Your browser is old and dusty. Try Google Chrome!

Details for ssr1720

ORF ssr1720
Accession NP_440490.1
Symbol
Category Aminoacyl tRNA synthetases and tRNA modification
Definition similar to tyrosyl tRNA synthetase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -1 -15 3.73617 0.16
NP_440795.1_7 Forward -66 -59 14.6904 0.0123
NP_440795.1_7 Reverse -59 -66 14.6904 0.0123
NP_440897.1_6 Forward -67 -48 16.0265 0.0255
NP_441453.1_1 Reverse -51 -69 3.65664 0.263
NP_441453.1_4 Reverse -58 -66 16.539 0.00633
NP_441453.1_4 Forward -67 -59 16.539 0.00633
NP_441453.1_7 Reverse -22 -29 12.9205 0.23
NP_442151.1_6 Reverse -58 -72 15.4376 0.0238
NP_440226.1_1 Reverse -58 -77 22.1239 0.00612
NP_442173.1_1 Forward -66 -58 15.4574 0.00633
NP_442173.1_1 Reverse -59 -67 15.4574 0.00633
NP_442752.1_4 Forward -67 -60 13.8055 0.0199
NP_442752.1_4 Reverse -58 -65 13.8055 0.0199
NP_443027.1_4 Forward -69 -59 15.3197 0.0437
NP_443027.1_4 Reverse -56 -66 13.943 0.0452
NP_441812.1_3 Reverse -57 -71 14.9459 0.106
NP_442975.1_10 Reverse -54 -68 12.192 0.0477
NP_442975.1_10 Forward -71 -57 11.897 0.0482
NP_440784.1_7 Forward -66 -59 15.9687 0.0123
NP_440784.1_7 Reverse -59 -66 15.9687 0.0123
NP_442062.1_8 Forward -67 -57 19.4496 0.000558
NP_442062.1_8 Reverse -58 -68 10.3048 0.0493
NP_441859.1_3 Reverse -57 -76 11.995 0.102
NP_441641.1_6 Forward -69 -50 16.0416 0.134
NP_440304.1_4 Forward -69 -59 18.9579 0.00406
NP_440304.1_4 Reverse -56 -66 9.91146 0.051
NP_442242.1_4 Forward -66 -59 14.3954 0.0124
NP_442242.1_4 Reverse -59 -66 14.3954 0.0124
NP_440044.1_8 Forward -66 -47 6.68596 0.0881
NP_441581.1_4 Reverse -377 -396 7.66927 0.272
NP_441161.1_3 Reverse -52 -70 8.37728 0.257
NP_441208.1_9 Forward -70 -56 13.9626 0.103
NP_441208.1_9 Reverse -55 -69 10.0294 0.196
NP_442110.1_7 Reverse -58 -72 0.589577 0.256
NP_440856.1_4 Forward -74 -55 3.93269 0.115
NP_441083.1_5 Forward -67 -57 11.3864 0.0159
NP_441083.1_5 Reverse -58 -68 11.2881 0.0159
NP_442827.1_8 Reverse -50 -69 -0.984623 0.238
NP_441149.1_3 Reverse -5 -24 11.7008 0.124
NP_441738.1_2 Forward -65 -58 15.28 0.0102
NP_441738.1_2 Reverse -60 -67 15.28 0.0102
NP_441558.1_5 Forward -69 -50 4.916 0.267
NP_441558.1_5 Reverse -56 -75 3.83436 0.296
NP_440209.1_1 Reverse -58 -66 18.1123 0.00295
NP_440209.1_1 Forward -67 -59 18.1123 0.00295
NP_442889.1_10 Forward -361 -342 12.35 0.207
NP_441713.1_1 Forward -73 -54 -1.96717 0.113
NP_441713.1_1 Reverse -52 -71 -4.91709 0.113
NP_440178.1_7 Reverse -57 -76 -21.6334 0.232
NP_441716.1_1 Forward -67 -53 13.8643 0.0689
NP_441716.1_2 Reverse -116 -135 -1.04673 0.28
NP_441327.1_5 Forward -353 -344 16.2243 0.164
NP_442111.1_4 Forward -68 -54 14.7492 0.0275
NP_441163.1_1 Reverse -50 -67 8.19958 0.232
NP_440906.1_5 Forward -66 -59 15.8704 0.0124
NP_440906.1_5 Reverse -59 -66 15.8704 0.0124
NP_440747.1_10 Forward -70 -58 -1.92764 0.0192
NP_440747.1_10 Reverse -55 -67 -2.02597 0.0196
NP_441130.1_10 Reverse -56 -70 17.9942 0.0144
NP_441130.1_10 Forward -69 -55 11.111 0.107
NP_441486.1_1 Reverse -55 -69 -3.54032 0.179
NP_441486.1_1 Forward -70 -56 -4.32697 0.194
NP_442634.1_4 Reverse -56 -70 4.52282 0.0764
NP_442634.1_4 Forward -69 -55 4.22782 0.0819
NP_441265.1_3 Reverse -52 -66 4.71948 0.181
NP_441265.1_3 Forward -73 -59 1.96621 0.2
NP_442848.1_1 Reverse -52 -66 -3.73699 0.27
NP_443018.1_3 Forward -66 -59 14.8871 0.0123
NP_443018.1_3 Reverse -59 -66 14.8871 0.0123
