Your browser is old and dusty. Try Google Chrome!

Details for ssr1600

ORF ssr1600
Accession NP_441740.2
Symbol
Category RNA synthesis, modification, and DNA transcription
Definition similar to anti-sigma f factor antagonist
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -222 -236 0.392915 0.211
NP_441061.1_2 Reverse -85 -99 -0.885388 0.242
NP_440557.1_1 Forward -235 -216 -1.18052 0.27
NP_440557.1_1 Reverse -85 -104 -2.26216 0.286
NP_440795.1_7 Forward -92 -85 14.6904 0.0123
NP_440795.1_7 Reverse -85 -92 14.6904 0.0123
NP_441418.1_6 Reverse -84 -103 -19.7651 0.0955
NP_441418.1_6 Forward -93 -74 -21.83 0.16
NP_442291.1_5 Forward -94 -78 -2.39974 0.215
NP_441453.1_4 Reverse -84 -92 16.539 0.00633
NP_441453.1_4 Forward -93 -85 16.539 0.00633
NP_442151.1_1 Forward -166 -147 3.53937 0.287
NP_442151.1_6 Reverse -84 -98 16.7159 0.0139
NP_442151.1_6 Forward -93 -79 6.29277 0.24
NP_441818.1_1 Forward -92 -81 8.51463 0.288
NP_440226.1_1 Reverse -84 -103 6.58763 0.125
NP_441630.1_3 Reverse -76 -95 13.2741 0.0597
NP_441630.1_3 Reverse -107 -126 11.8975 0.0736
NP_442744.1_10 Reverse -344 -363 15.9291 0.27
NP_442655.1_1 Reverse -79 -98 -0.4922 0.252
NP_442173.1_1 Forward -92 -84 15.4574 0.00633
NP_442173.1_1 Reverse -85 -93 15.4574 0.00633
NP_442752.1_4 Forward -93 -86 13.8055 0.0199
NP_442752.1_4 Reverse -84 -91 13.8055 0.0199
NP_443027.1_4 Forward -95 -85 15.3197 0.0437
NP_441812.1_3 Reverse -83 -97 7.9644 0.254
NP_442975.1_10 Reverse -80 -94 11.012 0.0516
NP_442975.1_10 Forward -97 -83 3.24392 0.26
NP_441225.1_1 Forward -152 -133 -5.50708 0.232
NP_440784.1_7 Forward -92 -85 15.9687 0.0123
NP_440784.1_7 Reverse -85 -92 15.9687 0.0123
NP_442000.2_10 Forward -391 -373 8.18062 0.286
NP_441476.1_5 Reverse -91 -110 -0.688862 0.2
NP_442062.1_3 Reverse -39 -58 -1.86883 0.264
NP_442062.1_8 Forward -93 -83 17.6796 0.00193
NP_442062.1_8 Reverse -84 -94 10.3048 0.0493
NP_441900.1_2 Reverse -377 -395 -0.76823 0.27
NP_441859.1_3 Forward -94 -75 7.17681 0.164
NP_440304.1_4 Forward -95 -85 18.9579 0.00406
NP_440304.1_4 Reverse -82 -92 9.91146 0.051
NP_442242.1_4 Forward -92 -85 14.3954 0.0124
NP_442242.1_4 Reverse -85 -92 14.3954 0.0124
NP_440044.1_8 Reverse -85 -104 11.7992 0.048
NP_440908.1_5 Forward -122 -105 7.70866 0.287
NP_441660.1_10 Reverse -23 -42 18.584 0.215
NP_441161.1_3 Reverse -78 -96 13.4905 0.153
NP_441200.1_4 Forward -241 -222 5.70265 0.294
NP_441619.1_8 Reverse -78 -92 7.17714 0.289
NP_441208.1_9 Reverse -81 -95 16.1259 0.0671
NP_442110.1_7 Reverse -84 -98 9.5377 0.0724
NP_441925.1_4 Reverse -234 -253 -6.19614 0.185
NP_440856.1_4 Forward -100 -81 0.392778 0.167
NP_441083.1_5 Forward -93 -83 19.3512 0.000718
NP_441083.1_5 Reverse -84 -94 11.2881 0.0159
NP_442827.1_8 Reverse -107 -126 -1.18128 0.245
NP_442827.1_8 Reverse -76 -95 -1.37794 0.245
NP_441434.1_7 Forward -91 -77 4.32615 0.225
NP_441738.1_2 Forward -91 -84 15.28 0.0102
NP_441738.1_2 Reverse -86 -93 15.28 0.0102
NP_440209.1_1 Reverse -84 -92 18.1123 0.00295
NP_440209.1_1 Forward -93 -85 18.1123 0.00295
NP_442889.1_8 Forward -96 -82 9.24208 0.101
NP_440178.1_7 Reverse -83 -102 -12.9802 0.129
NP_442570.1_3 Forward -163 -144 -6.29373 0.257
NP_442570.1_3 Reverse -251 -270 -9.24366 0.296
NP_441025.1_2 Forward -266 -247 18.584 0.128
NP_441716.1_2 Reverse -47 -66 -2.09947 0.299
NP_441327.1_1 Forward -296 -277 3.25228 0.277
NP_441163.1_1 Forward -196 -179 8.98622 0.226
NP_440906.1_5 Forward -92 -85 15.8704 0.0124
NP_440906.1_5 Reverse -85 -92 15.8704 0.0124
NP_440747.1_10 Reverse -81 -93 5.54551 0.0128
NP_440747.1_10 Forward -96 -84 -1.92764 0.0192
NP_440747.1_10 Forward -110 -98 -12.2524 0.254
NP_441130.1_10 Reverse -82 -96 6.98109 0.173
NP_442973.1_5 Reverse -75 -94 19.8623 0.039
