Your browser is old and dusty. Try Google Chrome!

Details for ssr1513

ORF ssr1513
Accession NP_442372.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -167 -153 -0.0987402 0.221
NP_441061.1_2 Reverse -272 -286 -2.45868 0.293
NP_441812.1_3 Forward -281 -267 11.6026 0.21
NP_441250.1_3 Reverse -205 -224 4.03102 0.252
NP_439979.1_9 Reverse -154 -172 7.29564 0.288
NP_442062.1_8 Forward -280 -270 3.22496 0.279
NP_440044.1_8 Reverse -45 -64 1.0811 0.183
NP_441083.1_5 Reverse -271 -281 -1.10161 0.295
NP_441783.1_3 Forward -314 -295 11.8975 0.219
NP_440747.1_10 Forward -238 -226 -12.2524 0.254
NP_441014.1_8 Forward -238 -219 -5.11376 0.263
NP_442848.1_9 Forward -377 -358 3.34271 0.233
NP_443018.1_3 Forward -144 -137 5.34899 0.212
NP_441316.1_7 Forward -373 -358 5.68309 0.121
NP_440376.1_1 Forward -280 -271 5.21127 0.144
NP_441077.1_6 Reverse -21 -37 2.70546 0.276
NP_441846.1_10 Reverse -226 -245 -15.1435 0.245
NP_441013.1_2 Forward -246 -228 2.28076 0.242
NP_441080.1_7 Reverse -208 -226 7.29487 0.238
NP_441080.1_7 Reverse -1 -19 5.72158 0.296
NP_442658.1_1 Reverse -269 -279 8.53436 0.189
NP_442937.1_5 Reverse -218 -237 6.88262 0.268
NP_442937.1_5 Forward -197 -178 6.29264 0.282
NP_441099.1_5 Forward -172 -153 -6.88371 0.167
NP_442002.1_9 Reverse -270 -277 10.5605 0.214
NP_441654.1_5 Forward -36 -17 16.7729 0.204
NP_441294.1_7 Forward -236 -222 8.67469 0.289
NP_441000.1_5 Reverse -320 -339 8.35677 0.229
NP_440147.1_4 Forward -329 -316 4.93583 0.142
NP_441175.1_7 Forward -97 -78 6.78429 0.248
NP_441916.1_7 Forward -362 -352 3.12662 0.227
NP_441916.1_7 Forward -235 -225 2.43831 0.254
NP_441041.1_4 Forward -377 -358 -8.85033 0.208
NP_440569.1_7 Forward -390 -371 8.55425 0.286
NP_439966.1_7 Reverse -269 -279 6.56775 0.177
NP_442941.1_3 Forward -279 -269 -0.314959 0.256
NP_440260.1_8 Reverse -365 -383 0.0191479 0.202
NP_441514.1_1 Reverse -26 -36 13.5811 0.284
NP_441058.2_6 Reverse -372 -391 13.0775 0.268
NP_440929.1_8 Reverse -271 -280 4.81794 0.176
NP_441751.2_8 Forward -279 -265 -4.13031 0.163
NP_440265.1_7 Forward -65 -51 15.1419 0.253
NP_441826.1_5 Forward -173 -154 1.86774 0.282
NP_441251.1_8 Forward -89 -76 16.3909 0.254
NP_442808.1_1 Forward -236 -226 6.0761 0.131
NP_442808.1_1 Reverse -270 -280 4.89613 0.185
NP_442808.1_1 Reverse -63 -73 1.45457 0.285
NP_441101.1_10 Forward -252 -233 -7.4737 0.29
NP_442718.1_2 Forward -377 -358 -6.98204 0.299
NP_441445.1_1 Reverse -217 -236 2.16274 0.24
NP_440101.1_10 Forward -162 -143 2.75272 0.245
NP_440101.1_10 Reverse -153 -172 2.55606 0.251
NP_442469.1_7 Reverse -357 -376 14.2574 0.282
NP_440440.1_2 Forward -176 -157 13.3716 0.282
NP_442347.1_2 Reverse -272 -281 9.14451 0.0718
