Your browser is old and dusty. Try Google Chrome!

Details for ssr1558

ORF ssr1558
Accession NP_442783.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -340 -354 12.0943 0.222
NP_440795.1_7 Forward -315 -308 14.6904 0.0123
NP_440795.1_7 Reverse -308 -315 14.6904 0.0123
NP_441418.1_6 Reverse -307 -326 -28.4182 0.205
NP_442291.1_5 Forward -317 -301 11.8583 0.0372
NP_441453.1_4 Reverse -307 -315 16.539 0.00633
NP_441453.1_4 Forward -316 -308 16.539 0.00633
NP_442151.1_6 Reverse -307 -321 16.6175 0.0139
NP_442151.1_6 Forward -316 -302 8.16106 0.182
NP_441818.1_1 Forward -315 -304 17.1677 0.00948
NP_440226.1_1 Reverse -307 -326 14.0608 0.0329
NP_440226.1_1 Reverse -84 -103 3.24438 0.233
NP_440996.1_2 Forward -260 -251 15.241 0.248
NP_440996.1_3 Forward -329 -311 18.702 0.0755
NP_442173.1_1 Forward -315 -307 15.4574 0.00633
NP_442173.1_1 Reverse -308 -316 15.4574 0.00633
NP_442752.1_4 Forward -316 -309 13.8055 0.0199
NP_442752.1_4 Reverse -307 -314 13.8055 0.0199
NP_442752.1_4 Forward -93 -86 4.26735 0.293
NP_443027.1_4 Reverse -305 -315 7.35486 0.24
NP_439997.1_4 Forward -332 -313 10.1275 0.189
NP_442975.1_10 Reverse -303 -317 4.8172 0.239
NP_440784.1_7 Forward -315 -308 15.9687 0.0123
NP_440784.1_7 Reverse -308 -315 15.9687 0.0123
NP_441250.1_3 Reverse -314 -333 6.4893 0.226
NP_441250.1_3 Forward -339 -320 2.26107 0.28
NP_440061.1_9 Forward -387 -373 6.98048 0.223
NP_441054.1_4 Forward -326 -308 9.55725 0.0695
NP_442062.1_8 Forward -316 -306 17.6796 0.00193
NP_442062.1_8 Reverse -307 -317 17.3846 0.00193
NP_440304.1_4 Reverse -305 -315 18.9579 0.00406
NP_440304.1_4 Forward -74 -64 2.83163 0.299
NP_440304.1_4 Forward -318 -308 1.84832 0.299
NP_442242.1_4 Forward -315 -308 14.3954 0.0124
NP_442242.1_4 Reverse -308 -315 14.3954 0.0124
NP_440044.1_8 Forward -315 -296 -3.14714 0.28
NP_442762.1_10 Reverse -365 -384 -18.5851 0.297
NP_439918.1_3 Forward -247 -228 4.916 0.264
NP_441208.1_9 Forward -395 -381 6.78443 0.229
NP_441594.1_6 Reverse -298 -317 1.0811 0.274
NP_442110.1_7 Forward -316 -302 1.76955 0.222
NP_441083.1_5 Reverse -307 -317 20.3345 0.00053
NP_441083.1_5 Forward -316 -306 19.3512 0.000718
NP_441083.1_5 Reverse -84 -94 7.15819 0.0637
NP_441083.1_5 Forward -93 -83 4.50326 0.141
NP_441434.1_3 Reverse -25 -44 0.786102 0.198
NP_441434.1_7 Forward -314 -300 4.32615 0.225
NP_441434.1_7 Reverse -86 -100 4.12949 0.225
NP_441738.1_2 Forward -314 -307 15.28 0.0102
NP_441738.1_2 Reverse -309 -316 15.28 0.0102
NP_441738.1_2 Reverse -387 -394 8.29857 0.176
NP_441558.1_5 Reverse -305 -324 19.469 0.00782
NP_441942.1_3 Forward -392 -373 16.4067 0.232
NP_440209.1_1 Reverse -307 -315 18.1123 0.00295
NP_440209.1_1 Forward -316 -308 18.1123 0.00295
NP_442889.1_8 Reverse -304 -318 20.3534 0.00446
NP_441713.1_1 Forward -322 -303 -4.13045 0.113
NP_440178.1_7 Reverse -379 -398 -21.535 0.229
NP_442570.1_3 Forward -125 -106 -9.44032 0.299
NP_441716.1_1 Forward -93 -79 4.12949 0.258
NP_441716.1_1 Forward -316 -302 4.03116 0.259
NP_442111.1_4 Forward -317 -303 9.5377 0.0606
NP_440906.1_5 Forward -315 -308 15.8704 0.0124
NP_440906.1_5 Reverse -308 -315 15.8704 0.0124
NP_440747.1_10 Forward -319 -307 14.887 0.00223
NP_440747.1_10 Reverse -304 -316 -1.92764 0.0192
NP_441486.1_1 Reverse -304 -318 14.5526 0.00628
NP_441486.1_1 Forward -319 -305 12.8809 0.00979
NP_441880.2_10 Forward -315 -297 9.95058 0.226
NP_440944.1_2 Forward -328 -309 -0.885524 0.259
NP_441265.1_1 Forward -394 -375 -17.0118 0.255
NP_441265.1_6 Forward -175 -156 19.3698 0.105
NP_440403.1_10 Reverse -298 -317 13.6675 0.129
NP_440842.1_10 Reverse -297 -311 2.35953 0.274
NP_442848.1_1 Reverse -301 -315 -4.13031 0.282
NP_442848.1_5 Forward -356 -338 1.88744 0.276
NP_443018.1_3 Forward -315 -308 14.8871 0.0123
NP_443018.1_3 Reverse -308 -315 14.8871 0.0123
NP_441316.1_7 Reverse -305 -320 4.40479 0.131
NP_441634.1_8 Forward -318 -304 -4.7203 0.295
NP_440376.1_1 Forward -316 -307 19.4693 0.000692
NP_440376.1_1 Reverse -307 -316 19.4693 0.000692
NP_440376.1_1 Reverse -300 -309 3.24465 0.206
NP_441588.1_4 Reverse -309 -319 15.9097 0.0369
NP_442730.1_4 Forward -70 -51 23.9203 0.0149
