Your browser is old and dusty. Try Google Chrome!

Details for ssr1604

ORF ssr1604
Accession NP_440186.1
Symbol rpl28
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L28
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -63 -77 12.586 0.0452
NP_441061.1_2 Forward -337 -323 0.786239 0.199
NP_440557.1_1 Reverse -364 -383 1.67108 0.252
NP_440795.1_7 Forward -70 -63 14.6904 0.0123
NP_440795.1_7 Reverse -63 -70 14.6904 0.0123
NP_440795.1_7 Reverse -132 -139 11.3472 0.0978
NP_440795.1_7 Reverse -118 -125 6.92228 0.26
NP_441418.1_6 Reverse -268 -287 -29.5982 0.23
NP_440815.1_5 Reverse -62 -81 5.01433 0.286
NP_442291.1_5 Reverse -61 -77 15.3982 0.0222
NP_442291.1_5 Forward -72 -56 0.943514 0.155
NP_440897.1_6 Forward -71 -52 2.55527 0.165
NP_441453.1_4 Reverse -62 -70 16.539 0.00633
NP_441453.1_4 Forward -71 -63 16.539 0.00633
NP_441453.1_4 Forward -140 -132 4.93597 0.224
NP_441623.1_1 Reverse -336 -354 -1.65248 0.241
NP_442151.1_6 Reverse -131 -145 15.7325 0.0214
NP_442151.1_6 Forward -140 -126 9.73436 0.141
NP_442151.1_6 Forward -129 -115 5.70279 0.266
NP_441818.1_1 Reverse -63 -74 18.8393 0.00301
NP_441818.1_1 Forward -70 -59 16.3811 0.0166
NP_441818.1_9 Reverse -281 -300 -8.85033 0.283
NP_441818.1_9 Reverse -275 -294 -9.44032 0.291
NP_440226.1_1 Forward -71 -52 1.86774 0.286
NP_441465.1_8 Forward -82 -64 12.9005 0.174
NP_442169.1_1 Forward -265 -246 -1.18052 0.265
NP_442169.1_1 Forward -256 -237 -3.63879 0.298
NP_442623.1_1 Reverse -287 -306 -9.73531 0.253
NP_442623.1_3 Reverse -132 -151 -19.0768 0.274
NP_440996.1_2 Forward -378 -369 15.241 0.248
NP_442173.1_1 Forward -70 -62 15.4574 0.00633
NP_442173.1_1 Reverse -63 -71 15.4574 0.00633
NP_442173.1_1 Reverse -281 -289 7.00092 0.186
NP_442173.1_1 Forward -145 -137 6.3126 0.191
NP_442173.1_1 Reverse -132 -140 4.73931 0.258
NP_442752.1_4 Forward -71 -64 13.8055 0.0199
NP_442752.1_4 Reverse -62 -69 13.8055 0.0199
NP_443027.1_4 Forward -73 -63 14.0414 0.0452
NP_443027.1_4 Reverse -129 -139 13.4514 0.0521
NP_443027.1_4 Forward -142 -132 10.4031 0.131
NP_441812.1_3 Forward -141 -127 15.1426 0.106
NP_440784.1_7 Forward -70 -63 15.9687 0.0123
NP_440784.1_7 Reverse -63 -70 15.9687 0.0123
NP_440784.1_7 Forward -139 -132 12.4288 0.0475
NP_440784.1_7 Reverse -132 -139 6.23397 0.241
NP_442909.1_7 Reverse -63 -77 9.14375 0.156
NP_440061.1_9 Forward -73 -59 22.5167 0.0017
NP_440061.1_9 Reverse -129 -143 6.39049 0.248
NP_440110.1_8 Forward -142 -123 -3.44213 0.297
NP_442062.1_8 Forward -71 -61 17.6796 0.00193
NP_442062.1_8 Reverse -62 -72 17.3846 0.00193
NP_440761.1_8 Reverse -77 -96 17.5998 0.149
NP_441859.1_3 Reverse -130 -149 7.86512 0.151
NP_440304.1_4 Forward -73 -63 10.8948 0.051
NP_440304.1_4 Reverse -60 -70 9.91146 0.051
NP_440304.1_4 Reverse -129 -139 8.4365 0.0776
NP_442242.1_4 Forward -70 -63 14.3954 0.0124
NP_442242.1_4 Reverse -63 -70 14.3954 0.0124
NP_440044.1_8 Reverse -132 -151 8.84924 0.0723
NP_441781.1_7 Reverse -62 -81 0.982764 0.239
NP_441781.1_7 Forward -71 -52 -2.36049 0.289
NP_442048.1_5 Reverse -155 -174 13.9625 0.183
NP_441161.1_3 Forward -77 -59 9.16393 0.251
NP_441210.1_3 Reverse -378 -397 20.4523 0.128
NP_441619.1_8 Forward -77 -63 13.5686 0.114
NP_440893.1_3 Reverse -234 -253 -0.00131823 0.28
NP_441208.1_1 Reverse -118 -137 -4.52377 0.263
NP_441594.1_6 Reverse -101 -120 4.81767 0.211
NP_442110.1_7 Reverse -137 -151 6.09611 0.153
NP_442110.1_7 Reverse -131 -145 0.687908 0.252
NP_442110.1_7 Reverse -62 -76 0.196253 0.266
NP_441083.1_5 Reverse -62 -72 20.3345 0.00053
NP_441083.1_5 Forward -71 -61 19.3512 0.000718
NP_441083.1_5 Forward -11 -1 4.60159 0.136
NP_441083.1_5 Forward -299 -289 4.10993 0.158
NP_441083.1_5 Forward -119 -109 2.04498 0.195
NP_441738.1_2 Forward -69 -62 15.28 0.0102
NP_441738.1_2 Reverse -64 -71 15.28 0.0102
NP_441738.1_2 Reverse -238 -245 6.72528 0.236
NP_441558.1_5 Reverse -129 -148 10.1275 0.105
NP_441558.1_5 Forward -73 -54 7.17762 0.19
NP_440209.1_1 Reverse -62 -70 18.1123 0.00295
NP_440209.1_1 Forward -71 -63 18.1123 0.00295
NP_442889.1_8 Reverse -59 -73 11.012 0.0764
NP_441713.1_1 Reverse -56 -75 -5.9004 0.114
NP_441713.1_1 Forward -77 -58 -16.4218 0.283
NP_440178.1_7 Reverse -61 -80 3.73603 0.0199
NP_442570.1_3 Reverse -142 -161 -9.34199 0.298
NP_441716.1_1 Reverse -62 -76 12.9793 0.0689
NP_441716.1_1 Forward -71 -57 11.3077 0.0936
NP_441327.1_5 Forward -380 -371 15.0444 0.191
NP_442111.1_4 Forward -72 -58 18.4858 0.00671
NP_440343.1_3 Forward -125 -107 3.8533 0.266
NP_440906.1_5 Forward -70 -63 15.8704 0.0124
NP_440906.1_5 Reverse -63 -70 15.8704 0.0124
NP_440906.1_5 Reverse -132 -139 6.23397 0.234
NP_440906.1_5 Forward -139 -132 6.0373 0.262
NP_440747.1_10 Forward -74 -62 7.51213 0.00286
NP_440747.1_10 Reverse -59 -71 7.4138 0.00422
NP_441130.1_10 Forward -73 -59 18.1908 0.0142
NP_441130.1_10 Reverse -60 -74 5.99778 0.207
NP_441486.1_1 Forward -74 -60 14.5526 0.00628
NP_441486.1_1 Reverse -59 -73 3.53951 0.0575
NP_442634.1_4 Reverse -60 -74 5.80112 0.051
NP_442634.1_4 Forward -142 -128 -4.32697 0.195