NP_441037.1_4 Forward -55 -45 7.61007 0.237
NP_440136.1_2 Forward -279 -272 4.16902 0.234
NP_442998.1_10 Reverse -320 -327 7.21728 0.144
NP_440640.1_6 Reverse -369 -388 -0.688862 0.292
NP_441229.1_1 Forward -172 -157 13.3529 0.25
NP_440915.1_6 Reverse -160 -174 -1.08205 0.22
NP_441464.1_8 Forward -327 -313 3.63784 0.291
NP_440695.1_6 Forward -225 -211 9.92656 0.276
NP_442993.1_1 Reverse -353 -369 -9.97122 0.201
NP_442386.1_9 Reverse -270 -279 10.914 0.111
NP_441750.1_1 Reverse -369 -388 8.06259 0.0978
NP_441160.1_5 Reverse -142 -161 -2.85214 0.288
NP_441595.1_2 Forward -221 -208 19.6376 0.103
NP_441803.1_7 Reverse -121 -140 15.5349 0.158
NP_442368.1_9 Forward -303 -284 22.123 0.121
NP_442384.1_10 Reverse -271 -284 0.805932 0.278
NP_442262.1_10 Forward -144 -137 7.6106 0.274
NP_440163.1_10 Forward -159 -149 8.92815 0.256
NP_440999.1_9 Reverse -358 -372 -1.18038 0.229
NP_440999.1_9 Forward -275 -261 -2.95034 0.281
NP_441543.1_2 Reverse -227 -236 5.21127 0.209
NP_442845.1_2 Reverse -158 -172 3.44117 0.29
NP_442966.1_7 Forward -214 -197 18.639 0.122
NP_441469.1_8 Reverse -270 -279 6.48957 0.227
NP_442578.1_7 Forward -370 -363 6.62729 0.18
NP_440071.1_1 Forward -385 -368 16.361 0.216
NP_443062.1_6 Reverse -218 -237 0.491109 0.294
NP_442204.1_6 Reverse -369 -388 6.98095 0.24
NP_440516.1_2 Forward -241 -223 -1.94747 0.295
NP_441052.1_2 Reverse -226 -236 1.65166 0.233
NP_440436.1_4 Reverse -369 -378 7.07914 0.142
NP_441004.1_1 Reverse -153 -172 -12.1936 0.245
NP_441004.1_1 Reverse -369 -388 -14.1602 0.265
NP_439949.1_7 Reverse -140 -154 10.3243 0.293
NP_441034.1_4 Forward -173 -154 15.2294 0.235
NP_441851.1_10 Reverse -270 -280 11.3864 0.0743
NP_441046.1_2 Reverse -142 -161 -0.39387 0.28
NP_441661.1_3 Forward -159 -142 -6.05768 0.283
NP_440023.1_5 Forward -223 -204 9.3409 0.195
NP_442243.1_1 Forward -174 -156 0.903388 0.223
NP_442038.1_1 Reverse -208 -227 2.26107 0.275
NP_441078.1_4 Reverse -226 -235 -1.47524 0.266
NP_441078.1_4 Reverse -271 -280 -2.06522 0.295
NP_442729.1_8 Forward -69 -56 9.06573 0.125
NP_440707.1_9 Reverse -379 -398 3.24438 0.268
NP_441432.1_9 Reverse -296 -309 11.604 0.221
NP_441432.1_9 Forward -33 -20 10.8284 0.239
NP_442320.1_4 Reverse -71 -90 17.7965 0.266
NP_440760.1_1 Reverse -271 -290 -16.0285 0.163
NP_440913.1_1 Reverse -157 -175 5.91901 0.234
NP_442489.1_7 Forward -235 -226 -1.6719 0.235
NP_441022.1_1 Forward -88 -79 13.6565 0.202
NP_442346.1_5 Forward -54 -44 6.8632 0.188
NP_440459.1_2 Forward -386 -369 10.4619 0.198
NP_442603.1_7 Forward -124 -110 9.43874 0.146
NP_442045.1_5 Reverse -365 -384 -2.45882 0.294
NP_440821.1_4 Reverse -269 -279 -0.216628 0.244