NP_442687.1_7 Reverse -306 -316 18.5646 0.0028
NP_442687.1_7 Forward -317 -307 8.92815 0.0994
NP_442687.1_7 Reverse -83 -93 4.99491 0.225
NP_442687.1_7 Reverse -299 -309 4.20827 0.262
NP_442485.1_3 Reverse -296 -315 3.73603 0.193
NP_441846.1_10 Forward -111 -92 -16.9135 0.256
NP_440571.1_5 Forward -72 -53 16.4207 0.221
NP_441029.1_4 Forward -369 -350 -3.24547 0.283
NP_442658.1_1 Reverse -305 -315 14.8275 0.0188
NP_442658.1_1 Forward -318 -308 6.76441 0.214
NP_442198.1_3 Forward -325 -306 19.2723 0.0623
NP_440141.1_8 Forward -109 -90 4.22769 0.292
NP_442782.1_7 Reverse -299 -318 11.5042 0.104
NP_442496.1_5 Forward -279 -261 22.5369 0.0807
NP_441414.1_9 Reverse -307 -326 6.78429 0.0378
NP_440800.1_7 Reverse -58 -72 12.1926 0.241
NP_442937.1_5 Forward -370 -351 6.29264 0.282
NP_441958.1_5 Reverse -306 -316 20.5312 0.000966
NP_441958.1_5 Forward -317 -307 12.2714 0.00183
NP_441958.1_5 Forward -94 -84 -0.609952 0.215
NP_441958.1_5 Reverse -299 -309 -0.904945 0.222
NP_439905.1_1 Reverse -308 -321 7.29578 0.263
NP_440984.1_7 Forward -321 -307 10.9143 0.122
NP_439990.1_5 Forward -321 -308 17.1289 0.0266
NP_442376.1_2 Reverse -79 -98 -13.4719 0.296
NP_442911.1_2 Forward -326 -307 -3.54046 0.114
NP_442911.1_2 Reverse -366 -385 -6.39206 0.182
NP_440153.1_5 Forward -315 -301 2.5562 0.221
NP_442064.1_1 Forward -321 -302 16.3224 0.0142
NP_442064.1_4 Forward -320 -301 5.11187 0.279
NP_443055.1_6 Forward -316 -298 -2.73484 0.299
NP_440496.1_1 Reverse -207 -226 0.491109 0.289
NP_440602.1_8 Forward -316 -302 18.4858 0.0898
NP_441099.1_5 Forward -326 -307 -0.39387 0.0928
NP_441099.1_5 Reverse -74 -93 -7.08038 0.17
NP_442002.1_9 Reverse -306 -313 14.1004 0.074
NP_442002.1_9 Forward -94 -87 14.1004 0.074
NP_440809.1_9 Forward -325 -307 -7.94566 0.225
NP_441294.1_7 Reverse -303 -317 18.2736 0.00602
NP_441294.1_7 Forward -313 -299 10.9784 0.161
NP_442438.1_10 Reverse -302 -316 10.1277 0.0579
NP_441000.1_6 Forward -317 -303 -4.52363 0.245
NP_442771.1_1 Forward -318 -300 -5.09406 0.166
NP_440147.1_4 Forward -318 -305 11.6223 0.0326
NP_440147.1_4 Forward -95 -82 8.77074 0.0465
NP_440147.1_4 Reverse -305 -318 4.05085 0.173
NP_440147.1_4 Forward -311 -298 0.707601 0.247
NP_441550.1_8 Reverse -305 -315 15.4175 0.0132
NP_441550.1_8 Forward -318 -308 14.6309 0.0132
NP_441550.1_8 Reverse -82 -92 12.6642 0.0325
NP_441550.1_8 Forward -95 -85 11.2876 0.052
NP_441916.1_7 Forward -316 -306 16.893 0.00407
NP_441916.1_7 Reverse -307 -317 10.3048 0.0261
NP_441916.1_7 Forward -385 -375 2.63497 0.246
NP_441916.1_10 Reverse -299 -318 11.1109 0.141
NP_441041.1_4 Reverse -307 -326 1.67108 0.0792
NP_441041.1_7 Reverse -304 -316 13.2483 0.049
NP_441041.1_7 Forward -96 -84 7.51478 0.162
NP_442396.1_5 Forward -320 -307 21.1604 0.00421
NP_442004.1_6 Forward -316 -302 1.76955 0.278
NP_441725.1_5 Forward -315 -305 21.0229 0.00533
NP_441725.1_5 Reverse -308 -318 2.04498 0.115
NP_439966.1_7 Reverse -305 -315 9.12434 0.119
NP_439966.1_7 Forward -318 -308 7.25606 0.15
NP_439966.1_7 Reverse -38 -48 4.89613 0.254
NP_442941.1_3 Forward -315 -305 11.3864 0.0116
NP_442941.1_3 Reverse -308 -318 11.0914 0.0116
NP_440289.1_2 Reverse -304 -317 22.6354 0.00258
NP_440289.1_2 Forward -319 -306 -2.144 0.251
NP_440289.1_2 Forward -96 -83 -4.01229 0.276
NP_440983.1_5 Reverse -310 -329 -4.72043 0.261
NP_441514.1_6 Reverse -26 -33 14.2971 0.248
NP_442281.1_1 Reverse -302 -316 12.2903 0.0385
NP_441334.1_7 Forward -391 -372 -15.3402 0.275
NP_442847.1_3 Forward -314 -295 4.81688 0.279
NP_440437.1_1 Reverse -301 -320 9.24257 0.0525
NP_440437.1_1 Forward -355 -336 5.40766 0.0868
NP_440498.1_1 Reverse -298 -316 -0.669169 0.218
NP_441644.1_6 Reverse -307 -317 17.3841 0.00127
NP_441644.1_6 Forward -316 -306 15.7125 0.0048
NP_441644.1_6 Forward -309 -299 4.30615 0.242
NP_443049.1_6 Forward -94 -84 13.6904 0.149
NP_442215.1_2 Forward -318 -302 23.7563 0.00196
NP_442215.1_2 Reverse -284 -300 -7.0213 0.284
NP_440929.1_8 Forward -316 -307 19.2726 0.000701
NP_440929.1_8 Reverse -307 -316 19.2726 0.000701
NP_442933.1_10 Forward -316 -307 17.601 0.00325
NP_442933.1_10 Reverse -307 -316 17.601 0.00325
NP_442933.1_10 Forward -385 -376 3.7363 0.284