NP_441014.1_5 Forward -304 -286 10.4422 0.263
NP_442848.1_1 Forward -77 -63 14.2576 0.0211
NP_442848.1_1 Reverse -56 -70 -3.63866 0.268
NP_442848.1_5 Forward -338 -320 3.46073 0.276
NP_442848.1_9 Reverse -229 -248 6.58763 0.186
NP_443018.1_3 Forward -70 -63 14.8871 0.0123
NP_443018.1_3 Reverse -63 -70 14.8871 0.0123
NP_443018.1_3 Reverse -132 -139 13.8055 0.024
NP_443018.1_3 Forward -139 -132 13.6088 0.0352
NP_443018.1_3 Reverse -158 -165 5.34899 0.212
NP_441634.1_8 Forward -73 -59 2.85119 0.16
NP_441634.1_8 Reverse -129 -143 2.35953 0.168
NP_441634.1_8 Forward -398 -384 -2.26202 0.295
NP_441634.1_8 Reverse -60 -74 -4.4253 0.295
NP_440376.1_1 Forward -71 -62 19.4693 0.000692
NP_440376.1_1 Reverse -62 -71 19.4693 0.000692
NP_440376.1_1 Reverse -150 -159 3.34298 0.206
NP_440376.1_1 Forward -244 -235 0.196389 0.283
NP_441588.1_4 Reverse -64 -74 8.63316 0.14
NP_442687.1_7 Reverse -61 -71 18.5646 0.0028
NP_442687.1_7 Forward -72 -62 8.92815 0.0994
NP_442687.1_7 Reverse -296 -306 3.61828 0.299
NP_441846.1_10 Forward -255 -236 -4.42544 0.165
NP_441846.1_10 Forward -261 -242 -21.24 0.256
NP_441846.1_10 Forward -252 -233 -23.1083 0.277
NP_442530.1_2 Reverse -304 -314 16.4013 0.194
NP_440642.1_10 Reverse -373 -387 14.8469 0.119
NP_440042.1_1 Reverse -282 -301 7.07928 0.253
NP_441950.1_8 Forward -130 -116 5.40779 0.281
NP_442658.1_1 Reverse -60 -70 16.0075 0.00966
NP_442658.1_1 Reverse -129 -139 10.3043 0.125
NP_442658.1_1 Forward -73 -63 6.76441 0.214
NP_442205.1_9 Reverse -56 -72 -2.5964 0.272
NP_440656.1_2 Reverse -362 -381 -0.885524 0.258
NP_440656.1_8 Forward -82 -63 -4.32711 0.198
NP_441414.1_9 Reverse -62 -81 12.7825 0.0151
NP_440800.1_1 Forward -54 -35 16.6165 0.218
NP_441487.1_6 Forward -79 -60 -0.000545616 0.259
NP_441317.1_4 Forward -209 -195 10.1324 0.29
NP_441958.1_2 Reverse -53 -72 11.9958 0.213
NP_441958.1_5 Reverse -61 -71 20.5312 0.000966
NP_441958.1_5 Forward -72 -62 12.2714 0.00183
NP_441958.1_5 Forward -12 -2 -0.609952 0.215
NP_439905.1_1 Forward -70 -57 11.0324 0.204
NP_440984.1_7 Forward -131 -117 4.91614 0.281
NP_442911.1_2 Forward -81 -62 7.7676 0.0234
NP_442911.1_2 Reverse -52 -71 0.982764 0.0628
NP_442911.1_2 Forward -150 -131 -3.73712 0.117
NP_440153.1_5 Reverse -63 -77 5.70279 0.191
NP_442064.1_1 Reverse -372 -391 -12.7836 0.28
NP_440602.1_8 Reverse -62 -76 16.3225 0.115
NP_441099.1_5 Forward -81 -62 -4.52377 0.146
NP_441099.1_5 Reverse -52 -71 -8.752 0.203
NP_442002.1_9 Reverse -61 -68 14.1004 0.074
NP_442013.1_7 Forward -245 -226 5.30933 0.299
NP_441294.1_7 Reverse -58 -72 20.3853 0.00239
NP_441294.1_7 Forward -75 -61 13.1862 0.0727
NP_441294.1_7 Reverse -293 -307 9.34661 0.249
NP_441646.1_1 Reverse -55 -74 10.4225 0.115
NP_441646.1_1 Reverse -144 -163 6.09597 0.174
NP_441646.1_7 Reverse -323 -337 17.6992 0.184
NP_442438.1_10 Forward -76 -62 9.2427 0.0676
NP_442438.1_10 Reverse -57 -71 5.01447 0.14
NP_442431.1_10 Reverse -317 -335 -0.374176 0.287
NP_442566.1_2 Reverse -248 -267 7.57094 0.289
NP_441000.1_6 Reverse -61 -75 4.81781 0.0933
NP_441000.1_6 Forward -72 -58 4.62115 0.0946
NP_441674.1_6 Forward -336 -317 2.16274 0.291
NP_440147.1_4 Reverse -60 -73 10.5407 0.0355
NP_440147.1_4 Forward -73 -60 10.049 0.0355
NP_440147.1_4 Forward -301 -288 3.85419 0.179
NP_441550.1_8 Reverse -60 -70 18.1707 0.00754
NP_441550.1_8 Forward -73 -63 12.3692 0.0336
NP_441550.1_8 Forward -142 -132 10.4026 0.0684
NP_441550.1_8 Reverse -108 -118 9.91099 0.0807
NP_441916.1_7 Forward -71 -61 16.893 0.00407
NP_441916.1_7 Reverse -62 -72 10.3048 0.0261
NP_441916.1_7 Forward -67 -57 3.32329 0.22
NP_441916.1_10 Reverse -123 -142 5.40766 0.213
NP_440206.1_10 Reverse -122 -141 14.4541 0.288
NP_441041.1_4 Forward -146 -127 -8.85033 0.208
NP_441041.1_4 Reverse -62 -81 -12.1936 0.26
NP_441041.1_7 Reverse -59 -71 10.916 0.0864
NP_442396.1_5 Forward -75 -62 8.18076 0.16
NP_440569.1_6 Forward -279 -260 1.17943 0.297
NP_441547.1_2 Reverse -51 -69 10.5406 0.186
NP_442004.1_6 Forward -71 -57 12.0943 0.115
NP_442004.1_6 Reverse -62 -76 1.37622 0.29
NP_441725.1_5 Forward -70 -60 11.7798 0.0247
NP_441725.1_5 Reverse -63 -73 11.2881 0.0247
NP_441725.1_5 Forward -139 -129 7.35486 0.101
NP_439966.1_7 Forward -73 -63 15.8108 0.0124
NP_439966.1_7 Reverse -60 -70 8.63269 0.132
NP_439966.1_7 Forward -142 -132 8.63269 0.132
NP_442941.1_3 Reverse -63 -73 19.9412 0.00262
NP_442941.1_3 Forward -70 -60 10.6981 0.0116
NP_442941.1_3 Forward -139 -129 0.668351 0.19
NP_440289.1_2 Forward -74 -61 16.1456 0.00946
NP_440289.1_2 Reverse -59 -72 12.5073 0.0143
NP_442281.1_1 Forward -76 -62 9.53707 0.0685
NP_442281.1_1 Reverse -126 -140 4.22722 0.203
NP_442281.1_1 Reverse -57 -71 2.06395 0.278
NP_441334.1_7 Forward -142 -123 -13.8652 0.235
NP_441334.1_7 Forward -291 -272 -21.1417 0.29
NP_441079.1_7 Reverse -336 -355 -6.3928 0.276
NP_442256.1_2 Reverse -60 -78 -7.65067 0.214
NP_441556.1_10 Reverse -323 -337 9.83247 0.287
NP_440498.1_1 Reverse -122 -140 -3.22577 0.259
NP_441644.1_6 Reverse -62 -72 17.3841 0.00127
NP_441644.1_6 Forward -71 -61 15.7125 0.0048