NP_441486.1_1 Forward -96 -82 6.58777 0.0344
NP_441486.1_1 Reverse -81 -95 -2.75368 0.175
NP_441194.1_4 Forward -104 -85 6.29264 0.227
NP_440944.1_2 Forward -396 -377 0.196116 0.256
NP_442634.1_4 Reverse -82 -96 4.52282 0.0764
NP_442634.1_4 Forward -95 -81 -3.63866 0.161
NP_442848.1_9 Reverse -78 -97 1.37609 0.262
NP_443018.1_3 Forward -92 -85 14.8871 0.0123
NP_443018.1_3 Reverse -85 -92 14.8871 0.0123
NP_443018.1_3 Forward -275 -268 10.2655 0.107
NP_441316.1_7 Reverse -82 -97 7.25639 0.107
NP_441634.1_8 Reverse -82 -96 -4.32697 0.295
NP_440376.1_1 Forward -93 -84 19.4693 0.000692
NP_440376.1_1 Reverse -84 -93 19.4693 0.000692
NP_441588.1_4 Forward -91 -81 9.22315 0.14
NP_441588.1_4 Reverse -86 -96 6.66654 0.185
NP_441588.1_4 Reverse -269 -279 5.78156 0.235
NP_442687.1_7 Reverse -83 -93 18.5646 0.0028
NP_442687.1_7 Forward -94 -84 9.02648 0.0994
NP_442958.1_3 Forward -104 -85 1.57275 0.267
NP_440642.1_10 Reverse -303 -317 8.16044 0.209
NP_441422.1_7 Reverse -251 -268 -7.33598 0.258
NP_440667.1_2 Reverse -294 -313 -3.24547 0.232
NP_440360.1_5 Reverse -351 -370 -5.31042 0.297
NP_440360.1_10 Reverse -86 -100 3.73617 0.227
NP_442658.1_1 Forward -95 -85 15.9091 0.00966
NP_442658.1_1 Reverse -82 -92 14.8275 0.0188
NP_440617.1_3 Forward -101 -82 12.6841 0.0814
NP_441855.2_4 Reverse -76 -95 12.8973 0.174
NP_441256.1_1 Reverse -360 -379 4.32602 0.115
NP_441256.1_1 Forward -125 -106 -8.752 0.264
NP_442321.1_1 Forward -95 -76 -2.95047 0.214
NP_441958.1_5 Forward -94 -84 21.2195 0.000805
NP_441958.1_5 Reverse -83 -93 20.5312 0.000966
NP_442685.1_2 Reverse -276 -286 13.7464 0.289
NP_439905.1_1 Reverse -85 -98 9.75405 0.216
NP_440984.1_7 Forward -98 -84 20.1574 0.00473
NP_440984.1_7 Reverse -79 -93 5.01447 0.276
NP_442911.1_2 Forward -103 -84 -9.44032 0.257
NP_441580.1_6 Forward -104 -85 -6.49039 0.235
NP_440153.1_8 Forward -309 -296 -2.53732 0.244
NP_440993.1_2 Forward -98 -82 5.6634 0.234
NP_440934.1_1 Forward -107 -88 6.4893 0.235
NP_441099.1_5 Forward -103 -84 -11.7019 0.288
NP_442002.1_9 Reverse -83 -90 14.1004 0.074
NP_440809.1_9 Forward -102 -84 -7.84733 0.225
NP_440809.1_9 Forward -393 -375 -7.94566 0.225
NP_441294.1_7 Reverse -80 -94 15.6819 0.0213
NP_442438.1_10 Forward -98 -84 1.76955 0.188
NP_441000.1_6 Reverse -83 -97 -4.03198 0.225
NP_441000.1_6 Forward -94 -80 -4.62196 0.248
NP_440147.1_4 Reverse -82 -95 22.0454 0.00117
NP_440147.1_4 Forward -95 -82 4.05085 0.173
NP_440147.1_4 Reverse -96 -109 -0.177378 0.276
NP_441550.1_8 Reverse -82 -92 17.6791 0.00754
NP_441550.1_8 Forward -95 -85 17.4824 0.00754
NP_441550.1_8 Forward -211 -201 5.19112 0.26
NP_441916.1_7 Reverse -84 -94 18.9579 0.00144
NP_441916.1_7 Forward -93 -83 16.893 0.00407
NP_441916.1_10 Forward -322 -303 0.294447 0.286
NP_440465.1_10 Forward -96 -77 4.62101 0.225
NP_441041.1_4 Forward -353 -334 -8.26035 0.199
NP_441041.1_4 Reverse -369 -388 -13.3736 0.285
NP_441041.1_7 Reverse -81 -93 21.314 0.00104
NP_441041.1_7 Forward -96 -84 18.3015 0.00558
NP_441725.1_4 Reverse -66 -80 4.03056 0.278
NP_441725.1_5 Forward -92 -82 11.7798 0.0247
NP_441725.1_5 Reverse -85 -95 8.92815 0.0553
NP_439966.1_7 Forward -95 -85 13.8442 0.0234
NP_439966.1_7 Reverse -198 -208 4.99446 0.248
NP_439966.1_9 Forward -95 -86 0.983037 0.253
NP_442941.1_3 Reverse -85 -95 10.9931 0.0116
NP_442941.1_3 Forward -92 -82 2.53664 0.14
NP_440289.1_2 Forward -96 -83 14.5723 0.0107
NP_440289.1_2 Reverse -81 -94 7.09911 0.0586
NP_440983.1_9 Forward -261 -242 5.11266 0.285
NP_442281.1_1 Reverse -79 -93 22.025 0.00192
NP_442281.1_1 Forward -98 -84 14.2569 0.0198
NP_440177.1_5 Forward -326 -307 11.3075 0.278
NP_442256.1_2 Reverse -82 -100 -6.76569 0.214
NP_001035871.2_7 Reverse -251 -261 13.5497 0.219
NP_440437.1_1 Forward -99 -80 -4.6221 0.264