NP_441751.2_8 Forward -315 -301 15.3392 0.0119
NP_441751.2_8 Reverse -308 -322 -4.62196 0.176
NP_441751.2_8 Forward -92 -78 -5.80194 0.239
NP_441751.2_8 Forward -384 -370 -6.09693 0.252
NP_442554.1_8 Reverse -308 -318 15.3197 0.00882
NP_442554.1_8 Forward -315 -305 14.828 0.0108
NP_441762.1_7 Reverse -306 -318 8.9871 0.0142
NP_441762.1_7 Forward -94 -82 -6.2542 0.284
NP_441762.1_7 Forward -317 -305 -6.94252 0.284
NP_442142.1_4 Reverse -304 -317 13.8833 0.0324
NP_442292.1_1 Reverse -308 -317 18.486 0.00229
NP_442292.1_1 Forward -315 -306 9.53783 0.0183
NP_442292.1_5 Forward -320 -301 -0.0988766 0.257
NP_442476.1_6 Reverse -308 -322 4.42448 0.143
NP_440895.1_6 Forward -322 -309 11.7207 0.202
NP_443009.1_5 Forward -317 -306 15.7911 0.0107
NP_443009.1_5 Reverse -306 -317 11.1696 0.066
NP_441715.1_4 Reverse -308 -318 7.94484 0.107
NP_441715.1_4 Forward -315 -305 7.25653 0.108
NP_441715.1_4 Reverse -341 -351 5.5849 0.197
NP_440015.1_9 Forward -316 -298 0.904127 0.247
NP_440183.1_1 Forward -315 -296 9.43923 0.244
NP_441198.1_8 Reverse -305 -315 13.076 0.108
NP_440464.1_10 Reverse -308 -318 13.0082 0.169
NP_441468.1_1 Forward -315 -308 15.8704 0.0124
NP_441468.1_1 Reverse -308 -315 15.8704 0.0124
NP_441673.1_1 Forward -316 -307 20.8459 0.000698
NP_441673.1_1 Reverse -307 -316 20.8459 0.000698
NP_441673.1_1 Reverse -376 -385 -7.76842 0.168
NP_441673.1_1 Forward -385 -376 -8.06341 0.254
NP_441673.1_1 Reverse -300 -309 -8.06341 0.254
NP_440265.1_8 Reverse -359 -377 16.9321 0.174
NP_441876.1_9 Forward -305 -295 14.6309 0.267
NP_441826.1_2 Reverse -301 -315 22.5174 0.00269
NP_441826.1_2 Reverse -78 -92 -0.197071 0.204
NP_441637.1_9 Forward -324 -306 0.0191479 0.292
NP_441764.1_8 Reverse -211 -221 11.1193 0.287
NP_442868.1_6 Forward -318 -308 9.81313 0.038
NP_442868.1_6 Reverse -305 -315 9.22315 0.0527
NP_442868.1_6 Reverse -378 -388 -0.118297 0.264
NP_441251.1_7 Forward -67 -54 15.0639 0.266
NP_441612.1_2 Reverse -307 -317 8.54929 0.21
NP_442427.1_3 Reverse -380 -398 3.55906 0.171
NP_442427.1_8 Forward -325 -306 6.88262 0.227
NP_442808.1_1 Reverse -306 -316 8.73102 0.0481
NP_442808.1_1 Forward -317 -307 8.63269 0.0481
NP_442808.1_1 Forward -310 -300 6.96107 0.0921
NP_442808.1_1 Reverse -199 -209 3.91283 0.218
NP_442808.1_1 Reverse -382 -392 2.14288 0.275
NP_441101.1_4 Forward -234 -215 8.25926 0.214
NP_440145.1_3 Reverse -290 -309 -5.60541 0.273
NP_442718.1_2 Reverse -344 -363 1.0811 0.203
NP_442050.1_5 Reverse -305 -315 15.8108 0.0091
NP_442050.1_5 Forward -318 -308 7.64939 0.243
NP_442342.1_9 Reverse -82 -98 11.9566 0.113
NP_440558.1_2 Reverse -298 -317 -0.0988766 0.198
NP_441878.1_6 Reverse -306 -316 20.2362 0.0046
NP_441878.1_6 Forward -317 -307 10.4031 0.0176
NP_441878.1_6 Reverse -299 -309 2.04498 0.0528
NP_441878.1_6 Forward -386 -376 0.176696 0.147
NP_441878.1_6 Reverse -375 -385 -7.78811 0.266
NP_441036.1_8 Reverse -306 -316 8.4365 0.174
NP_441036.1_8 Forward -317 -307 8.33817 0.174
NP_441036.1_8 Reverse -302 -312 6.56821 0.225
NP_441557.1_5 Forward -316 -307 19.9609 0.000699
NP_441557.1_5 Reverse -307 -316 19.9609 0.000699
NP_441445.1_1 Forward -325 -306 9.83255 0.1
NP_441445.1_1 Reverse -75 -94 7.96426 0.124
NP_441445.1_1 Forward -102 -83 4.32602 0.195
NP_441445.1_1 Reverse -298 -317 2.45773 0.233
NP_442066.2_4 Forward -316 -297 -1.27885 0.187
NP_442066.2_9 Forward -320 -307 11.1307 0.154
NP_442066.2_9 Forward -216 -203 6.90245 0.259
NP_442350.1_1 Forward -329 -310 15.6341 0.278
NP_441564.1_10 Reverse -311 -330 9.24257 0.159
NP_440356.1_2 Forward -215 -196 -2.45882 0.28
NP_441549.1_9 Forward -320 -302 4.83737 0.0925
NP_442347.1_2 Reverse -308 -317 12.4878 0.056
NP_442347.1_2 Reverse -85 -94 3.44131 0.284
NP_442347.1_2 Forward -315 -306 3.34298 0.284
NP_442645.1_2 Reverse -299 -318 -6.58872 0.0908
NP_442645.1_2 Forward -324 -305 -22.42 0.291
NP_442965.1_2 Reverse -207 -226 -8.55534 0.29
NP_441411.1_3 Reverse -358 -377 5.211 0.297
NP_441037.1_4 Reverse -305 -315 9.65667 0.21
NP_441037.1_4 Forward -318 -308 7.9999 0.237
NP_441037.1_4 Reverse -298 -308 7.61007 0.237
NP_441633.1_3 Forward -318 -305 10.5407 0.0286