NP_441316.1_7 Reverse -56 -71 3.81481 0.137
NP_441634.1_8 Forward -69 -55 6.29277 0.114
NP_441634.1_8 Reverse -56 -70 -4.32697 0.295
NP_440376.1_1 Forward -67 -58 19.4693 0.000692
NP_440376.1_1 Reverse -58 -67 19.4693 0.000692
NP_441588.1_4 Reverse -60 -70 6.66654 0.185
NP_440266.1_3 Forward -287 -271 16.6147 0.266
NP_442687.1_7 Reverse -57 -67 15.8113 0.0125
NP_442687.1_7 Forward -68 -58 9.02648 0.0994
NP_440642.1_10 Reverse -19 -33 6.78381 0.225
NP_440360.1_5 Reverse -28 -47 0.982764 0.297
NP_442658.1_1 Reverse -56 -66 18.7607 0.00222
NP_442658.1_1 Forward -69 -59 15.9091 0.00966
NP_442198.1_3 Reverse -46 -65 3.73603 0.285
NP_440141.1_8 Forward -31 -12 6.39097 0.261
NP_442205.1_9 Forward -25 -9 9.49831 0.102
NP_442205.1_9 Reverse -206 -222 0.353528 0.264
NP_442205.1_9 Reverse -52 -68 -1.41643 0.264
NP_441414.1_9 Forward -67 -48 1.57275 0.073
NP_440184.1_1 Forward -245 -226 5.55585 0.21
NP_440184.1_7 Reverse -168 -187 17.234 0.152
NP_440720.1_1 Reverse -47 -66 3.53937 0.26
NP_441958.1_5 Forward -68 -58 21.2195 0.000805
NP_441958.1_5 Reverse -57 -67 12.2714 0.00183
NP_439905.1_1 Forward -66 -53 9.85238 0.216
NP_440984.1_7 Forward -72 -58 6.88276 0.195
NP_439990.1_5 Forward -72 -59 8.57408 0.168
NP_442376.1_2 Reverse -53 -72 -6.09707 0.286
NP_442911.1_2 Reverse -48 -67 6.78429 0.0277
NP_442911.1_2 Forward -77 -58 -1.57384 0.0871
NP_440153.1_5 Forward -66 -52 4.22782 0.199
NP_440993.1_2 Forward -72 -56 13.3332 0.0656
NP_440993.1_2 Reverse -53 -69 3.10679 0.262
NP_442002.1_9 Reverse -57 -64 10.7572 0.185
NP_440809.1_9 Forward -76 -58 1.49411 0.121
NP_440809.1_9 Reverse -49 -67 -7.65067 0.225
NP_441294.1_7 Reverse -54 -68 15.7779 0.0201
NP_441294.1_7 Forward -195 -181 9.34661 0.249
NP_441646.1_1 Reverse -51 -70 2.45773 0.218
NP_442438.1_10 Reverse -53 -67 14.3559 0.0311
NP_441000.1_6 Forward -68 -54 4.71948 0.0933
NP_441000.1_6 Reverse -57 -71 3.44117 0.111
NP_440605.1_4 Forward -77 -58 16.9686 0.104
NP_440147.1_4 Reverse -56 -69 12.2123 0.0326
NP_440147.1_4 Forward -69 -56 11.819 0.0326
NP_441550.1_8 Forward -69 -59 17.4824 0.00754
NP_441550.1_8 Reverse -56 -66 10.501 0.066
NP_441916.1_7 Reverse -58 -68 18.9579 0.00144
NP_441916.1_7 Forward -67 -57 18.4663 0.00144
NP_440465.1_10 Forward -70 -51 1.17943 0.283
NP_441041.1_7 Forward -70 -58 18.3015 0.00558
NP_441041.1_7 Reverse -55 -67 10.2357 0.1
NP_441725.1_5 Forward -66 -56 9.02648 0.0553
NP_441725.1_5 Reverse -59 -69 8.92815 0.0553
NP_439966.1_7 Reverse -56 -66 17.4824 0.00636
NP_439966.1_7 Forward -69 -59 13.8442 0.0234
NP_439966.1_9 Reverse -56 -65 10.7178 0.0863
NP_439966.1_9 Forward -69 -60 0.983037 0.253
NP_442941.1_3 Reverse -59 -69 10.9931 0.0116
NP_442941.1_3 Forward -66 -56 2.53664 0.14
NP_440289.1_2 Forward -70 -57 5.03416 0.0636
NP_440289.1_2 Reverse -55 -68 3.46087 0.078
NP_440260.1_8 Reverse -12 -30 5.52568 0.154
NP_442281.1_1 Forward -72 -58 7.17714 0.106
NP_441334.1_7 Forward -69 -50 -20.1584 0.275
NP_441079.1_7 Forward -286 -267 4.32522 0.158
NP_441457.1_7 Forward -69 -50 1.27776 0.276
NP_441644.1_6 Reverse -58 -68 19.0557 0.000803
NP_441644.1_6 Forward -67 -57 10.1076 0.0628
NP_440253.1_2 Reverse -58 -76 12.1139 0.0299
NP_440253.1_2 Forward -67 -49 -1.75081 0.249
NP_440929.1_8 Forward -67 -58 19.2726 0.000701
NP_440929.1_8 Reverse -58 -67 19.2726 0.000701
NP_442933.1_10 Forward -67 -58 17.601 0.00325