NP_440647.1_9 Reverse -82 -100 8.27895 0.219
NP_442012.1_1 Forward -99 -80 3.83436 0.179
NP_441457.1_7 Forward -95 -76 -0.197208 0.288
NP_441556.1_10 Forward -251 -237 12.3632 0.195
NP_441644.1_6 Reverse -84 -94 19.0557 0.000803
NP_441644.1_6 Forward -93 -83 15.7125 0.0048
NP_442215.1_2 Reverse -82 -98 -1.71142 0.187
NP_442215.1_2 Forward -95 -79 -2.00642 0.191
NP_440253.1_2 Reverse -84 -102 0.609134 0.181
NP_440929.1_8 Forward -93 -84 19.2726 0.000701
NP_440929.1_8 Reverse -84 -93 19.2726 0.000701
NP_442933.1_10 Forward -93 -84 17.601 0.00325
NP_442933.1_10 Reverse -84 -93 17.601 0.00325
NP_441751.2_8 Forward -92 -78 5.80112 0.0408
NP_441751.2_8 Reverse -85 -99 2.75286 0.0759
NP_442554.1_8 Reverse -85 -95 19.1546 0.00369
NP_442554.1_8 Forward -92 -82 14.238 0.0144
NP_442970.1_3 Forward -76 -58 15.3133 0.168
NP_441762.1_7 Reverse -83 -95 11.1504 0.0142
NP_441762.1_7 Forward -94 -82 0.432302 0.0747
NP_442142.1_4 Reverse -81 -94 11.2284 0.0603
NP_442142.1_4 Forward -96 -83 4.93527 0.206
NP_442142.1_4 Reverse -357 -370 4.73861 0.212
NP_442142.1_4 Reverse -264 -277 4.24695 0.227
NP_442292.1_1 Reverse -85 -94 17.5026 0.00435
NP_442292.1_1 Forward -92 -83 9.53783 0.0183
NP_442292.1_5 Forward -97 -78 -0.590531 0.257
NP_440919.1_1 Forward -98 -79 -1.67217 0.221
NP_442381.1_8 Forward -96 -77 -13.9635 0.28
NP_443009.1_5 Forward -94 -83 17.0694 0.00659
NP_443009.1_5 Reverse -83 -94 16.7744 0.00677
NP_443009.1_5 Forward -147 -136 3.49977 0.292
NP_443009.1_10 Forward -134 -116 9.95058 0.187
NP_442408.2_1 Forward -93 -74 -6.58872 0.282
NP_441715.1_4 Reverse -85 -95 7.25653 0.108
NP_441715.1_4 Reverse -99 -109 4.3066 0.29
NP_440357.1_3 Reverse -82 -101 3.34271 0.242
NP_440158.1_1 Reverse -213 -232 12.1748 0.195
NP_441198.1_8 Forward -95 -85 15.4199 0.0427
NP_441198.1_8 Reverse -82 -92 12.5877 0.12
NP_440379.1_5 Forward -192 -173 -11.4069 0.296
NP_441468.1_1 Forward -92 -85 15.8704 0.0124
NP_441468.1_1 Reverse -85 -92 15.8704 0.0124
NP_441020.2_6 Reverse -82 -99 13.4119 0.0736
NP_441020.2_6 Forward -95 -78 10.4619 0.142
NP_441673.1_1 Forward -93 -84 20.8459 0.000698
NP_441673.1_1 Reverse -84 -93 20.8459 0.000698
NP_440265.1_7 Forward -236 -222 17.3052 0.158
NP_441826.1_2 Reverse -78 -92 3.14618 0.115
NP_441826.1_2 Forward -99 -85 -2.26202 0.269
NP_442811.1_2 Forward -168 -149 -2.95047 0.281
NP_442490.1_9 Forward -105 -86 -5.50708 0.273
NP_441764.1_4 Reverse -47 -64 11.605 0.216
NP_442868.1_6 Reverse -82 -92 9.12481 0.0539
NP_442868.1_6 Forward -95 -85 8.63316 0.0555
NP_442808.1_1 Reverse -83 -93 8.73102 0.0481
NP_442808.1_1 Forward -94 -84 8.73102 0.0481
NP_442808.1_1 Reverse -136 -146 2.5362 0.263
NP_442808.1_1 Forward -379 -369 1.45457 0.285
NP_441849.1_7 Reverse -209 -222 16.4864 0.278
NP_442542.1_9 Forward -100 -86 9.04542 0.141
NP_442050.1_5 Forward -95 -85 17.1874 0.00812
NP_442050.1_5 Reverse -82 -92 6.96107 0.27
NP_442050.1_8 Forward -372 -353 11.9452 0.282
NP_440601.1_8 Forward -373 -354 16.2209 0.175
NP_441114.1_3 Forward -187 -178 7.27622 0.247
NP_441114.1_3 Reverse -147 -156 6.39124 0.277
NP_440558.1_2 Reverse -296 -315 -5.9004 0.267
NP_441878.1_6 Reverse -83 -93 20.2362 0.0046
NP_441878.1_6 Forward -94 -84 10.5014 0.0176
NP_441036.1_8 Forward -94 -84 15.713 0.00724
NP_441036.1_8 Reverse -83 -93 8.4365 0.174
NP_442503.1_9 Forward -198 -179 8.84924 0.22
NP_441557.1_5 Forward -93 -84 19.9609 0.000699
NP_441557.1_5 Reverse -84 -93 19.9609 0.000699
NP_441445.1_1 Reverse -27 -46 -0.590531 0.297
NP_441590.1_4 Forward -302 -283 1.86696 0.299
NP_442066.2_4 Reverse -84 -103 -2.36049 0.211
NP_442066.2_9 Forward -97 -84 19.3905 0.00844
NP_441308.1_8 Forward -95 -85 12.4681 0.218
NP_442183.1_1 Reverse -84 -98 11.996 0.0648
NP_442183.1_1 Forward -93 -79 9.5377 0.0966