NP_441633.1_3 Forward -311 -298 -5.88057 0.236
NP_441633.1_3 Forward -351 -338 -7.06055 0.288
NP_440136.1_2 Forward -315 -308 15.9687 0.0123
NP_440136.1_2 Reverse -308 -315 15.9687 0.0123
NP_442590.1_10 Reverse -334 -353 6.78429 0.237
NP_442590.1_10 Forward -316 -297 5.80098 0.258
NP_442590.1_10 Reverse -101 -120 3.44104 0.293
NP_442998.1_8 Reverse -214 -233 22.8114 0.0401
NP_442998.1_10 Forward -314 -307 15.5754 0.0102
NP_442998.1_10 Reverse -309 -316 15.5754 0.0102
NP_442998.1_10 Reverse -86 -93 5.93897 0.206
NP_440899.1_1 Forward -290 -271 7.04116 0.267
NP_440899.1_8 Forward -21 -2 -0.0988766 0.189
NP_440299.1_1 Forward -320 -307 12.9984 0.0319
NP_440299.1_1 Reverse -303 -316 7.09854 0.121
NP_440299.1_1 Forward -248 -235 2.28034 0.292
NP_441799.1_1 Reverse -303 -317 12.2903 0.0441
NP_441799.1_1 Forward -320 -306 9.24208 0.0966
NP_441799.1_4 Forward -364 -345 5.40766 0.0864
NP_441007.1_10 Forward -321 -308 1.29759 0.203
NP_441007.1_10 Reverse -302 -315 1.10092 0.209
NP_442334.1_2 Reverse -297 -314 -13.5308 0.297
NP_442334.1_10 Forward -392 -373 -16.8151 0.282
NP_440256.1_1 Forward -319 -300 -8.85033 0.268
NP_440087.1_1 Reverse -298 -317 -8.752 0.285
NP_440915.1_6 Reverse -296 -310 4.81781 0.0953
NP_440915.1_6 Reverse -303 -317 3.63784 0.101
NP_440915.1_6 Forward -320 -306 1.57289 0.134
NP_440717.1_3 Forward -313 -299 13.1753 0.227
NP_441464.1_8 Reverse -307 -321 3.63784 0.291
NP_440787.1_5 Reverse -318 -332 9.93102 0.256
NP_442993.1_1 Forward -316 -300 2.71347 0.0502
NP_442993.1_1 Reverse -300 -316 -9.47957 0.186
NP_442386.1_9 Forward -317 -308 13.8639 0.0289
NP_442386.1_9 Reverse -306 -315 6.39082 0.219
NP_440570.1_5 Reverse -259 -278 6.58763 0.184
NP_441340.1_5 Forward -315 -308 15.6737 0.0124
NP_441340.1_5 Reverse -308 -315 15.6737 0.0124
NP_441340.1_9 Forward -262 -252 9.12288 0.236
NP_442484.1_2 Forward -327 -308 5.99764 0.159
NP_440168.1_4 Reverse -259 -278 2.85105 0.202
NP_440168.1_9 Reverse -90 -109 -4.72043 0.296
NP_442240.1_2 Forward -243 -224 -15.4385 0.212
NP_442714.1_7 Reverse -308 -327 -2.0655 0.292
NP_440586.1_8 Forward -315 -308 13.2151 0.026
NP_440586.1_8 Reverse -308 -315 13.2151 0.026
NP_442251.1_6 Forward -315 -308 15.2804 0.0124
NP_442251.1_6 Reverse -308 -315 15.2804 0.0124
NP_441262.1_3 Reverse -307 -314 14.7888 0.0223
NP_441262.1_3 Forward -316 -309 14.7888 0.0223
NP_443051.1_1 Reverse -306 -315 18.0926 0.00402
NP_443051.1_1 Forward -317 -308 10.4228 0.00754
NP_443051.1_1 Forward -94 -85 5.40793 0.0926
NP_439984.1_7 Forward -314 -296 -4.79907 0.292
NP_439937.1_9 Forward -310 -293 -10.9749 0.237
NP_439937.1_9 Forward -386 -369 -14.2198 0.287
NP_439937.1_9 Reverse -306 -323 -14.7114 0.287
NP_439937.1_9 Forward -94 -77 -15.1047 0.287
NP_440398.1_2 Reverse -368 -387 5.01433 0.231
NP_439943.1_4 Reverse -101 -120 5.60432 0.284
NP_440372.1_2 Forward -315 -308 16.3621 0.0124
NP_440372.1_2 Reverse -308 -315 16.3621 0.0124
NP_440372.1_2 Forward -92 -85 4.07068 0.262
NP_441138.1_5 Forward -67 -54 8.36957 0.247
NP_440819.1_5 Forward -262 -254 8.08256 0.185
NP_439977.1_5 Forward -322 -303 1.0811 0.196
NP_440139.1_1 Reverse -301 -320 14.8466 0.0474
NP_441572.1_7 Reverse -301 -320 4.916 0.0921
NP_441572.1_7 Reverse -294 -313 -3.24547 0.208
NP_441572.1_7 Forward -355 -336 -5.99873 0.278
NP_440267.1_2 Reverse -302 -316 14.5519 0.105
NP_442384.1_10 Reverse -307 -320 15.8506 0.00946
NP_442384.1_10 Forward -316 -303 9.65572 0.0508
NP_441018.1_7 Forward -320 -301 16.2241 0.092
NP_442262.1_10 Forward -315 -308 14.1988 0.0123
NP_442262.1_10 Reverse -308 -315 14.1988 0.0123
NP_441689.1_5 Reverse -305 -315 8.63269 0.132
NP_441689.1_5 Forward -318 -308 5.78111 0.197
NP_440344.1_10 Reverse -300 -317 -7.13932 0.115
NP_440531.1_6 Reverse -299 -318 -3.3438 0.265
NP_442910.1_1 Reverse -369 -388 0.982764 0.153
NP_440826.1_5 Reverse -299 -317 13.6404 0.274
NP_441965.1_10 Reverse -304 -320 9.69497 0.117
NP_442529.1_7 Forward -295 -276 18.289 0.19
NP_442693.1_7 Forward -290 -271 14.0608 0.202
NP_440297.1_9 Forward -315 -305 19.0562 0.0359
NP_440297.1_9 Reverse -308 -318 -0.118297 0.282
NP_441592.1_4 Forward -316 -297 0.884433 0.227
NP_440999.1_9 Forward -353 -339 12.1926 0.0414