NP_442933.1_10 Reverse -58 -67 17.601 0.00325
NP_440430.1_5 Reverse -334 -353 13.4708 0.23
NP_441751.2_8 Reverse -59 -73 2.65453 0.0782
NP_441751.2_8 Forward -66 -52 -3.24533 0.137
NP_442554.1_8 Reverse -59 -69 19.1546 0.00369
NP_442554.1_8 Forward -66 -56 16.008 0.0065
NP_442554.1_9 Forward -316 -297 12.5018 0.279
NP_441762.1_7 Forward -68 -56 12.527 0.0142
NP_441762.1_7 Reverse -57 -69 11.7404 0.0142
NP_442142.1_4 Forward -70 -57 14.1783 0.0311
NP_442142.1_4 Reverse -55 -68 6.60689 0.16
NP_442292.1_1 Reverse -59 -68 17.5026 0.00435
NP_442292.1_1 Forward -66 -57 9.63616 0.0183
NP_442476.1_6 Forward -66 -52 14.4542 0.0401
NP_441711.1_3 Forward -308 -290 19.0954 0.18
NP_443009.1_5 Forward -68 -57 19.626 0.00102
NP_443009.1_5 Reverse -57 -68 7.82632 0.118
NP_443009.1_5 Reverse -134 -145 6.05637 0.177
NP_441715.1_4 Forward -66 -56 9.32148 0.097
NP_441715.1_4 Reverse -59 -69 7.25653 0.108
NP_440730.1_4 Forward -40 -21 -5.60541 0.3
NP_442076.1_5 Reverse -264 -283 5.11266 0.293
NP_442076.1_5 Forward -242 -223 5.01433 0.293
NP_441198.1_8 Forward -69 -59 15.4199 0.0427
NP_440379.1_5 Forward -34 -15 -11.6036 0.299
NP_441468.1_1 Forward -66 -59 15.8704 0.0124
NP_441468.1_1 Reverse -59 -66 15.8704 0.0124
NP_441015.1_10 Forward -72 -53 -8.26035 0.272
NP_441673.1_1 Forward -67 -58 20.8459 0.000698
NP_441673.1_1 Reverse -58 -67 20.8459 0.000698
NP_441826.1_2 Reverse -52 -66 1.08123 0.164
NP_442868.1_6 Forward -69 -59 8.63316 0.0555
NP_442868.1_6 Reverse -56 -66 8.53483 0.0555
NP_442719.1_2 Reverse -7 -25 3.8533 0.155
NP_441251.1_7 Forward -99 -86 10.049 0.294
NP_442427.1_8 Forward -76 -57 12.0942 0.152
NP_441911.1_10 Forward -364 -345 9.33025 0.233
NP_442808.1_1 Reverse -57 -67 18.4657 0.00201
NP_442808.1_1 Forward -68 -58 8.73102 0.0481
NP_442808.1_1 Forward -395 -385 3.51951 0.238
NP_440145.1_3 Forward -77 -58 -1.27885 0.15
NP_442050.1_5 Forward -69 -59 17.1874 0.00812
NP_442050.1_5 Reverse -56 -66 8.23937 0.234
NP_442903.1_2 Forward -365 -346 4.53544 0.215
NP_442342.1_9 Reverse -56 -72 10.3833 0.137
NP_441114.1_3 Forward -171 -162 6.39124 0.277
NP_441878.1_6 Forward -68 -58 10.5014 0.0176
NP_441878.1_6 Reverse -57 -67 10.4031 0.0176
NP_441036.1_8 Reverse -57 -67 17.7779 0.000554
NP_441036.1_8 Forward -68 -58 15.713 0.00724
NP_441557.1_5 Forward -67 -58 19.9609 0.000699
NP_441557.1_5 Reverse -58 -67 19.9609 0.000699
NP_441445.1_1 Forward -76 -57 10.5209 0.0945
NP_441445.1_1 Forward -305 -286 9.73422 0.103
NP_441445.1_1 Reverse -49 -68 2.0644 0.243
NP_442066.2_9 Forward -71 -58 9.95071 0.158
NP_441433.1_8 Forward -29 -10 6.98095 0.174
NP_441308.1_8 Forward -69 -59 12.4681 0.218
NP_441308.1_8 Reverse -56 -66 9.22315 0.226
NP_442830.1_5 Reverse -14 -28 4.22722 0.239
NP_441564.1_10 Forward -60 -41 1.86774 0.287
NP_442183.1_1 Reverse -58 -72 8.75105 0.109
NP_442397.1_1 Forward -96 -82 13.8282 0.296
NP_441574.1_1 Forward -46 -27 -6.78538 0.28
NP_441467.1_10 Reverse -344 -358 5.60446 0.281
NP_442347.1_2 Forward -66 -57 11.1111 0.056
NP_442347.1_2 Reverse -87 -96 5.21127 0.237
NP_442347.1_2 Reverse -59 -68 3.34298 0.284
NP_442888.1_6 Forward -78 -59 1.17943 0.298
NP_441037.1_4 Forward -69 -59 16.5761 0.0168
NP_441037.1_4 Reverse -56 -66 16.2838 0.0168
NP_442317.1_6 Reverse -53 -72 2.94938 0.267
NP_441633.1_3 Reverse -56 -69 5.91914 0.0481
NP_441633.1_3 Forward -69 -56 3.95252 0.0699
NP_440136.1_2 Forward -66 -59 15.9687 0.0123