NP_442183.1_1 Forward -245 -231 5.70279 0.206
NP_442183.1_1 Forward -146 -132 4.03116 0.282
NP_442183.1_9 Forward -206 -196 10.6981 0.296
NP_442397.1_9 Forward -93 -74 3.93269 0.262
NP_441549.1_9 Forward -111 -93 -6.56903 0.201
NP_440861.1_3 Forward -121 -103 9.45892 0.296
NP_442347.1_2 Forward -92 -83 3.34298 0.284
NP_442347.1_2 Reverse -85 -94 3.34298 0.284
NP_442645.1_2 Forward -95 -76 -21.7317 0.29
NP_442965.1_2 Forward -353 -334 -6.78538 0.261
NP_442888.1_6 Forward -287 -268 4.81767 0.228
NP_441037.1_4 Reverse -82 -92 17.3558 0.0127
NP_441037.1_4 Forward -95 -85 16.5761 0.0168
NP_442317.1_6 Forward -98 -79 8.16093 0.216
NP_441633.1_3 Reverse -82 -95 3.65753 0.0699
NP_441633.1_3 Forward -95 -82 -3.71729 0.177
NP_440136.1_2 Forward -92 -85 15.9687 0.0123
NP_440136.1_2 Reverse -85 -92 15.9687 0.0123
NP_442998.1_10 Forward -91 -84 15.5754 0.0102
NP_442998.1_10 Reverse -86 -93 15.5754 0.0102
NP_440899.1_1 Forward -177 -158 7.62671 0.254
NP_441799.1_1 Reverse -80 -94 15.5352 0.0178
NP_441799.1_1 Forward -97 -83 7.17714 0.149
NP_441007.1_10 Forward -98 -85 21.9471 0.00574
NP_441007.1_10 Reverse -79 -92 0.707601 0.219
NP_440256.1_1 Reverse -81 -100 -3.24547 0.129
NP_440256.1_1 Forward -96 -77 -9.24366 0.275
NP_440256.1_1 Forward -234 -215 -9.34199 0.278
NP_441395.1_3 Forward -358 -339 17.699 0.298
NP_440915.1_6 Forward -97 -83 12.1926 0.0218
NP_440915.1_6 Reverse -80 -94 5.80112 0.0879
NP_442866.1_1 Forward -98 -79 -5.11376 0.24
NP_440748.1_5 Reverse -218 -237 -2.45882 0.274
NP_441464.1_8 Forward -93 -79 14.6509 0.115
NP_441464.1_10 Forward -253 -239 12.291 0.201
NP_441939.1_3 Reverse -85 -104 16.3224 0.0401
NP_441199.1_3 Reverse -141 -159 1.29745 0.231
NP_441494.1_6 Forward -177 -164 8.47575 0.23
NP_441494.1_6 Forward -98 -85 6.80412 0.272
NP_442993.1_1 Forward -93 -77 -7.41462 0.146
NP_442993.1_1 Reverse -84 -100 -11.1512 0.235
NP_440677.1_1 Reverse -227 -246 9.83255 0.181
NP_440677.1_1 Forward -102 -83 8.06259 0.218
NP_442386.1_9 Forward -379 -370 11.8973 0.0799
NP_442386.1_9 Reverse -368 -377 11.3073 0.0971
NP_442386.1_9 Forward -94 -85 6.39082 0.219
NP_442386.1_9 Reverse -83 -92 6.39082 0.219
NP_441340.1_5 Forward -92 -85 15.6737 0.0124
NP_441340.1_5 Reverse -85 -92 15.6737 0.0124
NP_441947.1_4 Reverse -73 -92 14.9458 0.16
NP_441297.1_8 Forward -149 -131 11.4247 0.238
NP_440168.1_9 Forward -199 -180 -4.52377 0.296
NP_442506.1_2 Forward -104 -85 4.12936 0.275
NP_440161.1_3 Forward -95 -76 8.75091 0.264
NP_442714.1_3 Forward -96 -77 16.8132 0.124
NP_440586.1_8 Forward -92 -85 13.2151 0.026
NP_440586.1_8 Reverse -85 -92 13.2151 0.026
NP_440586.1_8 Forward -275 -268 9.08521 0.178
NP_442251.1_6 Forward -92 -85 15.2804 0.0124
NP_442251.1_6 Reverse -85 -92 15.2804 0.0124
NP_440684.1_9 Reverse -78 -92 19.8624 0.0219
NP_441262.1_3 Reverse -84 -91 14.7888 0.0223
NP_441262.1_3 Forward -93 -86 14.7888 0.0223
NP_443051.1_1 Forward -94 -85 19.5676 0.00335
NP_443051.1_1 Reverse -83 -92 18.0926 0.00402
NP_439937.1_9 Reverse -114 -131 -9.89323 0.215
NP_439937.1_9 Reverse -83 -100 -14.5148 0.287
NP_441740.2_4 Forward -187 -168 16.4207 0.185
NP_441740.2_8 Forward -92 -78 18.3875 0.24
NP_441740.2_9 Forward -341 -322 17.5024 0.215
NP_441740.2_9 Reverse -309 -328 16.0274 0.284
NP_440626.1_1 Reverse -85 -104 8.35677 0.299
NP_440439.1_1 Forward -96 -83 12.3107 0.0255
NP_440372.1_2 Forward -92 -85 16.3621 0.0124
NP_440372.1_2 Reverse -85 -92 16.3621 0.0124
NP_440171.1_3 Forward -161 -142 1.96607 0.29
NP_441138.1_5 Forward -73 -60 3.02202 0.297
NP_441572.1_7 Forward -99 -80 -4.42544 0.235
NP_440267.1_2 Reverse -79 -93 9.73373 0.156
NP_442384.1_10 Forward -93 -80 1.69091 0.249
NP_441018.1_7 Forward -240 -221 9.83255 0.218
NP_442790.1_4 Reverse -75 -94 3.34271 0.0729