NP_440888.1_2 Forward -316 -302 11.2087 0.0729
NP_440888.1_2 Forward -309 -295 9.83206 0.113
NP_440888.1_2 Reverse -307 -321 8.06211 0.172
NP_442892.1_9 Forward -32 -18 13.4703 0.293
NP_440179.1_6 Reverse -308 -327 7.17762 0.209
NP_440179.1_6 Forward -116 -97 6.4893 0.22
NP_442147.1_7 Reverse -298 -317 12.6841 0.233
NP_441345.1_9 Reverse -376 -395 16.0274 0.125
NP_439969.1_3 Forward -321 -302 -2.16383 0.297
NP_442277.1_8 Forward -47 -28 18.1907 0.107
NP_441123.1_6 Reverse -261 -279 10.3439 0.223
NP_441543.1_2 Reverse -308 -317 16.9127 0.00359
NP_441543.1_2 Forward -315 -306 9.34117 0.0818
NP_442845.1_2 Forward -322 -308 13.2743 0.0955
NP_442845.1_2 Reverse -301 -315 7.76774 0.195
NP_441304.1_10 Forward -396 -387 13.4711 0.241
NP_441469.1_8 Reverse -306 -315 13.3727 0.073
NP_441469.1_8 Forward -317 -308 6.48957 0.227
NP_442315.1_2 Forward -321 -309 9.28209 0.291
NP_443064.1_6 Forward -316 -306 13.8273 0.0796
NP_443064.1_6 Reverse -307 -317 12.5669 0.0796
NP_442578.1_7 Forward -315 -308 14.5921 0.026
NP_442578.1_7 Reverse -308 -315 14.5921 0.026
NP_441462.1_2 Forward -316 -306 20.1379 0.000967
NP_441462.1_2 Reverse -307 -317 11.5831 0.00406
NP_441462.1_2 Forward -93 -83 6.37155 0.069
NP_441462.1_2 Forward -385 -375 -0.708283 0.245
NP_443062.1_1 Reverse -307 -325 9.13097 0.14
NP_443062.1_6 Forward -324 -305 10.2259 0.116
NP_443062.1_6 Reverse -332 -351 7.96426 0.157
NP_441410.1_3 Reverse -298 -317 3.93269 0.295
NP_442204.1_5 Reverse -297 -316 2.75272 0.206
NP_441560.1_8 Forward -321 -302 15.603 0.103
NP_440516.1_8 Forward -316 -307 16.9127 0.00442
NP_440516.1_8 Reverse -307 -316 16.9127 0.00442
NP_440516.1_8 Forward -93 -84 9.24284 0.0264
NP_440516.1_8 Forward -49 -40 -0.196935 0.185
NP_442428.1_4 Forward -317 -298 1.57275 0.291
NP_442428.1_5 Forward -315 -308 15.8704 0.0124
NP_442428.1_5 Reverse -308 -315 15.8704 0.0124
NP_442120.1_8 Forward -173 -154 15.2408 0.134
NP_440673.1_3 Forward -314 -307 12.4288 0.0426
NP_440673.1_3 Reverse -309 -316 12.4288 0.0426
NP_440673.1_3 Reverse -86 -93 10.1672 0.149
NP_440673.1_3 Forward -387 -380 7.41394 0.263
NP_441052.1_2 Reverse -307 -317 19.9412 0.00106
NP_441052.1_2 Forward -316 -306 10.4031 0.0285
NP_442219.1_9 Reverse -308 -317 17.7976 0.00718
NP_442219.1_9 Forward -315 -306 8.25953 0.0681
NP_440436.1_4 Reverse -308 -317 17.2072 0.00233
NP_440436.1_4 Forward -315 -306 15.9289 0.00508
NP_441884.1_9 Reverse -371 -390 -21.4367 0.245
NP_441884.1_9 Reverse -304 -323 -24.9766 0.29
NP_440314.1_9 Reverse -308 -327 18.4857 0.00676
NP_440314.1_9 Forward -315 -296 -5.60541 0.225
NP_440314.1_9 Reverse -377 -396 -7.27704 0.238
NP_441719.1_4 Forward -315 -308 16.3621 0.0124
NP_441719.1_4 Reverse -308 -315 16.3621 0.0124
NP_441733.1_10 Forward -319 -306 5.32916 0.218
NP_441004.1_1 Forward -278 -259 7.37428 0.0897
NP_441004.1_1 Reverse -294 -313 -15.2418 0.273
NP_441004.1_2 Forward -283 -264 0.687771 0.23
NP_441004.1_5 Reverse -296 -310 8.75105 0.27
NP_442366.1_3 Reverse -299 -317 -5.68405 0.292
NP_442366.1_5 Forward -319 -309 15.4175 0.0374
NP_442366.1_5 Forward -96 -86 13.9425 0.0549
NP_442366.1_5 Forward -113 -103 10.206 0.282
NP_439949.1_7 Forward -67 -53 13.6676 0.247
NP_439949.1_7 Forward -368 -354 12.9793 0.257
NP_441115.1_4 Reverse -339 -357 7.78652 0.272
NP_443054.1_2 Reverse -305 -319 3.44117 0.24
NP_443054.1_2 Reverse -298 -312 1.47456 0.245
NP_443054.1_2 Forward -318 -304 0.982901 0.251
NP_441851.1_9 Reverse -343 -362 8.25926 0.267
NP_441851.1_10 Reverse -306 -316 17.4829 0.0027
NP_441851.1_10 Forward -317 -307 15.8113 0.00552
NP_442208.1_5 Reverse -285 -304 -8.06369 0.275
NP_442814.1_2 Reverse -157 -176 5.40766 0.259
NP_442011.1_1 Forward -94 -75 8.25926 0.18
NP_442011.1_1 Forward -317 -298 3.44104 0.239
NP_442856.1_7 Reverse -298 -317 -0.885524 0.211
NP_442515.1_1 Reverse -306 -320 13.2743 0.0278
NP_442515.1_1 Forward -317 -303 4.52282 0.107
NP_440593.1_1 Reverse -341 -360 13.0775 0.298
NP_440593.1_3 Forward -314 -295 -7.4737 0.295
NP_441982.1_6 Reverse -312 -321 12.5809 0.274
NP_440463.1_2 Forward -178 -159 19.8371 0.19
NP_441046.1_2 Forward -327 -308 9.63589 0.221