NP_441644.1_6 Forward -140 -130 5.48612 0.188
NP_441644.1_6 Reverse -131 -141 3.91283 0.256
NP_442215.1_2 Reverse -60 -76 -6.23465 0.266
NP_442029.1_6 Forward -87 -68 9.93088 0.182
NP_440929.1_8 Forward -71 -62 19.2726 0.000701
NP_440929.1_8 Reverse -62 -71 19.2726 0.000701
NP_440929.1_8 Reverse -131 -140 5.80125 0.117
NP_440929.1_8 Forward -140 -131 5.70292 0.123
NP_442933.1_10 Forward -71 -62 17.601 0.00325
NP_442933.1_10 Reverse -62 -71 17.601 0.00325
NP_442933.1_10 Forward -67 -58 3.7363 0.284
NP_441751.2_8 Reverse -63 -77 24.8773 0.00368
NP_441751.2_8 Forward -70 -56 4.32615 0.0511
NP_442554.1_8 Reverse -63 -73 15.9097 0.00747
NP_442554.1_8 Forward -70 -60 15.123 0.00944
NP_442554.1_8 Reverse -132 -142 13.648 0.0164
NP_442554.1_8 Forward -139 -129 12.5664 0.0248
NP_441762.1_7 Reverse -61 -73 1.7106 0.0735
NP_441762.1_7 Forward -72 -60 -6.84419 0.284
NP_442142.1_4 Forward -74 -61 7.49186 0.137
NP_442142.1_4 Reverse -59 -72 4.05029 0.234
NP_442292.1_1 Reverse -63 -72 18.486 0.00229
NP_442292.1_1 Forward -139 -130 13.9627 0.0183
NP_442292.1_1 Forward -70 -61 9.53783 0.0183
NP_442292.1_1 Reverse -132 -141 8.1612 0.0478
NP_442476.1_6 Forward -70 -56 18.3875 0.0295
NP_442476.1_6 Reverse -132 -146 4.52282 0.143
NP_443009.1_2 Forward -297 -278 2.94938 0.216
NP_443009.1_5 Forward -72 -61 15.7911 0.0107
NP_443009.1_5 Reverse -61 -72 11.1696 0.066
NP_443009.1_5 Forward -127 -116 4.38475 0.249
NP_441715.1_4 Reverse -63 -73 14.828 0.0268
NP_441715.1_4 Forward -70 -60 9.81313 0.097
NP_440015.1_9 Reverse -62 -80 15.5554 0.0365
NP_440379.1_5 Reverse -98 -117 -11.4069 0.296
NP_441468.1_1 Forward -70 -63 15.8704 0.0124
NP_441468.1_1 Reverse -63 -70 15.8704 0.0124
NP_441468.1_1 Reverse -132 -139 13.8055 0.0242
NP_441468.1_1 Forward -139 -132 6.0373 0.223
NP_441015.1_10 Reverse -278 -297 -3.63879 0.19
NP_441015.1_10 Forward -395 -376 -5.31042 0.221
NP_441015.1_10 Reverse -275 -294 -8.26035 0.272
NP_441673.1_1 Forward -71 -62 20.8459 0.000698
NP_441673.1_1 Reverse -62 -71 20.8459 0.000698
NP_441876.1_9 Reverse -379 -389 12.2709 0.267
NP_441826.1_2 Forward -77 -63 20.4524 0.00719
NP_441826.1_2 Forward -146 -132 4.81781 0.0988
NP_441826.1_5 Reverse -132 -151 8.75091 0.202
NP_442490.1_9 Reverse -98 -117 -6.88371 0.275
NP_441764.1_8 Forward -380 -370 12.5549 0.284
NP_442868.1_6 Reverse -60 -70 18.5646 0.0104
NP_442868.1_6 Forward -73 -63 9.91146 0.038
NP_442868.1_6 Forward -128 -118 5.48657 0.147
NP_442719.1_2 Reverse -244 -262 -3.81647 0.203
NP_442719.1_2 Forward -97 -79 -9.32298 0.263
NP_441251.1_8 Reverse -82 -95 12.9532 0.257
NP_441612.1_2 Reverse -62 -72 8.54929 0.21
NP_441911.1_10 Forward -390 -371 7.49852 0.274
NP_442808.1_1 Reverse -61 -71 8.73102 0.0481
NP_442808.1_1 Forward -72 -62 8.63269 0.0481
NP_441101.1_10 Reverse -58 -77 -6.68705 0.29
NP_440145.1_3 Reverse -52 -71 0.294447 0.137
NP_440145.1_3 Forward -254 -235 -6.29373 0.295
NP_440145.1_4 Forward -298 -288 13.7459 0.299
NP_442542.1_2 Reverse -60 -73 19.1938 0.0177
NP_442542.1_9 Reverse -124 -138 4.52221 0.294
NP_442050.1_1 Forward -255 -236 7.07928 0.277
NP_442050.1_5 Forward -73 -63 16.4991 0.00812
NP_442050.1_5 Reverse -60 -70 13.6475 0.0295
NP_442050.1_5 Reverse -129 -139 7.74772 0.243
NP_440558.1_2 Reverse -319 -338 -4.91709 0.249
NP_440558.1_2 Reverse -53 -72 -5.01543 0.251
NP_441518.1_3 Forward -81 -62 -14.7502 0.28
NP_441878.1_6 Reverse -61 -71 20.2362 0.0046
NP_441878.1_6 Forward -72 -62 10.4031 0.0176
NP_441878.1_6 Forward -160 -150 -7.29646 0.217
NP_441878.1_6 Forward -245 -235 -7.39479 0.222
NP_441878.1_6 Reverse -327 -337 -7.68978 0.255
NP_441036.1_8 Reverse -61 -71 8.4365 0.174
NP_441036.1_8 Forward -72 -62 8.33817 0.174
NP_441036.1_8 Reverse -116 -126 5.48657 0.279
NP_441557.1_5 Forward -71 -62 19.9609 0.000699
NP_441557.1_5 Reverse -62 -71 19.9609 0.000699
NP_441557.1_5 Reverse -131 -140 -1.47524 0.283
NP_441557.1_5 Forward -140 -131 -1.57357 0.291
NP_441445.1_1 Forward -80 -61 1.17943 0.259
NP_441308.1_8 Reverse -129 -139 8.33817 0.261
NP_440101.1_3 Reverse -57 -76 3.44104 0.231
NP_442183.1_1 Reverse -62 -76 10.816 0.0784
NP_442397.1_9 Reverse -62 -81 7.47261 0.246
NP_441549.1_9 Forward -75 -57 1.69077 0.101
NP_441549.1_9 Reverse -58 -76 -4.40575 0.198
NP_441549.1_9 Reverse -319 -337 -8.14232 0.221
NP_441549.1_9 Forward -144 -126 -9.0273 0.241
NP_442347.1_2 Reverse -63 -72 12.4878 0.056
NP_442347.1_2 Forward -70 -61 3.34298 0.284
NP_442645.1_2 Forward -79 -60 -6.98204 0.0983
NP_442645.1_2 Reverse -54 -73 -11.6036 0.144
NP_441037.1_4 Reverse -60 -70 9.55921 0.21
NP_441037.1_4 Forward -161 -151 8.58464 0.237
NP_442594.1_8 Forward -263 -244 1.86774 0.295
NP_441633.1_3 Forward -73 -60 3.46087 0.0699
NP_441633.1_3 Reverse -60 -73 -3.81562 0.177
NP_441633.1_3 Forward -121 -108 -6.66722 0.265
NP_440136.1_2 Forward -70 -63 15.9687 0.0123
NP_440136.1_2 Reverse -63 -70 15.9687 0.0123
NP_440136.1_2 Reverse -132 -139 6.52896 0.116
NP_440136.1_2 Forward -139 -132 6.13563 0.193
NP_442998.1_5 Reverse -78 -88 9.41981 0.241
NP_442998.1_10 Forward -69 -62 15.5754 0.0102