NP_440136.1_2 Reverse -59 -66 15.9687 0.0123
NP_442998.1_5 Forward -83 -73 10.8948 0.201
NP_442998.1_5 Forward -288 -278 10.0098 0.231
NP_442998.1_10 Forward -65 -58 15.5754 0.0102
NP_442998.1_10 Reverse -60 -67 15.5754 0.0102
NP_440299.1_1 Reverse -54 -67 13.5883 0.0298
NP_441799.1_1 Reverse -54 -68 15.0436 0.0206
NP_441799.1_1 Forward -71 -57 14.0603 0.0274
NP_441007.1_10 Forward -72 -59 5.23083 0.182
NP_440256.1_1 Forward -70 -51 -0.983855 0.0988
NP_440256.1_1 Forward -224 -205 -3.73712 0.138
NP_441559.1_8 Reverse -53 -67 9.73436 0.0625
NP_441559.1_8 Reverse -11 -25 -2.65535 0.192
NP_441559.1_8 Forward -72 -58 -7.47356 0.294
NP_442860.1_3 Forward -267 -248 10.1275 0.258
NP_440915.1_6 Reverse -54 -68 13.7659 0.0187
NP_440915.1_6 Forward -71 -57 4.52282 0.0953
NP_441866.1_4 Reverse -344 -357 14.5093 0.273
NP_441464.1_8 Reverse -58 -72 8.84938 0.194
NP_441464.1_8 Forward -67 -53 8.55439 0.194
NP_441199.1_6 Reverse -54 -73 1.0811 0.226
NP_442993.1_1 Reverse -58 -74 -0.531451 0.077
NP_442386.1_9 Reverse -57 -66 15.7322 0.0144
NP_442386.1_9 Forward -68 -59 6.39082 0.219
NP_441340.1_5 Forward -66 -59 15.6737 0.0124
NP_441340.1_5 Reverse -59 -66 15.6737 0.0124
NP_441271.1_1 Reverse -52 -70 10.8348 0.262
NP_440186.1_6 Forward -363 -344 23.6972 0.0391
NP_440586.1_1 Reverse -51 -70 -4.42544 0.278
NP_440586.1_8 Forward -66 -59 13.2151 0.026
NP_440586.1_8 Reverse -59 -66 13.2151 0.026
NP_442251.1_6 Forward -66 -59 15.2804 0.0124
NP_442251.1_6 Reverse -59 -66 15.2804 0.0124
NP_440192.1_4 Reverse -56 -75 9.10654 0.284
NP_442959.1_5 Reverse -266 -285 10.1275 0.224
NP_441262.1_3 Reverse -58 -65 14.7888 0.0223
NP_441262.1_3 Forward -67 -60 14.7888 0.0223
NP_443051.1_1 Forward -68 -59 19.5676 0.00335
NP_443051.1_1 Reverse -57 -66 10.4228 0.00754
NP_439937.1_9 Forward -68 -51 22.0642 0.00605
NP_439937.1_9 Reverse -57 -74 2.69307 0.0798
NP_440439.1_1 Reverse -55 -68 18.8005 0.0105
NP_440439.1_1 Forward -70 -57 10.344 0.0369
NP_440372.1_2 Forward -66 -59 16.3621 0.0124
NP_440372.1_2 Reverse -59 -66 16.3621 0.0124
NP_440574.1_7 Reverse -37 -56 13.3725 0.191
NP_440574.1_7 Forward -305 -286 10.0292 0.283
NP_440819.1_5 Forward -84 -76 7.68924 0.266
NP_439977.1_5 Reverse -52 -71 3.24438 0.16
NP_441572.1_7 Forward -73 -54 -1.47551 0.188
NP_440267.1_2 Forward -203 -189 8.16044 0.173
NP_442384.1_10 Forward -67 -54 10.2457 0.0465
NP_442384.1_10 Reverse -86 -99 0.510939 0.289
NP_442114.1_4 Forward -67 -56 12.1534 0.107
NP_442262.1_10 Forward -66 -59 14.1988 0.0123
NP_442262.1_10 Reverse -59 -66 14.1988 0.0123
NP_441689.1_5 Forward -69 -59 8.43603 0.132
NP_440344.1_10 Forward -74 -57 8.88863 0.00953
NP_440344.1_10 Reverse -51 -68 1.41547 0.0308
NP_440562.1_10 Forward -230 -212 5.52568 0.289
NP_441965.1_10 Reverse -209 -225 3.00846 0.277
NP_440297.1_9 Forward -66 -56 -0.216628 0.282
NP_440297.1_9 Reverse -59 -69 -0.314959 0.282
NP_442280.1_10 Reverse -11 -29 6.72063 0.268
NP_441896.1_3 Reverse -49 -68 1.57275 0.213
NP_442129.1_6 Reverse -237 -256 17.0491 0.246
NP_440999.1_9 Reverse -54 -68 9.63603 0.0615
NP_440888.1_2 Forward -67 -53 18.1901 0.00261
NP_440888.1_2 Reverse -58 -72 15.6336 0.00976
NP_442948.1_2 Forward -68 -49 7.27595 0.229
NP_442277.1_4 Reverse -49 -68 14.4533 0.0423
NP_442277.1_7 Forward -361 -345 -1.33008 0.268
NP_442033.1_10 Reverse -56 -75 -7.57203 0.186
NP_442033.1_10 Reverse -14 -33 -13.2752 0.284