NP_441349.1_10 Reverse -297 -316 -1.18052 0.0999
NP_441661.1_3 Reverse -377 -394 -5.46769 0.281
NP_441409.1_6 Forward -322 -303 -7.67036 0.154
NP_442843.1_6 Forward -332 -313 3.53937 0.29
NP_440474.1_8 Forward -315 -301 8.3571 0.189
NP_440431.1_3 Reverse -306 -325 2.94938 0.0923
NP_442450.1_5 Reverse -305 -315 19.1546 0.0103
NP_442450.1_5 Forward -318 -308 7.55152 0.13
NP_440588.1_2 Forward -318 -299 -0.295539 0.15
NP_440588.1_2 Reverse -298 -317 -6.49039 0.283
NP_441031.1_10 Forward -21 -2 15.1137 0.262
NP_440195.1_4 Reverse -295 -314 6.29264 0.273
NP_443047.1_7 Forward -315 -296 6.19431 0.228
NP_443047.1_7 Forward -393 -374 3.83436 0.284
NP_442243.1_1 Reverse -294 -312 2.28001 0.204
NP_441570.1_1 Forward -316 -298 -9.0273 0.127
NP_441078.1_4 Forward -316 -307 19.6659 0.0007
NP_441078.1_4 Reverse -307 -316 19.6659 0.0007
NP_441078.1_4 Reverse -300 -309 -1.77023 0.266
NP_442729.1_8 Forward -320 -307 10.639 0.125
NP_441528.1_3 Forward -313 -294 18.7968 0.132
NP_442348.1_2 Forward -394 -385 7.37455 0.28
NP_440707.1_7 Reverse -336 -355 10.7175 0.207
NP_442443.1_1 Reverse -348 -367 -6.58872 0.295
NP_441094.1_6 Reverse -300 -317 17.0493 0.136
NP_440526.1_3 Forward -315 -304 10.8746 0.0646
NP_440526.1_3 Reverse -308 -319 1.04151 0.267
NP_441432.1_8 Forward -317 -308 16.8143 0.00595
NP_441432.1_8 Reverse -306 -315 8.35786 0.0755
NP_441432.1_8 Forward -94 -85 2.55633 0.298
NP_441333.1_1 Forward -20 -10 15.975 0.169
NP_442320.1_2 Forward -247 -228 20.649 0.0806
NP_442320.1_8 Forward -322 -308 -2.36035 0.0871
NP_442320.1_8 Reverse -301 -315 -4.32697 0.159
NP_442344.1_7 Forward -315 -296 3.24438 0.0638
NP_441732.1_2 Reverse -303 -319 -16.3627 0.165
NP_442447.1_6 Reverse -63 -77 17.1415 0.249
NP_440760.1_1 Reverse -307 -326 -12.8819 0.0954
NP_440760.1_1 Reverse -376 -395 -21.1417 0.231
NP_441131.1_9 Reverse -291 -310 11.2092 0.164
NP_440199.1_10 Reverse -304 -314 7.74818 0.231
NP_442353.1_4 Forward -355 -336 0.0970122 0.281
NP_442489.1_7 Forward -316 -307 20.1576 0.000695
NP_442489.1_7 Reverse -307 -316 20.1576 0.000695
NP_442489.1_7 Reverse -300 -309 -1.27858 0.185
NP_442489.1_7 Forward -385 -376 -1.77023 0.247
NP_442079.1_7 Reverse -308 -327 2.75272 0.223
NP_440559.1_1 Reverse -308 -317 17.4043 0.00658
NP_440559.1_1 Forward -315 -306 17.306 0.00658
NP_441659.2_8 Forward -316 -306 19.3512 0.000966
NP_441659.2_8 Reverse -307 -317 18.1713 0.00133
NP_441659.2_8 Forward -309 -299 4.60159 0.13
NP_442913.1_10 Reverse -298 -317 8.45592 0.0477
NP_441040.1_2 Forward -318 -299 -2.95047 0.14
NP_441968.1_1 Forward -262 -254 14.1787 0.286
NP_442346.1_5 Reverse -306 -316 17.9746 0.00128
NP_442346.1_5 Forward -317 -307 16.6963 0.00248
NP_442346.1_5 Forward -245 -235 4.40493 0.29
NP_440545.1_3 Reverse -376 -393 -4.38605 0.224
NP_440545.1_3 Forward -320 -303 -6.451 0.28
NP_440545.1_3 Forward -393 -376 -6.54933 0.283
NP_441856.1_3 Reverse -304 -323 9.24257 0.101
NP_441629.1_1 Reverse -299 -318 7.7676 0.251
NP_440459.1_2 Forward -311 -294 7.217 0.299
NP_440010.1_10 Reverse -295 -314 8.16093 0.219
NP_442603.1_7 Reverse -307 -321 9.43874 0.146
NP_442603.1_7 Forward -93 -79 7.47213 0.205
NP_441948.1_4 Forward -100 -82 -2.0458 0.158
NP_441833.1_4 Forward -315 -308 15.9687 0.0124
NP_441833.1_4 Reverse -308 -315 15.9687 0.0124
NP_442498.1_7 Forward -98 -81 18.5221 0.111
NP_442162.1_9 Forward -315 -308 16.2637 0.0124
NP_442162.1_9 Reverse -308 -315 16.2637 0.0124
NP_440671.1_4 Reverse -301 -315 15.2409 0.0469
NP_442140.1_3 Reverse -308 -318 12.2714 0.0632
NP_442140.1_3 Forward -315 -305 5.68323 0.198
NP_441813.1_5 Reverse -305 -315 16.1063 0.01
NP_441813.1_5 Forward -318 -308 8.63316 0.0367
NP_440590.1_4 Reverse -308 -321 9.85238 0.0331
NP_440590.1_4 Forward -315 -302 -5.78224 0.289
NP_440567.1_1 Forward -315 -301 15.0442 0.0181
NP_440567.1_1 Reverse -308 -322 5.21113 0.105
NP_442497.1_10 Forward -315 -306 19.8626 0.00532
NP_442497.1_10 Reverse -308 -317 10.4228 0.0087
NP_442497.1_10 Reverse -85 -94 0.196389 0.208
NP_440821.1_4 Reverse -305 -315 19.8429 0.00399
NP_440821.1_4 Forward -318 -308 9.41981 0.0286
NP_441239.1_9 Reverse -305 -317 11.7404 0.0551
NP_441239.1_9 Forward -318 -306 6.92215 0.173