NP_442262.1_10 Forward -92 -85 14.1988 0.0123
NP_442262.1_10 Reverse -85 -92 14.1988 0.0123
NP_442262.1_10 Forward -275 -268 9.18389 0.211
NP_441689.1_5 Forward -95 -85 8.43603 0.132
NP_442244.1_9 Reverse -236 -255 8.75091 0.268
NP_440344.1_10 Reverse -77 -94 -3.30441 0.0812
NP_440344.1_10 Forward -100 -83 -8.71262 0.132
NP_440282.1_10 Reverse -188 -207 -5.40875 0.25
NP_440282.1_10 Forward -103 -84 -5.80207 0.25
NP_440531.1_6 Forward -101 -82 4.42435 0.125
NP_442123.1_3 Reverse -84 -103 19.174 0.0479
NP_441060.1_1 Forward -146 -127 12.7655 0.294
NP_440562.1_3 Reverse -85 -102 15.8701 0.052
NP_442529.1_4 Reverse -75 -94 9.93088 0.235
NP_442693.1_2 Forward -127 -108 13.7658 0.169
NP_440297.1_9 Forward -92 -82 9.61647 0.0917
NP_440297.1_9 Reverse -85 -95 -0.314959 0.282
NP_442280.1_10 Reverse -142 -160 15.0971 0.114
NP_442553.1_4 Reverse -65 -84 8.75091 0.264
NP_443036.1_1 Reverse -196 -215 10.0284 0.267
NP_440999.1_9 Forward -97 -83 8.65272 0.0738
NP_440888.1_2 Reverse -84 -98 16.3219 0.00724
NP_440600.1_4 Reverse -76 -94 -8.14232 0.297
NP_440491.1_1 Reverse -81 -100 9.84073 0.206
NP_442277.1_2 Forward -199 -185 10.6193 0.287
NP_442277.1_4 Forward -102 -83 19.4681 0.0213
NP_442277.1_4 Reverse -75 -94 1.6703 0.272
NP_441543.1_2 Reverse -85 -94 15.9293 0.00518
NP_441543.1_2 Forward -92 -83 9.34117 0.0818
NP_442845.1_2 Forward -99 -85 5.30946 0.237
NP_442845.1_4 Forward -95 -76 10.1275 0.178
NP_441469.1_8 Reverse -83 -92 13.3727 0.073
NP_441469.1_8 Forward -94 -85 6.5879 0.227
NP_443064.1_6 Forward -93 -83 13.8273 0.0796
NP_443064.1_6 Reverse -84 -94 10.8217 0.13
NP_443064.1_6 Reverse -137 -147 10.5308 0.148
NP_442578.1_7 Forward -92 -85 14.5921 0.026
NP_442578.1_7 Reverse -85 -92 14.5921 0.026
NP_440148.1_6 Forward -367 -353 16.6434 0.255
NP_441462.1_2 Reverse -84 -94 20.2362 0.000805
NP_441462.1_2 Forward -93 -83 20.1379 0.000967
NP_441621.1_7 Reverse -82 -96 2.5562 0.123
NP_440668.1_3 Forward -270 -251 2.85105 0.297
NP_443062.1_1 Reverse -84 -102 6.10824 0.209
NP_443062.1_6 Reverse -76 -95 0.982764 0.283
NP_441410.1_3 Reverse -75 -94 8.84924 0.21
NP_440544.1_2 Forward -273 -254 9.73422 0.202
NP_440516.1_6 Forward -197 -183 14.8469 0.188
NP_440516.1_8 Forward -93 -84 16.9127 0.00442
NP_440516.1_8 Reverse -84 -93 16.9127 0.00442
NP_442428.1_5 Forward -92 -85 15.8704 0.0124
NP_442428.1_5 Reverse -85 -92 15.8704 0.0124
NP_440673.1_3 Forward -91 -84 12.4288 0.0426
NP_440673.1_3 Reverse -86 -93 12.4288 0.0426
NP_440673.1_3 Reverse -229 -236 6.72562 0.277
NP_441052.1_2 Forward -93 -83 10.4031 0.0285
NP_441052.1_2 Reverse -84 -94 10.4031 0.0285
NP_441052.1_2 Forward -188 -178 3.81494 0.173
NP_442219.1_8 Reverse -377 -396 8.16711 0.253
NP_442219.1_9 Forward -92 -83 8.25953 0.0681
NP_442219.1_9 Reverse -85 -94 8.25953 0.0681
NP_440436.1_4 Forward -92 -83 15.9289 0.00508
NP_440436.1_4 Reverse -85 -94 9.24241 0.0871
NP_441884.1_9 Reverse -81 -100 -5.99873 0.0594
NP_441884.1_9 Forward -96 -77 -23.4033 0.284
NP_441893.1_10 Forward -354 -335 13.3725 0.192
NP_440314.1_9 Reverse -228 -247 -8.85033 0.254
NP_440041.1_6 Reverse -108 -127 12.1917 0.285
NP_441719.1_4 Forward -92 -85 16.3621 0.0124
NP_441719.1_4 Reverse -85 -92 16.3621 0.0124
NP_441733.1_10 Forward -96 -83 16.3422 0.047
NP_441004.1_1 Forward -111 -92 -17.7001 0.294
NP_441004.1_4 Forward -328 -318 13.648 0.216
NP_442366.1_3 Forward -94 -76 -0.964162 0.203
NP_442366.1_5 Reverse -81 -91 14.8275 0.0375
NP_441115.1_4 Reverse -83 -101 13.883 0.067
NP_440328.1_4 Reverse -78 -97 6.4893 0.129
NP_443054.1_2 Forward -95 -81 9.04604 0.102
NP_443054.1_2 Reverse -82 -96 4.81781 0.24
NP_442430.1_10 Forward -103 -84 11.405 0.245
NP_440864.1_9 Reverse -307 -326 8.94757 0.0786
NP_441851.1_10 Reverse -83 -93 17.4829 0.0027