NP_442033.1_10 Forward -69 -50 -14.5535 0.299
NP_440575.1_8 Reverse -234 -253 -1.18052 0.221
NP_442077.1_9 Forward -169 -150 -6.29373 0.289
NP_442512.1_4 Reverse -203 -221 6.214 0.29
NP_441543.1_2 Forward -66 -57 18.486 0.00236
NP_441543.1_2 Reverse -59 -68 15.9293 0.00518
NP_442845.1_2 Forward -73 -59 8.16106 0.195
NP_442845.1_2 Reverse -52 -66 3.93283 0.272
NP_441551.1_5 Reverse -54 -70 18.7407 0.0365
NP_441469.1_8 Reverse -57 -66 16.126 0.00797
NP_441469.1_8 Forward -68 -59 6.5879 0.227
NP_443064.1_6 Reverse -58 -68 10.8217 0.13
NP_442578.1_7 Forward -66 -59 14.5921 0.026
NP_442578.1_7 Reverse -59 -66 14.5921 0.026
NP_441462.1_2 Reverse -58 -68 20.2362 0.000805
NP_441462.1_2 Forward -67 -57 11.5831 0.00406
NP_441621.1_7 Reverse -56 -70 13.9626 0.0266
NP_441621.1_7 Forward -69 -55 6.48943 0.068
NP_443062.1_1 Reverse -58 -76 7.96088 0.163
NP_443062.1_6 Reverse -50 -69 3.14605 0.243
NP_442204.1_5 Reverse -48 -67 4.42435 0.167
NP_441560.1_8 Reverse -215 -234 12.584 0.25
NP_440516.1_8 Forward -67 -58 16.9127 0.00442
NP_440516.1_8 Reverse -58 -67 16.9127 0.00442
NP_442428.1_5 Forward -66 -59 15.8704 0.0124
NP_442428.1_5 Reverse -59 -66 15.8704 0.0124
NP_442823.1_8 Forward -57 -38 10.8159 0.297
NP_440673.1_3 Forward -65 -58 12.4288 0.0426
NP_440673.1_3 Reverse -60 -67 12.4288 0.0426
NP_440718.1_2 Reverse -302 -321 15.1424 0.197
NP_440865.1_9 Forward -73 -54 5.40766 0.0798
NP_441052.1_2 Forward -67 -57 10.5014 0.0285
NP_441052.1_2 Reverse -58 -68 10.4031 0.0285
NP_441052.1_2 Reverse -212 -222 2.7333 0.193
NP_442219.1_8 Forward -297 -278 6.81424 0.287
NP_442219.1_9 Forward -66 -57 8.35786 0.0681
NP_442219.1_9 Reverse -59 -68 8.25953 0.0681
NP_440436.1_4 Forward -66 -57 18.1905 0.00233
NP_440436.1_4 Reverse -59 -68 9.24241 0.0871
NP_441884.1_9 Forward -70 -51 -21.24 0.235
NP_441719.1_4 Forward -66 -59 16.3621 0.0124
NP_441719.1_4 Reverse -59 -66 16.3621 0.0124
NP_441733.1_10 Forward -70 -57 18.1122 0.0292
NP_442366.1_3 Reverse -57 -75 -4.79907 0.276
NP_441115.1_4 Forward -68 -50 16.6363 0.0262
NP_441115.1_4 Reverse -57 -75 12.8014 0.0969
NP_442694.1_9 Forward -237 -218 14.3558 0.187
NP_440328.1_4 Reverse -22 -41 -0.295539 0.272
NP_443054.1_2 Reverse -56 -70 3.34284 0.24
NP_443054.1_2 Forward -69 -55 3.04785 0.24
NP_441851.1_10 Reverse -57 -67 16.008 0.00552
NP_441851.1_10 Forward -68 -58 8.53483 0.114
NP_442515.1_1 Reverse -57 -71 -3.54032 0.292
NP_442515.1_1 Forward -68 -54 -4.03198 0.298
NP_441982.1_6 Forward -211 -202 12.9628 0.274
NP_441046.1_2 Reverse -207 -226 6.98095 0.221
NP_442689.1_8 Reverse -344 -361 -6.25434 0.28
NP_441349.1_10 Reverse -48 -67 2.3594 0.075
NP_441409.1_6 Reverse -52 -71 1.0811 0.0639
NP_440432.1_9 Reverse -59 -74 6.76473 0.0455
NP_439960.1_10 Forward -32 -14 -4.70074 0.296
NP_440474.1_8 Forward -66 -52 14.1586 0.0658
NP_440474.1_8 Reverse -59 -73 14.1586 0.0658
NP_440431.1_4 Forward -85 -66 -9.40638 0.284
NP_440588.1_2 Reverse -49 -68 7.07928 0.0524
NP_441031.1_10 Reverse -75 -94 14.246 0.286
NP_442006.1_2 Forward -31 -14 -8.81095 0.197
NP_441078.1_4 Forward -67 -58 19.6659 0.0007
NP_441078.1_4 Reverse -58 -67 19.6659 0.0007
NP_442443.1_4 Forward -355 -345 15.1225 0.179
NP_440526.1_3 Reverse -59 -70 11.6612 0.0646
NP_440526.1_3 Forward -66 -55 2.41814 0.267
NP_441432.1_8 Forward -68 -59 16.8143 0.00595
NP_441432.1_8 Reverse -57 -66 8.25953 0.0755
NP_441432.1_9 Reverse -346 -359 16.9367 0.0855