NP_441239.1_9 Reverse -82 -94 6.82381 0.175
NP_441239.1_9 Forward -311 -299 6.1355 0.2
NP_441239.1_9 Reverse -38 -50 3.67722 0.279
NP_441951.1_9 Forward -214 -195 -1.47551 0.295
NP_441892.1_1 Reverse -298 -315 -4.68105 0.266
NP_440604.1_6 Forward -244 -225 -5.11376 0.267
NP_442193.1_3 Forward -41 -22 14.5362 0.299
NP_441567.1_1 Forward -301 -282 5.50599 0.186
NP_440546.1_4 Forward -316 -306 12.8578 0.0572
NP_440546.1_4 Reverse -307 -317 10.046 0.109
NP_440675.1_1 Forward -319 -300 11.7992 0.177
NP_440462.1_6 Reverse -305 -315 7.84651 0.0699
NP_440462.1_6 Forward -318 -308 1.35667 0.294
NP_442611.1_1 Forward -316 -297 -2.85214 0.295
NP_440868.1_4 Forward -320 -308 8.10212 0.0602
NP_440868.1_4 Reverse -303 -315 -0.452677 0.269
NP_442402.1_4 Reverse -257 -276 -7.27777 0.272
NP_441084.1_6 Reverse -305 -319 14.4828 0.0972
NP_441084.1_6 Reverse -216 -230 10.8954 0.226
NP_441084.1_6 Reverse -298 -312 9.73195 0.269
NP_442039.1_4 Forward -315 -308 15.1821 0.0124
NP_442039.1_4 Reverse -308 -315 15.1821 0.0124
NP_441180.1_2 Forward -96 -77 12.7089 0.287
NP_441926.1_3 Forward -316 -300 14.2182 0.0488
NP_440825.1_7 Reverse -308 -318 12.9096 0.152
NP_442837.1_3 Forward -315 -308 15.7721 0.0124
NP_442837.1_3 Reverse -308 -315 15.7721 0.0124
NP_440160.1_9 Forward -122 -103 8.75091 0.256
NP_442053.1_1 Forward -316 -307 18.3876 0.0007
NP_442053.1_1 Reverse -307 -316 18.3876 0.0007
NP_442053.1_1 Reverse -84 -93 4.71961 0.228
NP_440505.1_3 Forward -318 -308 9.22315 0.122
NP_440505.1_3 Reverse -305 -315 7.55152 0.151
NP_441203.1_1 Forward -315 -296 -12.5869 0.143
NP_440914.1_1 Reverse -307 -317 17.5935 0.000537
NP_440914.1_1 Forward -316 -306 8.51751 0.186
NP_441011.1_8 Forward -315 -306 14.356 0.0249
NP_441011.1_8 Reverse -308 -317 8.25953 0.144
NP_441011.1_8 Reverse -301 -310 6.29291 0.194
NP_442101.1_10 Forward -324 -305 -8.26035 0.232
NP_442533.1_6 Forward -316 -307 17.2076 0.00137
NP_442533.1_6 Reverse -307 -316 17.2076 0.00137
NP_442533.1_6 Forward -309 -300 5.21127 0.15
NP_442533.1_6 Reverse -376 -385 2.16301 0.27
NP_442229.1_1 Forward -318 -304 6.98048 0.2
NP_441482.1_7 Reverse -301 -315 -8.94853 0.193
NP_439944.1_9 Forward -315 -305 17.3846 0.00516
NP_439944.1_9 Reverse -308 -318 10.5014 0.0887
NP_441028.1_6 Forward -218 -208 5.78111 0.243
NP_441028.1_6 Forward -306 -296 4.10949 0.278
NP_440116.1_8 Forward -315 -296 9.83255 0.0326
NP_440116.1_8 Reverse -308 -327 -5.70374 0.194
NP_441527.1_4 Reverse -16 -35 -2.53096 0.158
NP_441527.1_5 Reverse -305 -324 19.2984 0.169
NP_440115.1_6 Reverse -377 -387 9.81313 0.115
NP_440007.1_9 Reverse -303 -317 9.83269 0.166
NP_441972.1_5 Reverse -308 -327 -0.983855 0.172
NP_441106.1_1 Reverse -306 -315 9.73449 0.0311
NP_441106.1_1 Forward -317 -308 9.63616 0.0311
NP_441420.1_1 Forward -317 -298 3.04771 0.166
NP_441286.1_1 Forward -317 -305 23.9334 0.000767
NP_441286.1_1 Reverse -306 -318 3.48056 0.0467
NP_441286.1_1 Forward -94 -82 -5.36923 0.197
NP_440670.1_8 Forward -316 -307 18.3876 0.000699
NP_440670.1_8 Reverse -307 -316 18.3876 0.000699
NP_441479.1_1 Forward -96 -77 9.24257 0.218
NP_440886.1_7 Reverse -306 -316 8.04271 0.0805
NP_440886.1_7 Forward -317 -307 7.94438 0.0805
NP_440886.1_7 Forward -310 -300 6.66608 0.115
NP_442614.1_2 Forward -316 -302 14.2576 0.104
NP_442614.1_2 Forward -93 -79 14.2576 0.104
NP_442614.1_2 Forward -110 -96 8.16106 0.255
NP_442614.1_2 Reverse -307 -321 8.16106 0.255
NP_442072.1_9 Forward -317 -299 -11.6822 0.0794
NP_442072.1_9 Reverse -299 -317 -12.9605 0.095
NP_442072.1_9 Reverse -306 -324 -20.0404 0.204
NP_440513.1_1 Reverse -374 -393 18.4857 0.15
NP_440513.1_4 Forward -93 -74 20.5506 0.0702
NP_441403.1_4 Reverse -284 -302 6.90232 0.282
NP_440907.2_8 Forward -315 -305 9.81266 0.103
NP_440907.2_8 Reverse -308 -318 7.64939 0.117
NP_440907.2_8 Reverse -85 -95 4.7978 0.243
NP_442264.1_2 Forward -320 -303 6.03703 0.267
NP_441021.1_1 Reverse -308 -327 -8.06369 0.193
NP_440326.1_5 Forward -318 -305 15.2606 0.179
NP_440841.1_4 Reverse -305 -324 -7.27704 0.226
NP_441463.1_3 Forward -326 -307 -8.94866 0.276
NP_441626.1_2 Forward -315 -308 15.7721 0.0124
NP_441626.1_2 Reverse -308 -315 15.7721 0.0124