NP_442998.1_10 Reverse -64 -71 15.5754 0.0102
NP_440899.1_1 Reverse -120 -139 7.91948 0.247
NP_440299.1_1 Reverse -58 -71 10.9334 0.0529
NP_440299.1_1 Forward -75 -62 10.3434 0.0573
NP_440299.1_1 Forward -144 -131 8.18017 0.0964
NP_441799.1_1 Reverse -58 -72 17.3052 0.011
NP_441799.1_1 Forward -75 -61 4.71887 0.238
NP_441007.1_10 Reverse -57 -70 1.69091 0.203
NP_441007.1_10 Forward -76 -63 0.510939 0.226
NP_441007.1_10 Reverse -126 -139 -0.37404 0.277
NP_442334.1_2 Forward -254 -237 -4.28772 0.2
NP_442201.1_10 Reverse -51 -70 -10.522 0.26
NP_440256.1_1 Forward -74 -55 4.71934 0.042
NP_441362.1_4 Forward -195 -177 8.37728 0.26
NP_441559.1_8 Reverse -57 -71 0.88457 0.16
NP_441559.1_8 Reverse -175 -189 -3.24533 0.199
NP_440915.1_6 Forward -248 -234 11.7993 0.0243
NP_440915.1_6 Forward -75 -61 9.5377 0.0406
NP_440915.1_6 Reverse -58 -72 1.96621 0.128
NP_442785.1_7 Forward -73 -59 10.9143 0.228
NP_440749.1_1 Reverse -131 -150 3.44104 0.237
NP_441464.1_8 Forward -71 -57 10.3243 0.181
NP_441464.1_8 Reverse -297 -311 6.29277 0.241
NP_441464.1_8 Forward -337 -323 4.81781 0.263
NP_441939.1_3 Forward -70 -51 11.9958 0.104
NP_442993.1_1 Reverse -62 -78 -7.11963 0.146
NP_442386.1_9 Forward -72 -63 13.8639 0.0289
NP_442386.1_9 Forward -141 -132 11.1107 0.103
NP_442386.1_9 Reverse -61 -70 6.39082 0.219
NP_441340.1_5 Forward -70 -63 15.6737 0.0124
NP_441340.1_5 Reverse -63 -70 15.6737 0.0124
NP_441340.1_5 Forward -139 -132 13.5105 0.0314
NP_441340.1_5 Reverse -132 -139 6.23397 0.132
NP_441340.1_9 Forward -380 -370 17.7031 0.194
NP_442484.1_2 Forward -151 -132 -0.000545616 0.254
NP_440059.1_3 Reverse -318 -337 6.09517 0.266
NP_439976.1_5 Reverse -346 -360 15.6336 0.257
NP_442240.1_2 Forward -70 -51 -12.9802 0.163
NP_441160.1_9 Reverse -236 -255 9.43923 0.255
NP_440586.1_8 Forward -70 -63 13.2151 0.026
NP_440586.1_8 Reverse -63 -70 13.2151 0.026
NP_440586.1_8 Forward -139 -132 11.3468 0.0736
NP_440586.1_8 Reverse -132 -139 9.47853 0.146
NP_442251.1_6 Forward -70 -63 15.2804 0.0124
NP_442251.1_6 Reverse -63 -70 15.2804 0.0124
NP_440192.1_4 Forward -276 -257 8.62144 0.292
NP_442959.1_5 Forward -318 -299 14.4541 0.221
NP_440684.1_9 Forward -77 -63 16.5192 0.0691
NP_441262.1_3 Reverse -62 -69 14.7888 0.0223
NP_441262.1_3 Forward -71 -64 14.7888 0.0223
NP_441262.1_3 Reverse -131 -138 5.34899 0.181
NP_440027.1_3 Forward -299 -281 6.99988 0.218
NP_440027.1_8 Forward -74 -55 10.1267 0.243
NP_443051.1_1 Reverse -61 -70 18.0926 0.00402
NP_443051.1_1 Forward -72 -63 10.4228 0.00754
NP_443051.1_1 Reverse -130 -139 7.76787 0.0541
NP_439996.1_10 Forward -297 -278 14.1591 0.277
NP_439937.1_9 Forward -72 -55 -5.2717 0.157
NP_439937.1_9 Reverse -251 -268 -15.5964 0.287
NP_440408.1_7 Reverse -131 -150 6.78429 0.299
NP_440439.1_1 Reverse -59 -72 4.34585 0.104
NP_440439.1_1 Forward -74 -61 2.08423 0.138
NP_442239.1_8 Reverse -277 -296 5.60432 0.269
NP_439943.1_1 Reverse -151 -170 -6.78538 0.237
NP_440372.1_2 Forward -70 -63 16.3621 0.0124
NP_440372.1_2 Reverse -63 -70 16.3621 0.0124
NP_440372.1_2 Reverse -132 -139 6.62729 0.151
NP_440372.1_2 Forward -139 -132 6.52896 0.188
NP_440171.1_3 Reverse -107 -126 3.44104 0.284
NP_440819.1_5 Reverse -200 -208 7.68924 0.266
NP_440589.1_3 Reverse -102 -121 2.55606 0.279
NP_440139.1_1 Reverse -56 -75 22.713 0.0233
NP_441572.1_7 Forward -77 -58 8.94757 0.074
NP_441572.1_7 Reverse -56 -75 -3.63879 0.217
NP_440267.1_2 Forward -76 -62 8.45543 0.162
NP_442384.1_10 Forward -71 -58 22.0454 0.00194
NP_442384.1_10 Reverse -62 -75 9.06573 0.0574
NP_442262.1_10 Forward -70 -63 14.1988 0.0123
NP_442262.1_10 Reverse -63 -70 14.1988 0.0123
NP_442262.1_10 Reverse -132 -139 13.0188 0.0314
NP_442262.1_10 Forward -139 -132 11.6422 0.092
NP_442262.1_10 Reverse -158 -165 7.6106 0.274
NP_441689.1_5 Forward -73 -63 15.3192 0.0403
NP_440163.1_10 Forward -74 -64 11.3864 0.169
NP_440163.1_10 Reverse -360 -370 8.04317 0.292
NP_440344.1_10 Reverse -55 -72 -7.72931 0.119
NP_440531.1_6 Forward -79 -60 -0.4922 0.214
NP_442910.1_1 Forward -78 -59 2.94938 0.118
NP_440189.1_10 Forward -348 -329 2.3594 0.297
NP_440562.1_1 Forward -67 -48 13.6666 0.235
NP_440562.1_10 Forward -308 -290 12.1139 0.206
NP_441965.1_3 Forward -81 -62 14.6508 0.076
NP_441965.1_3 Reverse -52 -71 9.43923 0.11
NP_441640.1_8 Forward -145 -126 2.16274 0.159
NP_440297.1_9 Forward -139 -129 9.81313 0.0917
NP_440297.1_9 Forward -70 -60 9.61647 0.0917
NP_440297.1_9 Reverse -63 -73 9.32148 0.0917
NP_440297.1_9 Reverse -132 -142 -0.216628 0.282
NP_442280.1_10 Forward -121 -103 6.62323 0.27
NP_441592.1_4 Forward -71 -52 -0.197208 0.24
NP_441103.1_9 Reverse -379 -389 14.2474 0.23
NP_442129.1_6 Forward -185 -166 13.5586 0.269
NP_440999.1_9 Forward -293 -279 1.57289 0.162
NP_440999.1_9 Reverse -58 -72 -0.295402 0.203
NP_440888.1_2 Reverse -62 -76 17.3052 0.00418
NP_440888.1_2 Forward -71 -57 8.45543 0.16
NP_440888.1_2 Reverse -2 -16 7.76712 0.184
NP_442147.1_4 Forward -79 -60 17.404 0.222
NP_440491.1_1 Reverse -134 -153 11.4975 0.17
NP_442033.1_10 Reverse -233 -252 -14.1602 0.297