NP_442320.1_8 Forward -73 -59 7.57108 0.019
NP_442320.1_8 Reverse -52 -66 -0.197071 0.0817
NP_441732.1_2 Forward -71 -55 -5.34967 0.0476
NP_441732.1_2 Forward -44 -28 -6.23465 0.0495
NP_441732.1_2 Reverse -54 -70 -16.0677 0.164
NP_442298.1_10 Forward -66 -47 14.6508 0.219
NP_442727.1_1 Reverse -45 -59 14.6509 0.223
NP_440281.1_6 Reverse -209 -228 10.0292 0.268
NP_440713.1_4 Reverse -48 -67 1.76941 0.279
NP_442489.1_7 Forward -67 -58 20.1576 0.000695
NP_442489.1_7 Reverse -58 -67 20.1576 0.000695
NP_442079.1_7 Forward -66 -47 3.04771 0.214
NP_440559.1_1 Forward -66 -57 8.75118 0.0586
NP_440559.1_1 Reverse -59 -68 8.65285 0.0586
NP_441659.2_8 Reverse -58 -68 20.9245 0.000805
NP_441659.2_8 Forward -67 -57 11.9764 0.0147
NP_440779.1_5 Reverse -58 -75 -14.7108 0.269
NP_442346.1_5 Forward -68 -58 16.303 0.00248
NP_442346.1_5 Reverse -57 -67 9.02648 0.118
NP_440545.1_3 Forward -71 -54 14.8868 0.0141
NP_440545.1_3 Reverse -54 -71 2.89044 0.0923
NP_440545.1_3 Reverse -27 -44 -3.8944 0.214
NP_440449.1_6 Reverse -50 -68 4.6571 0.294
NP_441948.1_4 Reverse -51 -69 1.88744 0.129
NP_441948.1_4 Forward -74 -56 -0.177514 0.139
NP_441833.1_4 Forward -66 -59 15.9687 0.0124
NP_441833.1_4 Reverse -59 -66 15.9687 0.0124
NP_441329.1_3 Reverse -202 -212 12.593 0.273
NP_441112.1_6 Forward -212 -193 -4.03212 0.296
NP_442162.1_9 Forward -66 -59 16.2637 0.0124
NP_442162.1_9 Reverse -59 -66 16.2637 0.0124
NP_442796.1_2 Forward -59 -40 17.3826 0.185
NP_442199.1_5 Forward -75 -56 15.6341 0.0351
NP_442199.1_5 Reverse -204 -223 -4.72043 0.229
NP_442199.1_5 Reverse -50 -69 -7.37537 0.293
NP_442140.1_3 Forward -66 -56 17.4829 0.0159
NP_442140.1_3 Reverse -59 -69 7.94484 0.124
NP_441671.1_1 Reverse -10 -29 -0.590531 0.273
NP_440875.1_9 Reverse -60 -70 16.8403 0.0145
NP_440875.1_9 Forward -65 -55 15.2829 0.0295
NP_441813.1_5 Reverse -56 -66 10.0098 0.0208
NP_441813.1_5 Forward -69 -59 8.73149 0.0367
NP_440594.1_8 Forward -66 -53 10.6384 0.159
NP_440590.1_4 Forward -66 -53 14.1789 0.0112
NP_440590.1_4 Reverse -59 -72 4.8375 0.0585
NP_440567.1_1 Forward -66 -52 15.5359 0.017
NP_440567.1_1 Reverse -59 -73 3.14618 0.151
NP_442497.1_10 Reverse -59 -68 17.601 0.00813
NP_442497.1_10 Forward -66 -57 10.4228 0.0087
NP_440821.1_4 Reverse -56 -66 18.7612 0.00422
NP_440821.1_4 Forward -69 -59 10.7964 0.0146
NP_441239.1_9 Forward -69 -57 17.4436 0.0146
NP_441239.1_9 Reverse -56 -68 16.0669 0.0175
NP_441727.1_3 Forward -74 -55 4.81767 0.262
NP_441892.1_1 Forward -76 -59 -0.846137 0.192
NP_442669.1_1 Reverse -206 -225 1.27776 0.235
NP_442044.1_1 Forward -45 -26 -13.5702 0.277
NP_440863.1_1 Forward -354 -340 14.096 0.248
NP_440546.1_4 Reverse -58 -68 13.5365 0.0459
NP_440546.1_4 Forward -67 -57 11.8882 0.0679
NP_440546.1_6 Reverse -48 -67 9.63589 0.247
NP_440462.1_6 Forward -69 -59 19.4496 0.00371
NP_440462.1_6 Reverse -56 -66 17.9746 0.00578
NP_442611.1_1 Forward -72 -53 11.5042 0.076
NP_440868.1_4 Reverse -54 -66 19.6068 0.00963
NP_440868.1_4 Forward -71 -59 7.21714 0.0749
NP_441582.1_5 Forward -69 -50 9.24175 0.164
NP_442402.1_1 Reverse -272 -291 11.8975 0.254
NP_442402.1_2 Reverse -277 -291 13.4703 0.263
NP_442402.1_6 Forward -292 -283 13.2744 0.289
NP_441848.1_7 Reverse -69 -88 0.883656 0.228
NP_441084.1_6 Forward -69 -55 10.6046 0.234
NP_442039.1_4 Forward -66 -59 15.1821 0.0124
NP_442039.1_4 Reverse -59 -66 15.1821 0.0124