NP_441851.1_10 Forward -94 -84 8.53483 0.114
NP_442622.1_8 Forward -93 -75 -9.32229 0.145
NP_441668.1_4 Reverse -74 -93 3.93269 0.183
NP_442515.1_1 Reverse -83 -97 6.3911 0.0977
NP_442515.1_1 Forward -94 -80 -3.04867 0.285
NP_442689.1_8 Forward -61 -44 2.79211 0.18
NP_442689.1_8 Forward -30 -13 -8.12263 0.292
NP_440432.1_9 Forward -92 -77 9.61633 0.0419
NP_440432.1_9 Reverse -85 -100 7.74804 0.0427
NP_440432.1_9 Reverse -108 -123 -0.80675 0.167
NP_440432.1_9 Reverse -138 -153 -3.26502 0.179
NP_442843.1_1 Forward -153 -134 -2.65548 0.209
NP_440474.1_8 Reverse -85 -99 15.3386 0.0566
NP_442450.1_5 Reverse -82 -92 17.3846 0.0267
NP_441031.1_10 Forward -63 -44 13.6676 0.286
NP_442038.1_1 Reverse -278 -297 2.26107 0.275
NP_441570.1_1 Forward -93 -75 -16.9921 0.26
NP_441078.1_4 Forward -93 -84 19.6659 0.0007
NP_441078.1_4 Reverse -84 -93 19.6659 0.0007
NP_441078.1_4 Reverse -98 -107 -1.08191 0.222
NP_441078.1_4 Forward -107 -98 -2.06522 0.295
NP_442348.1_2 Reverse -43 -52 10.7178 0.259
NP_440526.1_3 Reverse -85 -96 11.6612 0.0646
NP_440526.1_3 Forward -92 -81 10.9729 0.0646
NP_441432.1_8 Forward -94 -85 16.8143 0.00595
NP_441432.1_8 Reverse -83 -92 8.35786 0.0755
NP_442320.1_8 Forward -99 -85 -3.24533 0.113
NP_442320.1_8 Reverse -78 -92 -4.13031 0.148
NP_441732.1_2 Reverse -94 -110 -8.10294 0.116
NP_441732.1_2 Reverse -80 -96 -16.2644 0.165
NP_441732.1_2 Forward -313 -297 -16.4611 0.167
NP_442815.1_2 Forward -247 -229 13.1955 0.125
NP_440760.1_1 Forward -93 -74 -5.70374 0.0511
NP_440578.1_8 Forward -143 -124 10.8159 0.284
NP_441057.1_2 Forward -148 -129 17.7974 0.243
NP_442353.1_4 Forward -359 -340 4.32522 0.205
NP_442353.1_4 Forward -136 -117 2.26028 0.234
NP_441072.1_2 Reverse -73 -92 9.43923 0.218
NP_442489.1_7 Forward -93 -84 20.1576 0.000695
NP_442489.1_7 Reverse -84 -93 20.1576 0.000695
NP_440565.1_2 Reverse -110 -124 14.74 0.292
NP_442079.1_7 Reverse -85 -104 1.96607 0.24
NP_440559.1_1 Forward -92 -83 17.306 0.00658
NP_440559.1_1 Reverse -85 -94 8.65285 0.0586
NP_441659.2_8 Reverse -84 -94 20.9245 0.000805
NP_441659.2_8 Forward -93 -83 19.3512 0.000966
NP_440363.1_9 Reverse -99 -117 13.9821 0.249
NP_442913.1_10 Forward -102 -83 -1.18052 0.167
NP_440779.1_5 Forward -93 -76 3.57876 0.0665
NP_440779.1_5 Reverse -84 -101 -5.66436 0.152
NP_441185.1_7 Forward -104 -85 18.3873 0.178
NP_442346.1_5 Reverse -83 -93 17.9746 0.00128
NP_442346.1_5 Forward -94 -84 16.303 0.00248
NP_440545.1_3 Reverse -80 -97 5.25038 0.0631
NP_441856.1_3 Reverse -81 -100 -1.96717 0.25
NP_440025.1_1 Reverse -80 -99 12.6841 0.147
NP_442551.1_4 Reverse -177 -192 -1.79006 0.25
NP_441233.1_8 Forward -368 -349 8.25926 0.148
NP_440449.1_6 Forward -101 -83 18.4685 0.065
NP_441948.1_4 Reverse -77 -95 -0.964162 0.14
NP_441948.1_4 Reverse -362 -380 -2.24246 0.163
NP_441833.1_4 Forward -92 -85 15.9687 0.0124
NP_441833.1_4 Reverse -85 -92 15.9687 0.0124
NP_442162.1_9 Forward -92 -85 16.2637 0.0124
NP_442162.1_9 Reverse -85 -92 16.2637 0.0124
NP_440671.1_4 Reverse -78 -92 6.3911 0.248
NP_440671.1_4 Reverse -194 -208 4.91614 0.3
NP_442199.1_5 Forward -101 -82 -1.18052 0.18
NP_442140.1_3 Forward -92 -82 13.5497 0.0542
NP_442140.1_3 Reverse -85 -95 7.94484 0.124
NP_440875.1_9 Reverse -86 -96 16.8403 0.0145
NP_441813.1_5 Reverse -82 -92 8.82982 0.0367
NP_441813.1_5 Forward -95 -85 8.73149 0.0367
NP_440590.1_4 Reverse -85 -98 2.96921 0.0783
NP_440590.1_4 Forward -92 -79 -6.07724 0.299
NP_440567.1_1 Reverse -85 -99 15.8309 0.0166
NP_440567.1_1 Forward -92 -78 3.73617 0.137
NP_440567.1_4 Forward -365 -346 2.3594 0.261
NP_442839.1_10 Forward -327 -313 12.1926 0.288
NP_442497.1_10 Forward -92 -83 19.8626 0.00532
NP_442497.1_10 Reverse -85 -94 17.601 0.00813
NP_440821.1_4 Reverse -82 -92 10.9931 0.0146
