 Reverse -196 -206 12.3692 0.0947
NP_442509.1_9 Forward -187 -177 11.9759 0.107
NP_441253.1_8 Forward -69 -55 10.088 0.288
NP_440734.1_9 Reverse -172 -191 9.43923 0.293
NP_440554.1_4 Reverse -254 -264 15.418 0.0199
NP_440554.1_4 Reverse -179 -189 15.0247 0.02
NP_440554.1_4 Forward -261 -251 9.91146 0.0608
NP_441845.1_6 Reverse -184 -202 0.805796 0.274
NP_441885.1_5 Forward -262 -252 2.33998 0.0799
NP_441885.1_5 Reverse -253 -263 1.55333 0.109
NP_441885.1_5 Forward -187 -177 0.0783647 0.183
NP_442341.1_9 Forward -189 -175 14.1586 0.0713
NP_441756.1_5 Forward -398 -379 4.22769 0.199
NP_441756.1_5 Reverse -174 -193 -4.91709 0.297
NP_442395.2_4 Reverse -177 -196 3.53858 0.2
NP_442395.2_4 Reverse -252 -271 3.44025 0.202
NP_440409.1_1 Forward -270 -251 -0.983855 0.224
NP_440423.1_6 Forward -195 -176 -12.4886 0.195
NP_443000.1_3 Forward -65 -46 9.77726 0.297
NP_443000.1_7 Forward -264 -254 10.7964 0.0345
NP_443000.1_7 Forward -189 -179 10.5998 0.0345
NP_443000.1_7 Reverse -251 -261 2.53664 0.226
NP_440076.1_5 Forward -194 -175 16.0265 0.159
NP_441842.1_1 Reverse -180 -193 15.9483 0.0521
NP_441842.1_10 Forward -269 -255 17.6992 0.0207
NP_441842.1_10 Forward -194 -180 7.07942 0.267
NP_440275.1_3 Forward -264 -254 18.6629 0.0082
NP_440275.1_3 Forward -189 -179 13.5497 0.0268
NP_440275.1_3 Reverse -251 -261 6.76487 0.0966
NP_440091.1_1 Reverse -249 -261 1.41561 0.197
NP_443046.1_9 Reverse -335 -353 5.81991 0.194
NP_440679.1_10 Forward -384 -365 -18.9784 0.279
NP_443010.1_10 Forward -208 -191 3.44723 0.253
NP_442638.1_3 Reverse -232 -251 10.1695 0.298
NP_441190.1_2 Reverse -315 -334 6.4893 0.17
NP_439962.1_4 Reverse -245 -264 -8.94866 0.298
NP_439962.1_8 Reverse -52 -71 7.7676 0.21
NP_440880.1_2 Forward -33 -14 18.6683 0.124
NP_442495.1_5 Forward -208 -189 6.68596 0.291
NP_441875.1_3 Reverse -188 -207 16.9115 0.252
NP_440216.1_1 Forward -262 -248 6.6861 0.0139
NP_440216.1_1 Reverse -178 -192 5.30946 0.0215
NP_440216.1_1 Reverse -253 -267 -2.85201 0.0608
NP_440216.1_1 Forward -187 -173 -12.5868 0.288
NP_440216.1_1 Reverse -55 -69 -12.5868 0.288
NP_440216.1_9 Reverse -57 -66 5.50626 0.292
NP_440678.1_9 Forward -267 -248 8.16093 0.279
NP_440172.1_1 Forward -262 -252 9.7148 0.0586
NP_440172.1_1 Reverse -253 -263 7.74818 0.0738
NP_440172.1_1 Reverse -178 -188 4.79825 0.166
NP_442371.1_1 Reverse -130 -140 16.4991 0.137
NP_442371.1_1 Reverse -232 -242 11.9759 0.273
NP_442015.1_10 Reverse -249 -262 5.03416 0.154
NP_442015.1_10 Forward -68 -55 1.00259 0.216
NP_442015.1_10 Reverse -174 -187 -0.177378 0.255
NP_441226.1_7 Forward -261 -254 14.4934 0.0123
NP_441226.1_7 Reverse -254 -261 14.4934 0.0123
NP_441226.1_7 Forward -186 -179 12.7234 0.0312
NP_441226.1_7 Reverse -179 -186 11.5435 0.0757
NP_441111.1_7 Reverse -254 -262 18.7023 0.00294
NP_441111.1_7 Forward -261 -253 8.96754 0.0463
NP_441111.1_7 Reverse -179 -187 8.86921 0.0589
NP_441766.1_2 Reverse -253 -262 18.2893 0.00297
NP_441766.1_2 Reverse -178 -187 14.7494 0.00772
NP_441766.1_2 Forward -262 -253 9.14451 0.0337
NP_442252.1_4 Forward -374 -355 12.7825 0.278
NP_440416.1_9 Reverse -171 -190 -3.3438 0.0743
NP_440416.1_9 Forward -269 -250 -14.3569 0.176
NP_440416.1_9 Forward -71 -52 -15.2418 0.187
NP_440416.1_9 Reverse -188 -207 -17.6018 0.243
NP_440416.1_9 Reverse -378 -397 -20.2567 0.283
NP_443052.1_8 Reverse -243 -262 -4.22878 0.114
NP_442403.1_8 Forward -343 -324 -1.47551 0.258
NP_442154.1_1 Forward -394 -376 -15.1238 0.218
NP_442154.1_1 Forward -397 -379 -18.1721 0.278
NP_440261.1_5 Reverse -254 -267 8.37742 0.0263
NP_440988.1_10 Forward -183 -169 5.4797 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCCGGGGGGCGGGTAAGGTGGAGGAGATGTGGCCTTGGGCTTGGATTTGGGTTTAGCTTTGGGAGCTTTGCTGGTCTGGTCCTTTTTAGGAATCTGGGAAGTTTTAGCGCTTAACTCCAGCTCCAATAATTCCTTGAGGCGATCGCGGGCTTGGTTAATTTCTTTGAGTTTCCTGGCCGCTTTGGCCAATAGGCGGGGATTGTCCCTGGGCAGGCGATCGGGGTGCCAAACAAAGGCTAAATCTCGATAGGCTTCATTGATTTCCTCCAGACTAGCCCCTACCTCTAGCCCCAGGATTTCGTAATAGTGGGAAAACTCTTGCATAATCACCGCTGTGCAATGGCCCACCTAAAAGCGTAATATAGAAAGGTTGTCAATTTTTAAGATCCCAGAGAAGTC

CDS

ATGGCAGTTCCCAAGAAGAAAACCTCCAAAGCAAAACGTGATCAACGCCGGGCCCACTGGCGCAGACAAGCTTCCTCCCAAGCGCAAAAGGCTTTGTCCCTCGGCAAATCCATTTTATCTGGCCGTTCTACTTTCCTCTATCCCCCCGCAGAAGAAGAAGGGGAAGAAGAGTAA

Protein

MAVPKKKTSKAKRDQRRAHWRRQASSQAQKALSLGKSILSGRSTFLYPPAEEEGEEE