NP_442033.1_10 Reverse -242 -261 -14.5535 0.299
NP_441543.1_2 Reverse -63 -72 16.9127 0.00359
NP_441543.1_2 Forward -70 -61 9.34117 0.0818
NP_441543.1_2 Forward -139 -130 4.12963 0.279
NP_442845.1_2 Forward -77 -63 14.9459 0.0763
NP_442845.1_2 Forward -146 -132 4.42448 0.259
NP_441551.1_5 Reverse -58 -74 7.43266 0.247
NP_441551.1_5 Forward -75 -59 6.2527 0.275
NP_441918.1_10 Reverse -275 -293 16.9321 0.119
NP_442710.1_6 Forward -374 -355 6.78429 0.204
NP_441469.1_4 Forward -193 -174 6.29264 0.296
NP_441469.1_8 Reverse -61 -70 13.3727 0.073
NP_441469.1_8 Forward -72 -63 6.48957 0.227
NP_441469.1_8 Reverse -130 -139 5.80125 0.253
NP_441469.1_8 Forward -141 -132 5.60459 0.258
NP_443064.1_6 Forward -71 -61 13.8273 0.0796
NP_443064.1_6 Reverse -62 -72 12.5669 0.0796
NP_443064.1_6 Reverse -179 -189 9.94905 0.187
NP_442578.1_7 Forward -70 -63 14.5921 0.026
NP_442578.1_7 Reverse -63 -70 14.5921 0.026
NP_440710.1_1 Forward -79 -61 -1.25915 0.179
NP_440071.1_6 Forward -256 -242 13.417 0.278
NP_440220.1_4 Reverse -362 -381 -2.75457 0.282
NP_441462.1_2 Forward -71 -61 20.1379 0.000967
NP_441462.1_2 Reverse -62 -72 11.5831 0.00406
NP_441462.1_2 Forward -11 -1 -1.19994 0.291
NP_441621.1_7 Forward -142 -128 -4.13031 0.208
NP_443062.1_1 Reverse -62 -80 18.1991 0.0227
NP_443062.1_6 Forward -208 -189 11.8975 0.1
NP_443062.1_6 Forward -79 -60 11.7008 0.1
NP_441601.1_4 Forward -291 -272 -1.67217 0.293
NP_442204.1_1 Reverse -127 -138 0.648657 0.281
NP_442204.1_1 Reverse -58 -69 0.157002 0.283
NP_441351.1_1 Forward -279 -260 8.65258 0.259
NP_440516.1_8 Forward -71 -62 16.9127 0.00442
NP_440516.1_8 Reverse -62 -71 16.9127 0.00442
NP_442428.1_5 Forward -70 -63 15.8704 0.0124
NP_442428.1_5 Reverse -63 -70 15.8704 0.0124
NP_442428.1_5 Reverse -132 -139 14.1988 0.0242
NP_442428.1_5 Forward -139 -132 6.0373 0.212
NP_442859.1_2 Forward -70 -51 8.45592 0.199
NP_441835.1_3 Reverse -48 -62 16.8142 0.24
NP_441867.1_2 Reverse -128 -147 -20.65 0.292
NP_440673.1_2 Reverse -318 -337 13.6088 0.109
NP_440673.1_3 Forward -69 -62 12.4288 0.0426
NP_440673.1_3 Reverse -64 -71 12.4288 0.0426
NP_440673.1_3 Forward -144 -137 7.02061 0.274
NP_440673.1_3 Reverse -330 -337 6.23397 0.283
NP_440865.1_9 Forward -77 -58 -8.16202 0.261
NP_441052.1_2 Reverse -62 -72 19.9412 0.00106
NP_441052.1_2 Forward -71 -61 10.4031 0.0285
NP_441052.1_2 Forward -159 -149 2.24165 0.213
NP_442219.1_9 Reverse -63 -72 17.7976 0.00718
NP_442219.1_9 Forward -70 -61 8.25953 0.0681
NP_440436.1_4 Reverse -63 -72 17.2072 0.00233
NP_440436.1_4 Forward -70 -61 15.9289 0.00508
NP_441884.1_9 Forward -292 -273 -20.4534 0.189
NP_442086.1_3 Forward -70 -51 14.1591 0.113
NP_442907.1_9 Forward -337 -318 -1.7705 0.24
NP_441719.1_4 Forward -70 -63 16.3621 0.0124
NP_441719.1_4 Reverse -63 -70 16.3621 0.0124
NP_441719.1_4 Reverse -132 -139 6.62729 0.151
NP_441719.1_4 Forward -139 -132 6.52896 0.188
NP_441719.1_6 Reverse -232 -251 4.81688 0.296
NP_441733.1_10 Forward -74 -61 8.18076 0.14
NP_441004.1_5 Forward -266 -252 9.5377 0.252
NP_442813.1_4 Forward -208 -189 -6.58872 0.299
NP_442366.1_3 Reverse -61 -79 3.16574 0.115
NP_442366.1_3 Reverse -321 -339 -4.11075 0.264
NP_443029.1_8 Reverse -274 -293 11.6025 0.293
NP_440296.1_10 Forward -247 -228 -8.26035 0.248
NP_441115.1_4 Reverse -130 -148 15.7513 0.0354
NP_442694.1_4 Forward -345 -336 12.0944 0.268
NP_442854.1_6 Reverse -62 -81 2.65439 0.272
NP_442312.1_3 Reverse -368 -387 18.0915 0.266
NP_443054.1_2 Reverse -233 -247 4.71948 0.24
NP_443054.1_2 Reverse -60 -74 2.94952 0.24
NP_443054.1_2 Forward -73 -59 0.786239 0.254
NP_441851.1_9 Reverse -325 -344 7.17762 0.282
NP_441851.1_10 Reverse -61 -71 17.4829 0.0027
NP_441851.1_10 Forward -72 -62 15.8113 0.00552
NP_441851.1_10 Reverse -130 -140 5.28991 0.218
NP_441851.1_10 Forward -141 -131 4.20827 0.282
NP_442622.1_5 Forward -153 -134 1.0811 0.171
NP_442622.1_8 Reverse -62 -80 -18.9587 0.293
NP_441542.1_4 Forward -349 -335 3.44117 0.282
NP_442515.1_1 Forward -72 -58 11.8976 0.0376
NP_442515.1_1 Reverse -61 -75 1.57289 0.155
NP_442515.1_1 Reverse -296 -310 0.88457 0.178
NP_440593.1_3 Forward -151 -132 -3.83545 0.242
NP_442709.1_3 Forward -78 -59 5.11266 0.215
NP_441046.1_2 Forward -377 -358 6.68596 0.221
NP_441046.1_2 Forward -275 -256 -0.688862 0.284
NP_440940.1_7 Reverse -110 -128 6.60656 0.224
NP_440940.1_7 Forward -81 -63 6.21323 0.225
NP_441349.1_10 Forward -81 -62 20.4523 0.00739
NP_441349.1_10 Reverse -52 -71 1.57275 0.0827
NP_441409.1_6 Reverse -56 -75 -9.24366 0.18
NP_441409.1_6 Forward -146 -127 -10.3253 0.203
NP_440432.1_9 Forward -70 -55 -4.54333 0.211
NP_440474.1_8 Reverse -63 -77 8.16044 0.189
NP_441477.1_10 Forward -78 -60 5.62401 0.192
NP_442450.1_5 Reverse -60 -70 10.0098 0.115
NP_442450.1_5 Forward -73 -63 9.32148 0.115
NP_440588.1_2 Reverse -53 -72 8.75091 0.0448
NP_440588.1_2 Forward -80 -61 0.0977854 0.149
NP_440954.1_4 Forward -200 -181 5.99764 0.203
NP_442006.1_2 Forward -252 -235 -17.0707 0.269
NP_443047.1_7 Reverse -63 -82 7.47261 0.22
NP_441570.1_1 Reverse -62 -80 11.6222 0.00743