NP_442216.1_4 Forward -150 -142 17.6202 0.23
NP_441848.1_4 Reverse -13 -29 8.41009 0.288
NP_441848.1_7 Reverse -190 -209 -4.22953 0.288
NP_439942.1_2 Forward -229 -210 15.6085 0.228
NP_439942.1_7 Reverse -129 -148 -1.47551 0.242
NP_441252.1_6 Forward -330 -323 14.3954 0.168
NP_442532.1_4 Forward -201 -183 9.12842 0.273
NP_440914.1_1 Reverse -271 -281 11.6404 0.0843
NP_440263.1_5 Forward -222 -208 8.84938 0.294
NP_441482.1_7 Forward -377 -363 -9.24352 0.196
NP_440721.1_9 Reverse -272 -285 20.8648 0.13
NP_440007.1_9 Reverse -267 -281 0.88457 0.29
NP_443045.1_9 Forward -252 -234 8.57317 0.246
NP_442588.1_6 Forward -296 -277 -3.14714 0.296
NP_442306.1_3 Forward -373 -354 14.4541 0.192
NP_441286.1_1 Forward -281 -269 -6.05754 0.245
NP_442674.1_2 Reverse -202 -221 6.88262 0.295
NP_440083.1_1 Forward -289 -270 2.45773 0.265
NP_440907.2_8 Reverse -61 -71 3.8145 0.297
NP_441463.1_3 Forward -122 -103 -4.72043 0.211
NP_442238.1_1 Reverse -159 -178 2.0644 0.222
NP_441962.1_4 Reverse -154 -173 -11.9969 0.25
NP_440114.1_10 Reverse -164 -178 8.84938 0.192
NP_442323.1_7 Forward -354 -335 11.2084 0.141
NP_440422.1_10 Forward -29 -10 10.5011 0.2
NP_440987.1_4 Forward -184 -165 2.75272 0.298
NP_441885.1_5 Reverse -271 -281 0.0783647 0.183
NP_441428.1_8 Reverse -151 -170 2.26107 0.275
NP_442703.1_9 Forward -214 -196 22.5369 0.0381
NP_442341.1_7 Forward -236 -222 12.6843 0.0423
NP_440423.1_10 Forward -300 -281 16.5191 0.168
NP_441902.1_3 Forward -209 -199 13.3704 0.23
NP_440804.1_4 Forward -38 -29 15.4377 0.267
NP_441875.1_8 Reverse -7 -24 23.5399 0.0108
NP_442371.1_2 Reverse -27 -44 24.2272 0.00449
NP_441226.1_7 Reverse -272 -279 8.59356 0.197
NP_441226.1_7 Reverse -159 -166 6.82361 0.246
NP_441111.1_7 Forward -279 -271 -0.570565 0.233
NP_440416.1_9 Reverse -367 -386 -18.6834 0.262
NP_442154.1_1 Forward -288 -270 -17.6804 0.262
NP_442564.1_9 Forward -156 -142 14.6052 0.227
NP_440988.1_10 Reverse -151 -165 6.64146 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGGACTGACAACTTCCACCACTAGCAAGGGCGGTAACATCGATAACCGAATCGTATTGCGTTTAGCTAATTGGGCAATATGCTCTTCTCGAATAATCGTCAAATCAGGAAAACGGTTTTTGGGTTCGCCGTGAACTTCTAGTTCTAAACCGTGTCCCCGTACCCGTCGATAACCGACAATTTCAGCAAATTTGAGCAGTAAAAATGTGGCAATTTGAAAGTTTAAACCCGATTCCGTCGGCACAGCGATTAATTCCCCATTGAATAATTCATAGAGTTGATCAGTATCGTCTTCGTACGCAAGATACTCGTCAAAGCTTTTAAAGCGGGGTTGGAGCGCTAACATAGGCTACCGTTTTCAGAAATAATTAGGCTTTTATTCTAACGATTTAGTAATTTT

CDS

ATGGCGATCGCCAAATTTGAATTTCCCCTGCAAAAGTCAGGGCGACGGCTTTATATTACGGGCTTCTTTGCCCCAAAAGAGTCGGATATTACCGATGTTTTTCCTTTGCAAGCTTTGACAGTGGGGGAAATAGCAGCGGAATATGCGAGAGAACTATTTGCTGGCGATAATTACACCGATTGTCTCTACCCAAAATAG

Protein

MAIAKFEFPLQKSGRRLYITGFFAPKESDITDVFPLQALTVGEIAAEYARELFAGDNYTDCLYPK