NP_442679.1_1 Reverse -301 -320 6.09597 0.147
NP_442837.1_3 Forward -66 -59 15.7721 0.0124
NP_442837.1_3 Reverse -59 -66 15.7721 0.0124
NP_442053.1_1 Forward -67 -58 18.3876 0.0007
NP_442053.1_1 Reverse -58 -67 18.3876 0.0007
NP_440505.1_3 Forward -69 -59 15.418 0.0114
NP_440505.1_3 Reverse -56 -66 14.1397 0.0235
NP_440505.1_3 Forward -27 -17 5.48657 0.227
NP_440351.1_8 Reverse -374 -392 12.9988 0.162
NP_440914.1_1 Reverse -58 -68 16.3248 0.00196
NP_440914.1_1 Forward -67 -57 8.6151 0.186
NP_441011.1_8 Forward -66 -57 16.9127 0.00602
NP_441011.1_8 Reverse -59 -68 16.6177 0.00602
NP_440068.1_2 Reverse -212 -231 27.3355 0.00266
NP_442533.1_6 Forward -67 -58 17.2076 0.00137
NP_442533.1_6 Reverse -58 -67 17.2076 0.00137
NP_442533.1_6 Forward -221 -212 3.24465 0.219
NP_442232.1_3 Reverse -50 -69 -6.09707 0.179
NP_441219.1_8 Forward -253 -234 15.6332 0.189
NP_439944.1_9 Reverse -59 -69 17.7779 0.00341
NP_439944.1_9 Forward -66 -56 10.4031 0.0887
NP_441028.1_6 Reverse -18 -28 10.6976 0.197
NP_441028.1_6 Forward -35 -25 5.48612 0.255
NP_441028.1_6 Reverse -281 -291 4.89613 0.275
NP_441028.1_6 Reverse -76 -86 4.7978 0.277
NP_441527.1_4 Forward -358 -339 -2.33998 0.156
NP_441527.1_4 Forward -359 -340 -2.91293 0.162
NP_441527.1_4 Reverse -363 -382 -6.15965 0.215
NP_441527.1_4 Forward -360 -341 -8.83343 0.251
NP_441527.1_4 Reverse -303 -322 -9.31089 0.256
NP_441527.1_4 Forward -53 -34 -13.0351 0.298
NP_441527.1_7 Reverse -11 -30 13.175 0.282
NP_440115.1_6 Reverse -55 -65 9.61647 0.115
NP_440115.1_6 Forward -70 -60 7.84651 0.146
NP_441106.1_1 Forward -68 -59 18.486 0.0028
NP_441106.1_1 Reverse -57 -66 18.191 0.0028
NP_442588.1_6 Reverse -377 -396 0.392778 0.252
NP_442306.1_10 Reverse -53 -72 -10.6203 0.11
NP_442306.1_10 Forward -72 -53 -19.2734 0.197
NP_441286.1_1 Forward -68 -56 5.34885 0.0259
NP_441286.1_1 Reverse -57 -69 5.15219 0.0259
NP_440670.1_8 Forward -67 -58 18.3876 0.000699
NP_440670.1_8 Reverse -58 -67 18.3876 0.000699
NP_440886.1_7 Reverse -57 -67 17.7774 0.0011
NP_440886.1_7 Forward -68 -58 8.04271 0.0805
NP_440886.1_7 Reverse -15 -25 4.99446 0.205
NP_442614.1_2 Forward -67 -53 5.89945 0.296
NP_442614.1_2 Forward -25 -11 5.89945 0.296
NP_439995.1_5 Reverse -48 -67 14.3558 0.141
NP_442072.1_9 Reverse -57 -75 -11.3872 0.0789
NP_442072.1_9 Forward -68 -50 -21.712 0.212
NP_440907.2_8 Reverse -59 -69 19.1541 0.00362
NP_440907.2_8 Forward -66 -56 17.4824 0.00685
NP_441463.1_3 Reverse -48 -67 -1.27885 0.138
NP_441463.1_3 Forward -77 -58 -1.7705 0.146
NP_442842.1_10 Reverse -69 -88 5.7076 0.207
NP_442842.1_10 Reverse -341 -360 1.82451 0.254
NP_441626.1_2 Forward -66 -59 15.7721 0.0124
NP_441626.1_2 Reverse -59 -66 15.7721 0.0124
NP_442365.1_5 Forward -66 -47 8.94757 0.215
NP_442615.1_1 Reverse -49 -67 13.0972 0.0119
NP_442615.1_1 Forward -76 -58 12.1139 0.015
NP_440387.1_1 Forward -67 -51 -0.43312 0.138
NP_441431.1_2 Reverse -55 -69 16.9119 0.0308
NP_441431.1_2 Forward -70 -56 11.5037 0.136
NP_441488.1_7 Forward -73 -54 0.982764 0.296
NP_441836.1_2 Reverse -52 -71 -3.54046 0.239
NP_441993.1_4 Forward -67 -48 11.0117 0.246
NP_441174.1_2 Reverse -55 -69 14.4542 0.161
NP_441174.1_2 Forward -70 -56 12.586 0.248
NP_440114.1_10 Reverse -58 -72 16.8142 0.0145
NP_440114.1_10 Forward -67 -53 10.3243 0.148
NP_441510.2_2 Forward -71 -52 2.45694 0.272
NP_441720.1_2 Forward -71 -52 6.09517 0.217
NP_440766.1_4 Forward -71 -57 6.98109 0.097