NP_441078.1_4 Forward -71 -62 19.6659 0.0007
NP_441078.1_4 Reverse -62 -71 19.6659 0.0007
NP_441078.1_4 Forward -159 -150 3.83464 0.13
NP_441663.1_8 Forward -251 -232 6.09597 0.127
NP_442348.1_2 Forward -201 -192 9.14451 0.28
NP_440793.1_1 Reverse -372 -386 12.5853 0.279
NP_440526.1_3 Reverse -63 -74 10.1862 0.0646
NP_440526.1_3 Forward -70 -59 1.6315 0.267
NP_440526.1_3 Reverse -236 -247 0.844851 0.267
NP_441432.1_8 Forward -72 -63 16.8143 0.00595
NP_441432.1_8 Reverse -61 -70 8.35786 0.0755
NP_441432.1_8 Reverse -136 -145 5.50626 0.151
NP_441432.1_8 Forward -338 -329 5.50626 0.151
NP_441432.1_8 Reverse -130 -139 4.22796 0.235
NP_442320.1_8 Forward -77 -63 3.24451 0.064
NP_442320.1_8 Forward -146 -132 -4.13031 0.148
NP_442344.1_10 Forward -74 -55 19.3707 0.23
NP_441732.1_2 Reverse -127 -143 -7.0213 0.0614
NP_441732.1_2 Forward -75 -59 -16.2644 0.165
NP_441732.1_2 Reverse -58 -74 -16.3627 0.165
NP_440629.1_4 Reverse -250 -269 8.06259 0.279
NP_442003.1_9 Forward -345 -326 3.53937 0.279
NP_440760.1_1 Forward -71 -52 -2.16383 0.0332
NP_440760.1_1 Reverse -62 -81 -21.3384 0.234
NP_442797.1_7 Reverse -55 -73 0.510803 0.274
NP_440199.1_10 Forward -74 -64 16.7946 0.0381
NP_441057.1_4 Reverse -319 -337 15.9488 0.0988
NP_442727.1_1 Forward -201 -187 15.8309 0.197
NP_441072.1_2 Forward -82 -63 6.39097 0.28
NP_442400.1_1 Reverse -59 -78 -4.6221 0.266
NP_440713.1_4 Forward -396 -377 11.1109 0.119
NP_440713.1_4 Reverse -280 -299 1.67108 0.282
NP_442489.1_7 Forward -71 -62 20.1576 0.000695
NP_442489.1_7 Reverse -62 -71 20.1576 0.000695
NP_442489.1_7 Reverse -131 -140 -1.6719 0.235
NP_440565.1_7 Forward -269 -250 6.58763 0.246
NP_440559.1_1 Reverse -63 -72 17.4043 0.00658
NP_440559.1_1 Forward -70 -61 17.306 0.00658
NP_440559.1_1 Reverse -132 -141 6.78456 0.128
NP_441659.2_8 Forward -71 -61 19.3512 0.000966
NP_441659.2_8 Reverse -62 -72 18.1713 0.00133
NP_441659.2_8 Forward -140 -130 5.97822 0.0909
NP_442913.1_10 Reverse -53 -72 -2.95047 0.195
NP_442913.1_10 Forward -253 -234 -5.70374 0.276
NP_439956.1_7 Forward -250 -231 3.44104 0.257
NP_442346.1_5 Reverse -61 -71 17.9746 0.00128
NP_442346.1_5 Forward -72 -62 16.6963 0.00248
NP_442346.1_5 Forward -338 -328 8.04317 0.149
NP_442346.1_5 Forward -141 -131 4.79825 0.272
NP_442346.1_5 Reverse -130 -140 4.79825 0.272
NP_440545.1_3 Forward -144 -127 8.69197 0.0431
NP_440545.1_3 Forward -75 -58 5.34871 0.0623
NP_440545.1_3 Reverse -127 -144 3.0871 0.089
NP_440545.1_3 Reverse -58 -75 -1.82945 0.175
NP_440025.1_3 Forward -309 -295 15.7419 0.181
NP_440555.1_4 Forward -254 -235 8.84924 0.214
NP_440459.1_5 Forward -261 -243 15.7521 0.278
NP_440010.1_10 Reverse -278 -297 9.63589 0.209
NP_442603.1_7 Forward -299 -285 11.9953 0.107
NP_441888.1_7 Reverse -186 -200 2.2612 0.225
NP_441833.1_4 Forward -70 -63 15.9687 0.0124
NP_441833.1_4 Reverse -63 -70 15.9687 0.0124
NP_441833.1_4 Reverse -132 -139 6.23397 0.163
NP_441833.1_4 Forward -139 -132 6.13563 0.198
NP_442162.1_9 Forward -70 -63 16.2637 0.0124
NP_442162.1_9 Reverse -63 -70 16.2637 0.0124
NP_442162.1_9 Reverse -132 -139 6.62729 0.142
NP_442162.1_9 Forward -139 -132 6.43063 0.208
NP_442796.1_2 Reverse -187 -206 14.496 0.258
NP_442055.1_6 Forward -276 -257 15.8307 0.221
NP_440671.1_4 Forward -77 -63 16.9125 0.0246
NP_442943.1_1 Reverse -83 -98 6.16814 0.206
NP_440772.1_8 Forward -77 -58 14.3558 0.253
NP_442199.1_5 Reverse -123 -142 -5.70374 0.253
NP_442140.1_3 Reverse -132 -142 13.5497 0.0542
NP_442140.1_3 Forward -70 -60 11.5831 0.0743
NP_442140.1_3 Reverse -63 -73 4.40493 0.243
NP_440875.1_2 Reverse -63 -82 6.4893 0.25
NP_441813.1_5 Reverse -60 -70 18.3679 0.00743
NP_441813.1_5 Forward -73 -63 15.9097 0.01
NP_441813.1_5 Reverse -129 -139 5.38824 0.13
NP_441813.1_7 Forward -332 -318 9.83206 0.235
NP_440594.1_8 Forward -70 -57 11.3267 0.153
NP_441227.1_6 Reverse -108 -127 13.5691 0.293
NP_441227.1_7 Forward -70 -51 11.3045 0.283
NP_440590.1_4 Forward -70 -57 3.16588 0.0756
NP_440590.1_4 Reverse -132 -145 1.88757 0.108
NP_440590.1_4 Reverse -63 -76 -4.50394 0.262
NP_440590.1_4 Reverse -281 -294 -5.19226 0.277
NP_440567.1_1 Forward -70 -56 14.0609 0.0191
NP_440567.1_1 Reverse -63 -77 13.0776 0.0213
NP_440567.1_1 Reverse -132 -146 2.06454 0.184
NP_442497.1_10 Forward -70 -61 19.8626 0.00532
NP_442497.1_10 Reverse -63 -72 10.4228 0.0087
NP_442497.1_10 Forward -139 -130 5.89959 0.109
NP_442497.1_10 Reverse -132 -141 -1.18024 0.256
NP_440821.1_4 Forward -73 -63 18.2696 0.00448
NP_440821.1_4 Reverse -60 -70 10.9931 0.0146
NP_440821.1_4 Forward -142 -132 7.55152 0.0698
NP_440821.1_4 Reverse -129 -139 0.766681 0.151
NP_441239.1_9 Reverse -60 -72 12.6253 0.0446
NP_441239.1_9 Forward -73 -61 7.90546 0.147
NP_441239.1_9 Reverse -129 -141 7.51213 0.158
NP_441239.1_9 Forward -142 -130 3.57889 0.283
NP_441951.1_4 Reverse -274 -293 5.60432 0.273
NP_440156.1_4 Forward -89 -79 18.0724 0.176
NP_442691.1_7 Forward -300 -281 7.96345 0.286
NP_441727.1_3 Forward -147 -128 5.50599 0.252
NP_440604.1_6 Reverse -62 -81 -1.96717 0.211