NP_440821.1_4 Forward -95 -85 10.7964 0.0146
NP_440821.1_7 Forward -186 -167 10.7175 0.288
NP_441239.1_9 Forward -95 -83 18.4269 0.0114
NP_441239.1_9 Reverse -82 -94 10.7571 0.0723
NP_440156.1_4 Forward -283 -273 17.3841 0.176
NP_441892.1_1 Reverse -75 -92 14.8868 0.032
NP_440604.1_6 Reverse -84 -103 -5.9004 0.287
NP_441017.1_8 Forward -96 -81 8.14137 0.252
NP_442083.1_9 Forward -379 -360 9.63589 0.255
NP_440949.1_7 Reverse -138 -157 8.94676 0.264
NP_442138.1_10 Forward -93 -74 -5.21209 0.268
NP_442052.1_8 Reverse -82 -92 12.7631 0.253
NP_440546.1_4 Reverse -84 -94 13.5365 0.0459
NP_440546.1_4 Forward -93 -83 12.8578 0.0572
NP_440462.1_6 Forward -95 -85 19.4496 0.00371
NP_440462.1_6 Reverse -82 -92 1.455 0.294
NP_440868.1_4 Forward -97 -85 9.47875 0.0482
NP_440868.1_4 Reverse -80 -92 -0.74767 0.282
NP_441848.1_7 Reverse -334 -353 9.7334 0.196
NP_439942.1_2 Forward -35 -16 12.405 0.271
NP_442923.1_4 Forward -242 -223 2.45773 0.161
NP_442039.1_4 Forward -92 -85 15.1821 0.0124
NP_442039.1_4 Reverse -85 -92 15.1821 0.0124
NP_442625.1_1 Reverse -285 -304 3.6377 0.267
NP_440825.1_7 Forward -92 -82 11.8361 0.2
NP_442837.1_3 Forward -92 -85 15.7721 0.0124
NP_442837.1_3 Reverse -85 -92 15.7721 0.0124
NP_439994.1_3 Forward -310 -291 8.1459 0.292
NP_442053.1_1 Forward -93 -84 18.3876 0.0007
NP_442053.1_1 Reverse -84 -93 18.3876 0.0007
NP_440505.1_3 Forward -95 -85 15.418 0.0114
NP_441102.1_1 Reverse -85 -104 14.5524 0.108
NP_441252.1_6 Reverse -322 -329 11.9372 0.25
NP_440914.1_1 Reverse -84 -94 16.3248 0.00196
NP_440914.1_1 Forward -93 -83 8.51751 0.186
NP_440914.1_1 Reverse -6 -16 6.95605 0.257
NP_441011.1_8 Reverse -85 -94 16.6177 0.00602
NP_441011.1_8 Forward -92 -83 14.356 0.0249
NP_442533.1_6 Forward -93 -84 17.2076 0.00137
NP_442533.1_6 Reverse -84 -93 17.2076 0.00137
NP_442541.1_10 Reverse -188 -202 2.75226 0.254
NP_442229.1_1 Forward -95 -81 17.2068 0.0765
NP_441482.1_7 Reverse -78 -92 -10.5218 0.209
NP_439944.1_9 Reverse -85 -95 17.7779 0.00341
NP_439944.1_9 Forward -92 -82 8.82982 0.101
NP_440816.1_7 Forward -97 -78 12.8808 0.201
NP_440116.1_8 Reverse -85 -104 -4.32711 0.168
NP_440115.1_6 Forward -96 -86 7.84651 0.146
NP_441972.1_5 Reverse -85 -104 -1.57384 0.177
NP_441106.1_1 Forward -94 -85 18.486 0.0028
NP_441106.1_1 Reverse -83 -92 9.73449 0.0311
NP_439903.1_6 Forward -96 -77 9.63507 0.12
NP_439903.1_6 Reverse -335 -354 5.70185 0.178
NP_442306.1_10 Forward -98 -79 -21.24 0.254
NP_441286.1_1 Forward -94 -82 6.03717 0.0258
NP_441286.1_1 Reverse -83 -95 5.25052 0.0259
NP_442674.1_3 Reverse -144 -163 5.89851 0.254
NP_440670.1_8 Forward -93 -84 18.3876 0.000699
NP_440670.1_8 Reverse -84 -93 18.3876 0.000699
NP_440886.1_7 Forward -94 -84 8.04271 0.0805
NP_440886.1_7 Reverse -83 -93 8.04271 0.0805
NP_440886.1_7 Forward -379 -369 3.8145 0.265
NP_440886.1_7 Forward -87 -77 3.22451 0.291
NP_442614.1_2 Reverse -84 -98 6.29277 0.291
NP_442072.1_9 Reverse -83 -101 8.27895 0.00914
NP_441403.1_4 Forward -142 -124 6.41066 0.288
NP_440907.2_8 Reverse -85 -95 19.1541 0.00362
NP_440907.2_8 Forward -92 -82 16.2041 0.0161
NP_441021.1_1 Reverse -85 -104 -6.49039 0.18
NP_441021.1_8 Reverse -79 -97 15.4571 0.0812
NP_441463.1_3 Forward -103 -84 -1.96717 0.147
NP_442893.1_4 Reverse -12 -31 7.07848 0.132
NP_441626.1_2 Forward -92 -85 15.7721 0.0124
NP_441626.1_2 Reverse -85 -92 15.7721 0.0124
NP_442211.1_3 Forward -242 -223 6.79116 0.299
NP_442615.1_1 Forward -102 -84 21.1603 0.0038
NP_442615.1_1 Reverse -75 -93 -3.02911 0.154
NP_441962.1_4 Forward -250 -231 -11.1119 0.238
NP_441962.1_4 Forward -202 -183 -11.4069 0.241
NP_440387.1_1 Reverse -84 -100 -1.71142 0.143
NP_441431.1_2 Forward -96 -82 15.3386 0.0501
NP_441431.1_2 Reverse -81 -95 9.6354 0.181