NP_440278.1_1 Reverse -317 -336 8.35759 0.215
NP_442930.1_1 Reverse -71 -81 11.5826 0.258
NP_439910.1_2 Forward -75 -58 -3.10775 0.0339
NP_439910.1_2 Reverse -50 -67 -21.7906 0.19
NP_439910.1_2 Forward -199 -182 -22.5773 0.267
NP_440502.1_3 Reverse -18 -28 14.9587 0.2
NP_440457.1_1 Reverse -54 -66 9.77374 0.092
NP_440798.1_6 Forward -66 -53 12.409 0.0468
NP_440798.1_6 Reverse -59 -72 0.707601 0.251
NP_442680.1_5 Forward -95 -76 0.169919 0.268
NP_440801.1_8 Reverse -211 -230 3.24438 0.229
NP_442509.1_9 Forward -67 -57 16.2041 0.00739
NP_442509.1_9 Reverse -58 -68 8.04271 0.192
NP_440554.1_4 Reverse -59 -69 15.418 0.0199
NP_440554.1_4 Forward -66 -56 13.943 0.0218
NP_441885.1_5 Forward -67 -57 11.4848 0.00668
NP_441885.1_5 Reverse -58 -68 11.3864 0.00668
NP_441614.1_6 Forward -257 -238 15.3382 0.275
NP_442341.1_7 Forward -68 -54 3.44117 0.224
NP_442341.1_7 Reverse -57 -71 3.04785 0.237
NP_441173.1_9 Reverse -282 -290 10.9338 0.242
NP_443000.1_7 Forward -69 -59 10.7964 0.0345
NP_443000.1_7 Reverse -56 -66 2.04498 0.226
NP_440552.1_5 Forward -374 -355 15.8846 0.174
NP_441842.1_1 Forward -65 -52 21.7498 0.0072
NP_441842.1_10 Reverse -51 -65 10.1277 0.171
NP_441842.1_10 Forward -74 -60 7.47274 0.257
NP_440275.1_3 Forward -69 -59 18.6629 0.0082
NP_440275.1_3 Reverse -56 -66 17.9746 0.0082
NP_440091.1_1 Reverse -54 -66 19.6068 0.0114
NP_440091.1_1 Forward -71 -59 10.8554 0.0429
NP_440091.1_1 Forward -195 -183 5.74217 0.109
NP_443010.1_10 Forward -70 -53 14.2702 0.0608
NP_443010.1_10 Reverse -55 -72 10.6948 0.119
NP_441122.1_1 Forward -300 -285 3.61814 0.281
NP_441207.1_7 Forward -81 -67 15.0642 0.179
NP_441105.1_3 Forward -78 -59 4.03102 0.0844
NP_440216.1_1 Forward -67 -53 7.9644 0.00737
NP_440216.1_1 Reverse -58 -72 6.09611 0.0162
NP_440216.1_9 Forward -28 -19 5.99792 0.289
NP_440172.1_1 Reverse -58 -68 17.5813 0.00421
NP_440172.1_1 Forward -67 -57 8.73149 0.0586
NP_442015.1_10 Reverse -178 -191 4.73917 0.162
NP_442015.1_10 Reverse -54 -67 3.16588 0.185
NP_441226.1_7 Forward -66 -59 14.4934 0.0123
NP_441226.1_7 Reverse -59 -66 14.4934 0.0123
NP_441111.1_7 Forward -66 -58 18.7023 0.00294
NP_441111.1_7 Reverse -59 -67 18.7023 0.00294
NP_441766.1_2 Forward -67 -58 17.5026 0.00297
NP_441766.1_2 Reverse -58 -67 17.5026 0.00297
NP_440416.1_1 Reverse -58 -77 -14.2585 0.284
NP_443052.1_8 Reverse -48 -67 -7.86702 0.164
NP_442116.1_6 Reverse -259 -276 14.4714 0.16
NP_442116.1_6 Reverse -72 -89 5.87715 0.289
NP_442154.1_1 Reverse -44 -62 -17.9754 0.273
NP_440261.1_5 Forward -66 -53 4.8375 0.0516
NP_440261.1_5 Reverse -59 -72 -3.12731 0.115
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCATCCGACCAACGTCTGTTCTGCTTTGTTTCGCTTATCTAAAAAAGAGGCAAAAATGAGACTTCTTGCCTATCAATTTATTTCTTCTAATGTTGGTTCTGCTTGGCTACTGTGGAAAAATGCCAATGATCTTTCAGAGATTAATCCTGACAGTGCAGAAGAATTTTTAACGGCAACTTGTCCATCACTTTCTCAAAAAACAATTGAACGACGTTCACAAACATTAAAAGCATGGCTCACTATCTTTCTGCAATACTGGGATTCTTAACGATTTGAGTTAGAACTACGACTGATTTTCATATTCTGGGGTTCATAAAGGGAAAAAATTTAAGAGGCGATCGCCGCCCAAAAAACAGCGGAGGATATTGTCACCCAGGGGAAAGCGGGCAATACGGATAGC

CDS

GTGCCGGAATTTTCCCTAGCTGAAATTACTTTTCCGGTGAAATTGGCCTATCTCCTCAGTGCCAGTGGCCTGTGCCCCAGTAGTAGCGAAGGGAGAAGGCAAATCAAGGGAGGAGCGGTGCGCTTAGATGGTGATCGCCTGGGGGATGTTAACCAGGAATACCAGAAACCGCAGGATTTGGACGGTAAGGTGCTCCAGGTAGGCAAGAAAAAATTTATTCGCTTCACTGCGAATTAG

Protein

MPEFSLAEITFPVKLAYLLSASGLCPSSSEGRRQIKGGAVRLDGDRLGDVNQEYQKPQDLDGKVLQVGKKKFIRFTAN