NP_440546.1_4 Forward -71 -61 12.8578 0.0572
NP_440546.1_4 Reverse -62 -72 10.046 0.109
NP_440546.1_4 Reverse -102 -112 7.23423 0.252
NP_441230.1_5 Forward -116 -97 1.76941 0.234
NP_440462.1_4 Forward -246 -232 11.3077 0.21
NP_440462.1_6 Reverse -60 -70 9.7148 0.0429
NP_440462.1_6 Forward -73 -63 7.74818 0.0699
NP_440868.1_4 Reverse -58 -70 10.9537 0.0363
NP_440868.1_4 Forward -75 -63 6.23383 0.0878
NP_440374.1_4 Forward -101 -82 16.4719 0.246
NP_440653.1_10 Reverse -132 -151 3.04771 0.285
NP_440696.1_3 Forward -71 -53 0.609134 0.229
NP_440696.1_3 Reverse -58 -76 -3.22577 0.284
NP_442039.1_4 Forward -70 -63 15.1821 0.0124
NP_442039.1_4 Reverse -63 -70 15.1821 0.0124
NP_442039.1_4 Reverse -132 -139 6.3323 0.289
NP_442039.1_7 Reverse -133 -143 14.4347 0.211
NP_442039.1_7 Forward -268 -258 7.15819 0.279
NP_441926.1_3 Reverse -62 -78 15.6932 0.0428
NP_440825.1_6 Forward -354 -335 17.8957 0.182
NP_442837.1_3 Forward -70 -63 15.7721 0.0124
NP_442837.1_3 Reverse -63 -70 15.7721 0.0124
NP_442837.1_3 Reverse -132 -139 6.0373 0.25
NP_442837.1_3 Forward -139 -132 5.93897 0.265
NP_440160.1_1 Forward -387 -368 10.1506 0.244
NP_442053.1_1 Forward -71 -62 18.3876 0.0007
NP_442053.1_1 Reverse -62 -71 18.3876 0.0007
NP_440505.1_3 Forward -73 -63 16.303 0.00696
NP_440505.1_3 Reverse -60 -70 9.61647 0.122
NP_440207.2_7 Forward -200 -181 21.8289 0.0573
NP_441203.1_1 Forward -139 -120 -12.4886 0.143
NP_442532.1_7 Reverse -131 -145 3.53951 0.195
NP_440914.1_1 Reverse -62 -72 17.5935 0.000537
NP_440914.1_1 Forward -71 -61 8.51751 0.186
NP_440914.1_1 Forward -77 -67 7.44401 0.237
NP_441011.1_8 Forward -70 -61 14.356 0.0249
NP_441011.1_8 Reverse -63 -72 8.25953 0.144
NP_442101.1_10 Reverse -123 -142 -8.26035 0.232
NP_440037.1_6 Reverse -290 -309 18.584 0.248
NP_442533.1_6 Forward -71 -62 17.2076 0.00137
NP_442533.1_6 Reverse -62 -71 17.2076 0.00137
NP_442533.1_6 Forward -126 -117 5.40793 0.14
NP_442533.1_6 Reverse -235 -244 4.62128 0.179
NP_442533.1_6 Forward -299 -290 2.26134 0.266
NP_442533.1_6 Forward -111 -102 2.16301 0.27
NP_442541.1_10 Reverse -234 -248 7.57046 0.228
NP_442541.1_10 Forward -71 -57 2.75226 0.254
NP_442232.1_3 Reverse -54 -73 -12.6852 0.282
NP_443016.1_1 Forward -77 -58 -5.80207 0.251
NP_441482.1_7 Reverse -56 -70 -0.885388 0.0612
NP_441482.1_7 Reverse -229 -243 -8.94853 0.193
NP_441482.1_7 Forward -77 -63 -10.8168 0.216
NP_439944.1_9 Reverse -63 -73 19.0562 0.00329
NP_439944.1_9 Reverse -132 -142 14.4347 0.0396
NP_439944.1_9 Forward -70 -60 8.82982 0.101
NP_439944.1_9 Forward -139 -129 5.78156 0.221
NP_441028.1_6 Reverse -372 -382 4.20782 0.278
NP_441028.1_6 Reverse -239 -249 3.8145 0.281
NP_441028.1_6 Reverse -378 -388 3.42118 0.296
NP_442202.1_6 Reverse -255 -274 -1.67217 0.277
NP_440116.1_8 Reverse -132 -151 -10.0303 0.297
NP_441527.1_4 Forward -389 -370 -6.15965 0.215
NP_441527.1_4 Forward -391 -372 -12.0802 0.285
NP_440115.1_6 Reverse -59 -69 15.3197 0.0488
NP_440007.1_9 Reverse -127 -141 3.24451 0.272
NP_441680.1_4 Forward -288 -269 2.45773 0.242
NP_441347.1_5 Forward -83 -69 12.9786 0.238
NP_441972.1_3 Forward -255 -236 17.3057 0.146
NP_441972.1_5 Reverse -132 -151 -4.6221 0.211
NP_441106.1_1 Reverse -61 -70 9.73449 0.0311
NP_441106.1_1 Forward -72 -63 9.63616 0.0311
NP_441106.1_1 Reverse -130 -139 6.19458 0.0971
NP_441815.1_6 Reverse -376 -395 5.2102 0.187
NP_441439.1_9 Reverse -318 -337 20.2556 0.208
NP_440797.1_2 Forward -82 -63 18.8034 0.0629
NP_441286.1_1 Forward -72 -60 15.4769 0.00418
NP_441286.1_1 Reverse -61 -73 11.937 0.0108
NP_441286.1_1 Forward -141 -129 -5.86088 0.229
NP_440670.1_8 Forward -71 -62 18.3876 0.000699
NP_440670.1_8 Reverse -62 -71 18.3876 0.000699
NP_440670.1_8 Forward -11 -2 5.11294 0.171
NP_440670.1_8 Reverse -131 -140 3.53964 0.257
NP_440670.1_8 Forward -140 -131 3.24465 0.29
NP_441930.1_2 Reverse -143 -153 12.5664 0.258
NP_440886.1_7 Reverse -61 -71 8.04271 0.0805
NP_440886.1_7 Forward -72 -62 7.94438 0.0805
NP_440886.1_7 Reverse -383 -393 3.51951 0.279
NP_442614.1_2 Forward -71 -57 14.4542 0.0984
NP_442614.1_2 Forward -245 -231 9.2427 0.242
NP_442072.1_1 Forward -217 -199 4.05072 0.289
NP_442072.1_9 Reverse -61 -79 -1.94747 0.0316
NP_442401.1_2 Forward -120 -101 9.7334 0.201
NP_442401.1_2 Forward -338 -319 7.37347 0.266
NP_440223.1_6 Reverse -269 -286 3.0871 0.278
NP_440907.2_8 Forward -70 -60 9.91099 0.103
NP_442264.1_2 Reverse -58 -75 5.74204 0.272
NP_442264.1_2 Forward -254 -237 4.85706 0.292
NP_441021.1_1 Forward -70 -51 1.0811 0.0848
NP_441021.1_4 Forward -292 -273 10.2259 0.269
NP_441021.1_8 Reverse -57 -75 2.87075 0.238
NP_440841.1_4 Forward -73 -54 -5.70374 0.208
NP_441463.1_3 Forward -81 -62 -4.03212 0.191
NP_441463.1_6 Forward -73 -59 6.99573 0.265
NP_441626.1_2 Forward -70 -63 15.7721 0.0124
NP_441626.1_2 Reverse -63 -70 15.7721 0.0124
NP_441626.1_2 Reverse -132 -139 6.52896 0.137
NP_441626.1_2 Forward -139 -132 5.93897 0.231
NP_442365.1_7 Reverse -58 -77 1.47442 0.17
NP_442615.1_1 Reverse -53 -71 -1.06249 0.124
NP_442615.1_1 Reverse -288 -306 -7.35568 0.287