NP_442794.1_1 Forward -320 -308 9.28209 0.0795
NP_442615.1_1 Forward -325 -307 13.7855 0.0109
NP_442615.1_1 Reverse -298 -316 5.52568 0.0379
NP_441962.1_4 Reverse -302 -321 -14.3569 0.286
NP_440387.1_1 Reverse -307 -323 4.48343 0.0417
NP_440387.1_1 Reverse -376 -392 3.00846 0.0671
NP_440387.1_1 Forward -316 -300 0.451859 0.126
NP_441431.1_2 Reverse -304 -318 7.27547 0.244
NP_441431.1_2 Reverse -81 -95 5.89884 0.284
NP_440814.1_4 Forward -325 -306 -3.14714 0.144
NP_440114.1_10 Forward -316 -302 16.7159 0.0153
NP_440114.1_10 Forward -117 -103 5.70279 0.296
NP_441425.1_4 Forward -263 -249 14.5526 0.282
NP_442437.1_8 Reverse -73 -92 6.78429 0.242
NP_442087.1_2 Reverse -307 -326 17.1812 0.117
NP_439988.1_3 Forward -283 -269 5.1128 0.289
NP_441237.1_9 Reverse -308 -318 14.828 0.0242
NP_439910.1_2 Forward -324 -307 -12.8425 0.103
NP_439910.1_2 Reverse -32 -49 -22.6756 0.285
NP_442867.1_8 Reverse -154 -173 5.89931 0.273
NP_442867.1_8 Reverse -285 -304 4.81767 0.277
NP_440457.1_1 Reverse -303 -315 19.4102 0.0344
NP_440457.1_1 Reverse -372 -384 7.02048 0.105
NP_440457.1_1 Reverse -296 -308 5.44718 0.141
NP_440457.1_1 Reverse -376 -388 1.02229 0.248
NP_440798.1_6 Forward -315 -302 4.73917 0.143
NP_441889.1_4 Reverse -298 -317 9.63589 0.101
NP_442509.1_9 Forward -316 -306 17.3841 0.00128
NP_442509.1_9 Reverse -84 -94 10.796 0.159
NP_442509.1_9 Reverse -307 -317 8.14104 0.192
NP_440554.1_4 Forward -315 -305 6.96153 0.107
NP_441885.1_5 Reverse -307 -317 20.9245 0.000538
NP_441885.1_5 Forward -316 -306 11.3864 0.00668
NP_441614.1_1 Forward -392 -373 13.7658 0.194
NP_442341.1_7 Reverse -306 -320 11.406 0.0555
NP_442341.1_7 Forward -310 -296 8.55439 0.0864
NP_442341.1_7 Forward -317 -303 7.07942 0.111
NP_442341.1_9 Forward -318 -304 9.43874 0.152
NP_441173.1_9 Reverse -164 -172 12.1137 0.21
NP_440423.1_6 Reverse -299 -318 -14.0619 0.224
NP_440423.1_6 Forward -101 -82 -18.3884 0.233
NP_443000.1_7 Forward -318 -308 10.3048 0.0345
NP_443000.1_7 Reverse -305 -315 8.82982 0.0437
NP_440275.1_3 Reverse -305 -315 10.0098 0.0454
NP_440275.1_3 Forward -318 -308 8.04317 0.0602
NP_440091.1_1 Reverse -303 -315 10.8554 0.0429
NP_441359.1_5 Reverse -337 -356 0.884433 0.29
NP_441875.1_10 Forward -301 -287 12.1926 0.242
NP_440216.1_1 Forward -316 -302 17.4042 0.00188
NP_440216.1_1 Reverse -307 -321 -10.5218 0.145
NP_440216.1_1 Reverse -300 -314 -11.4068 0.184
NP_440172.1_1 Forward -316 -306 16.303 0.00854
NP_440172.1_1 Reverse -307 -317 15.0247 0.00945
NP_440172.1_1 Forward -93 -83 4.69992 0.171
NP_442371.1_1 Forward -262 -252 14.3359 0.191
NP_442015.1_10 Reverse -303 -316 1.49425 0.204
NP_442015.1_10 Forward -320 -307 1.39592 0.204
NP_441226.1_7 Forward -315 -308 14.4934 0.0123
NP_441226.1_7 Reverse -308 -315 14.4934 0.0123
NP_441111.1_7 Forward -315 -307 18.7023 0.00294
NP_441111.1_7 Reverse -308 -316 18.7023 0.00294
NP_442379.1_10 Reverse -300 -317 -0.452814 0.223
NP_441766.1_2 Forward -316 -307 17.5026 0.00297
NP_441766.1_2 Reverse -307 -316 17.5026 0.00297
NP_441766.1_2 Reverse -84 -93 4.91628 0.154
NP_443052.1_8 Reverse -297 -316 5.30933 0.0379
NP_440072.1_5 Reverse -292 -310 -0.472507 0.244
NP_442564.1_10 Reverse -291 -305 9.93102 0.296
NP_440261.1_5 Forward -315 -302 -0.865694 0.0655
NP_440261.1_5 Reverse -308 -321 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAGAAGGGGATTTGGTCGCCCGCCCCGCTAATGTGGTCATTTATGCCACCAGTAACCGCCGTCATTTAATTCGCGAATTTTTTGGCGATCGCCCTTCGCCCCAGGATGCTGACGAAGTACAGGCTTGGGACACGGTGCAGGAAAAATTATCCTTTAGTGACCGTTTTGGTTTAACCCTAACTTTTCCGCCGGCTAACCAGGACACGTATTTGATGATAGTACACCACTTGGCTAAACAGGCGCAGATTAATTTATCGGAAACGGAGTTAGATTTCCGGGCTAAACAATGGGCCACCAGGCATAATGGGCGATCAGGCCGCACAGCGAGGCAATTTGTGGATTATTTAATCGGCGAGCAGGGTTTGACTTCCCCTTAACATTTTTCGTTTTAACATCACT

CDS

ATGGATTGGCAACTGTTTGGTCTAAGTTTCATCACCGTTTTTCTAGCGGAAATTGGCGACAAAAGCCAGTTGGCGGCGATCGCCTTGGGGGGAAGTGCCAAATCTCCCCGGGCCGTATTTTTCGGTTCCGTGACGGCATTAATTTTAGCCAGTTTCCTTGGGGTTTTGGCTGGGGGCAGTTTAGCTCAATTTTTGCCGACTAAATTACTCAAAGCATTGGCCGCCTTGGGGTTTACCATCATGGCCCTGCGTTTACTTTGGCCTAACCAAGAAGATTAG

Protein

MDWQLFGLSFITVFLAEIGDKSQLAAIALGGSAKSPRAVFFGSVTALILASFLGVLAGGSLAQFLPTKLLKALAALGFTIMALRLLWPNQED