NP_440114.1_10 Reverse -84 -98 18.0925 0.0075
NP_440114.1_10 Forward -93 -79 17.1092 0.0122
NP_442437.1_8 Forward -104 -85 7.66927 0.242
NP_441206.1_7 Reverse -78 -96 3.26407 0.294
NP_440766.1_4 Forward -97 -83 4.32615 0.131
NP_441237.1_9 Forward -92 -82 17.188 0.00445
NP_441311.1_2 Reverse -92 -106 18.2885 0.229
NP_441311.1_2 Forward -99 -85 11.9953 0.236
NP_441133.1_1 Forward -209 -190 14.2574 0.219
NP_440502.1_3 Reverse -33 -43 13.7899 0.292
NP_440457.1_1 Reverse -80 -92 1.12062 0.245
NP_440798.1_6 Forward -92 -79 3.85419 0.147
NP_440798.1_6 Reverse -85 -98 1.9859 0.188
NP_441984.1_6 Forward -122 -110 15.0836 0.219
NP_442509.1_7 Reverse -187 -206 16.9124 0.267
NP_442509.1_9 Forward -93 -83 17.3841 0.00128
NP_442509.1_9 Reverse -137 -147 11.9759 0.107
NP_442509.1_9 Reverse -84 -94 8.04271 0.192
NP_441253.1_8 Reverse -79 -93 18.3985 0.119
NP_440554.1_4 Reverse -85 -95 15.418 0.0199
NP_442862.1_3 Reverse -279 -296 8.29864 0.243
NP_441845.1_6 Forward -105 -87 -0.669169 0.274
NP_441885.1_5 Forward -93 -83 11.3864 0.00668
NP_441885.1_5 Reverse -84 -94 11.3864 0.00668
NP_441885.1_5 Reverse -98 -108 0.471689 0.145
NP_442341.1_7 Reverse -83 -97 6.78443 0.118
NP_442341.1_9 Forward -95 -81 11.602 0.122
NP_440423.1_6 Reverse -76 -95 -11.1119 0.164
NP_443000.1_7 Forward -95 -85 10.7964 0.0345
NP_443000.1_7 Reverse -82 -92 2.04498 0.226
NP_441842.1_10 Forward -100 -86 19.2725 0.0142
NP_440275.1_3 Forward -95 -85 18.6629 0.0082
NP_440275.1_3 Reverse -82 -92 9.91146 0.046
NP_440091.1_1 Forward -97 -85 3.2839 0.163
NP_440091.1_1 Reverse -80 -92 1.41561 0.197
NP_441902.1_3 Reverse -322 -332 13.0789 0.23
NP_443010.1_10 Forward -96 -79 7.60248 0.167
NP_441122.1_1 Forward -19 -4 4.20813 0.28
NP_440175.1_7 Forward -240 -222 15.2186 0.128
NP_440149.1_8 Forward -384 -365 -0.688862 0.151
NP_441105.1_3 Reverse -73 -92 -4.22878 0.195
NP_442373.1_2 Reverse -294 -313 -11.9969 0.298
NP_440216.1_1 Reverse -84 -98 7.9644 0.00737
NP_440216.1_1 Forward -93 -79 6.3911 0.0156
NP_440216.1_9 Reverse -269 -278 7.37455 0.286
NP_440172.1_1 Reverse -84 -94 17.5813 0.00421
NP_440172.1_1 Forward -93 -83 16.303 0.00854
NP_442015.1_10 Reverse -80 -93 2.47756 0.191
NP_441226.1_7 Forward -92 -85 14.4934 0.0123
NP_441226.1_7 Reverse -85 -92 14.4934 0.0123
NP_441226.1_7 Forward -325 -318 6.52862 0.253
NP_441111.1_7 Forward -92 -84 18.7023 0.00294
NP_441111.1_7 Reverse -85 -93 18.7023 0.00294
NP_442379.1_10 Forward -100 -83 7.41366 0.102
NP_441766.1_2 Forward -93 -84 17.5026 0.00297
NP_441766.1_2 Reverse -84 -93 17.5026 0.00297
NP_442116.1_6 Forward -295 -278 9.60133 0.227
NP_442154.1_1 Forward -115 -97 -16.4021 0.239
NP_440261.1_5 Reverse -85 -98 8.27909 0.0273
NP_440261.1_5 Forward -92 -79 -10.2071 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAACGGAGATGTTGAAGGAAACCGGCATCCCGGTGCAGGTGATTTTCAGCAGTGGCAAAGATGTGGATTTATTGCCCCAACGGAGTAACAAAGGTAACGCCACCCAATATCTGCAACAACATTTAGCCATGGAGCCGTCTCAAACCCTGGTGTGTGGGGACTCCGGCAATGATATTGGCTTATTTGAAACTTCCGCTCGGGGTGTCATTGTCCGTAATGCCCAGCCGGAATTATTGCACTGGTATGACCAATGGGGGGATTCTCGTCATTATCGGGCCCAATCGAGCCATGCTGGCGCTATCCTAGAGGCGATCGCCCATTTCGATTTTTTGAGCTGATATTTTAGTTAACAATTCCGAATGGGCAAGCAAAGTAAGCTACAATTTGACATTGTTCAATT

CDS

TTGAGTACAGGGTGTAAAGCCGAGGAGGGCGTTATTGCTGAGCCACTAAACTTGACGGTCAGTTTGCGCGGGACATTAGAAGTCAAGGAAAAGTTACAAATCTTCCGTCTGACGGGTTTGTTGGACGCATTTTCCGAGCCTACCTTCCGTAAGGTAGTCAGCGATCACATCGAAGCAGGGCCTCCCCATGTGGTGCTGGACTTGTCCACCATTGATTTTATTGATAGCTCTGGCCTAGGAGCTTTGGTGCAGGTAACCAAACTTTCCCAAAACAAACAGGGAAGTGTACAGATTGTCACCAACCCTAGGGTTACCCAAACGGTAAAACTGGTGCGTTTGGAAAAATTCCTCCATCTCCATAATTCCCTGGCTGAGGCGATCGCCGCTACCACTGAGGGGTAA

Protein

MSTGCKAEEGVIAEPLNLTVSLRGTLEVKEKLQIFRLTGLLDAFSEPTFRKVVSDHIEAGPPHVVLDLSTIDFIDSSGLGALVQVTKLSQNKQGSVQIVTNPRVTQTVKLVRLEKFLHLHNSLAEAIAATTEG