NP_441962.1_4 Reverse -57 -76 -4.6221 0.158
NP_441962.1_4 Reverse -132 -151 -13.1769 0.271
NP_440387.1_1 Reverse -62 -78 15.4965 0.00544
NP_440387.1_1 Forward -71 -55 -0.826444 0.142
NP_441431.1_2 Reverse -59 -73 8.06211 0.226
NP_441431.1_2 Forward -292 -278 7.27547 0.244
NP_441488.1_3 Reverse -278 -296 17.309 0.272
NP_441488.1_7 Reverse -104 -123 10.7175 0.113
NP_441488.1_8 Forward -145 -131 8.3571 0.195
NP_441836.1_2 Reverse -111 -130 -4.42544 0.255
NP_442224.1_1 Forward -291 -272 -0.787193 0.233
NP_440814.1_4 Forward -80 -61 -12.7836 0.244
NP_440114.1_10 Forward -71 -57 16.7159 0.0153
NP_440114.1_10 Reverse -62 -76 8.84938 0.192
NP_440114.1_10 Reverse -143 -157 6.58777 0.263
NP_442323.1_7 Forward -145 -126 1.37531 0.281
NP_440287.1_5 Reverse -246 -265 7.07848 0.286
NP_440287.1_5 Reverse -237 -256 6.09517 0.298
NP_441552.1_3 Forward -147 -128 15.9282 0.177
NP_440293.1_9 Forward -30 -16 10.2813 0.276
NP_440766.1_4 Forward -75 -61 5.50613 0.11
NP_440766.1_4 Reverse -276 -290 3.24451 0.151
NP_442743.1_4 Forward -70 -51 -1.96717 0.206
NP_439910.1_2 Forward -79 -62 -21.4956 0.183
NP_440457.1_1 Reverse -58 -70 20.5902 0.0344
NP_440457.1_1 Forward -75 -63 9.57708 0.092
NP_440457.1_1 Forward -248 -236 2.59558 0.207
NP_440798.1_6 Forward -70 -57 4.54251 0.145
NP_440798.1_6 Forward -139 -126 0.60927 0.254
NP_442680.1_5 Reverse -293 -312 1.73297 0.237
NP_441332.1_6 Reverse -235 -245 11.3563 0.261
NP_441889.1_4 Forward -80 -61 8.75091 0.103
NP_441436.1_8 Forward -245 -226 14.4541 0.215
NP_442509.1_9 Forward -71 -61 17.3841 0.00128
NP_442509.1_9 Reverse -62 -72 8.14104 0.192
NP_440554.1_4 Forward -139 -129 14.4347 0.0218
NP_440554.1_4 Forward -70 -60 8.82982 0.0646
NP_440554.1_4 Reverse -63 -73 7.05986 0.106
NP_441885.1_5 Reverse -62 -72 20.9245 0.000538
NP_441885.1_5 Forward -71 -61 11.3864 0.00668
NP_441885.1_5 Forward -159 -149 -1.78992 0.284
NP_440478.1_9 Reverse -105 -124 12.1925 0.255
NP_442341.1_7 Forward -300 -286 15.3392 0.0229
NP_442341.1_7 Reverse -61 -75 6.09611 0.135
NP_442341.1_9 Forward -113 -99 13.9619 0.0738
NP_442341.1_9 Reverse -60 -74 10.6187 0.133
NP_441756.1_5 Reverse -103 -122 -4.42544 0.294
NP_441173.1_9 Reverse -258 -266 10.2454 0.261
NP_440423.1_6 Forward -79 -60 -14.1602 0.224
NP_440423.1_6 Reverse -102 -121 -20.2567 0.252
NP_443000.1_7 Forward -73 -63 17.0896 0.00865
NP_443000.1_7 Reverse -60 -70 11.6814 0.0344
NP_442513.1_5 Forward -264 -245 9.14342 0.266
NP_441842.1_1 Forward -69 -56 16.2433 0.0484
NP_441842.1_1 Reverse -133 -146 14.1783 0.116
NP_440275.1_3 Reverse -60 -70 16.9913 0.0133
NP_440275.1_3 Forward -73 -63 8.1415 0.0602
NP_440275.1_3 Forward -142 -132 7.94484 0.0641
NP_440091.1_1 Forward -75 -63 18.3285 0.0114
NP_440091.1_1 Reverse -58 -70 0.825626 0.227
NP_443010.1_10 Reverse -59 -76 8.85872 0.156
NP_443010.1_10 Forward -74 -57 3.25396 0.258
NP_439962.1_4 Reverse -272 -291 -6.09707 0.28
NP_442495.1_4 Forward -197 -187 13.4514 0.187
NP_441105.1_3 Forward -151 -132 1.47442 0.114
NP_441105.1_3 Forward -82 -63 -5.80207 0.224
NP_441105.1_3 Reverse -51 -70 -7.27704 0.25
NP_441105.1_3 Forward -76 -57 -8.16202 0.267
NP_442373.1_2 Forward -270 -251 -3.93378 0.205
NP_440216.1_1 Forward -71 -57 17.6992 0.00155
NP_440216.1_1 Reverse -62 -76 -0.590395 0.0284
NP_440216.1_1 Reverse -2 -16 -6.98191 0.145
NP_440172.1_1 Forward -71 -61 16.303 0.00854
NP_440172.1_1 Reverse -62 -72 15.0247 0.00945
NP_440172.1_1 Reverse -2 -12 3.02829 0.251
NP_442015.1_10 Reverse -58 -71 12.704 0.0365
NP_442015.1_10 Forward -75 -62 0.60927 0.221
NP_441226.1_7 Forward -70 -63 14.4934 0.0123
NP_441226.1_7 Reverse -63 -70 14.4934 0.0123
NP_441226.1_7 Forward -139 -132 14.1984 0.024
NP_441111.1_7 Forward -70 -62 18.7023 0.00294
NP_441111.1_7 Reverse -63 -71 18.7023 0.00294
NP_442379.1_10 Forward -78 -61 25.3099 0.00393
NP_440244.1_1 Forward -393 -374 0.491109 0.187
NP_441766.1_2 Forward -71 -62 17.5026 0.00297
NP_441766.1_2 Reverse -62 -71 17.5026 0.00297
NP_440416.1_9 Forward -78 -59 -6.49039 0.0901
NP_443052.1_8 Reverse -52 -71 -12.2919 0.252
NP_442403.1_8 Forward -35 -16 -1.67217 0.258
NP_442403.1_10 Forward -338 -319 9.73422 0.266
NP_440261.1_5 Forward -70 -57 5.42749 0.0421
NP_440261.1_5 Reverse -132 -145 -4.50394 0.151
NP_440988.1_10 Forward -73 -59 7.31914 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAATTGCCGTGGAAGGGGATAAGGAAAAATTAATGGCTGTTAAACAGGAAATATTGGCATTTTGGCAACGGCACACCCAGCAGTTAAATTATTGGCTTATTGCCCATCAGCACCGACCTCTACGGCGGGAATCTTTGGCGGAATTGTGGGAACAGGGGGAATGGGCTGAGTTAGACTCCACCCAACAGGAGCTTTTTCTCGGTATTTGCTGGGGTAATCCAGTGGAGTATCAATATCAATGGGCTAAGCCCAATTCCGGTTGCCATCGCATTGTGGCCACCCCTGATCAGCCCAGCGGCATTAAGTTTTAAACGATTTAGCCAGAGAATGGCGATCGCCCGCCCATAATCCTCTGATATAGTGTTAGATCGGACTTTATCTGATCATAAGGAGATCTGCC

CDS

ATGGCCCGTCGCTGTCAACTGACCGGGAAAAAAGCTAATAACGGTTTTGCCGTATCTCACTCCCACCGTCGCACCAAGAAATTACAACAGGCAAATTTGCAATGGAAACGGGTTTGGTGGCCCGAAGGCAATCGCTTTGTCCGTCTGCGTCTTTCCACCACTGCCATTAAAACTTTGGAATCCAAAGGCATCAACGCCATGGCCAAGGAAGCGGGCATCAACTTGAATAAATTCTAG

Protein

MARRCQLTGKKANNGFAVSHSHRRTKKLQQANLQWKRVWWPEGNRFVRLRLSTTAIKTLESKGINAMAKEAGINLNKF