Your browser is old and dusty. Try Google Chrome!

Details for ssr1398

ORF ssr1398
Accession NP_442438.1
Symbol rpl33
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L33
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -187 -173 3.63784 0.161
NP_441061.1_2 Forward -235 -221 -1.47537 0.262
NP_440795.1_7 Forward -350 -343 14.6904 0.0123
NP_440795.1_7 Reverse -343 -350 14.6904 0.0123
NP_441418.1_6 Reverse -342 -361 -29.4998 0.228
NP_442291.1_5 Reverse -341 -357 9.10498 0.0541
NP_442291.1_5 Forward -352 -336 -0.826444 0.189
NP_440897.1_6 Reverse -342 -361 1.47364 0.17
NP_441453.1_4 Reverse -342 -350 16.539 0.00633
NP_441453.1_4 Forward -351 -343 16.539 0.00633
NP_441623.1_1 Forward -85 -67 -1.75081 0.241
NP_442151.1_6 Forward -351 -337 11.406 0.101
NP_441818.1_1 Forward -350 -339 18.446 0.0046
NP_441818.1_1 Reverse -343 -354 9.69459 0.232
NP_440226.1_1 Forward -351 -332 3.53937 0.221
NP_440120.1_4 Forward -83 -69 14.9459 0.273
NP_440150.1_6 Forward -354 -335 0.786102 0.296
NP_442173.1_1 Forward -350 -342 15.4574 0.00633
NP_442173.1_1 Reverse -343 -351 15.4574 0.00633
NP_442752.1_4 Forward -351 -344 13.8055 0.0199
NP_442752.1_4 Reverse -342 -349 13.8055 0.0199
NP_443027.1_4 Forward -353 -343 14.828 0.0437
NP_443027.1_4 Reverse -340 -350 11.0914 0.107
NP_440613.1_3 Forward -192 -173 9.93088 0.196
NP_441812.1_3 Reverse -341 -355 9.04604 0.245
NP_441812.1_3 Reverse -89 -103 8.94771 0.248
NP_442975.1_10 Forward -355 -341 13.8636 0.0459
NP_440784.1_7 Forward -350 -343 15.9687 0.0123
NP_440784.1_7 Reverse -343 -350 15.9687 0.0123
NP_441250.1_3 Forward -286 -267 3.93269 0.252
NP_440061.1_9 Forward -353 -339 11.2087 0.116
NP_440061.1_9 Reverse -198 -212 6.88214 0.228
NP_441054.1_2 Forward -86 -67 12.1925 0.244
NP_442062.1_8 Reverse -342 -352 19.4496 0.000558
NP_442062.1_8 Forward -351 -341 17.3846 0.00193
NP_440304.1_4 Forward -353 -343 10.8948 0.051
NP_440304.1_4 Reverse -340 -350 1.84832 0.299
NP_442242.1_4 Forward -350 -343 14.3954 0.0124
NP_442242.1_4 Reverse -343 -350 14.3954 0.0124
NP_440044.1_8 Reverse -343 -362 2.55606 0.149
NP_441581.1_6 Forward -350 -331 13.7525 0.283
NP_442742.1_9 Reverse -278 -297 -13.7669 0.284
NP_440518.1_8 Forward -252 -233 15.3382 0.205
NP_442110.1_7 Reverse -342 -356 1.86788 0.222
NP_442110.1_7 Forward -351 -337 1.08123 0.239
NP_441083.1_5 Forward -351 -341 20.3345 0.00053
NP_441083.1_5 Reverse -342 -352 11.3864 0.0159
NP_441434.1_3 Reverse -108 -127 1.96607 0.194
NP_441434.1_7 Reverse -344 -358 5.89945 0.225
NP_441738.1_2 Forward -349 -342 15.28 0.0102
NP_441738.1_2 Reverse -344 -351 15.28 0.0102
NP_441558.1_5 Reverse -340 -359 3.73603 0.299
NP_440209.1_1 Reverse -342 -350 18.1123 0.00295
NP_440209.1_1 Forward -351 -343 18.1123 0.00295
NP_442889.1_1 Forward -125 -106 -7.08038 0.198
NP_442889.1_1 Forward -99 -80 -14.1602 0.272
NP_442889.1_8 Forward -354 -340 13.5686 0.0588
NP_442889.1_8 Reverse -339 -353 3.34225 0.281
NP_442398.1_1 Reverse -82 -101 17.404 0.0807
NP_441713.1_1 Reverse -336 -355 -5.9004 0.114
NP_441713.1_1 Forward -317 -298 -15.7335 0.27
NP_441770.1_4 Reverse -185 -204 -2.45882 0.188
NP_440178.1_7 Reverse -241 -260 -22.2233 0.258
NP_441989.1_5 Forward -357 -338 15.9796 0.299
NP_442570.1_3 Forward -190 -171 -2.16383 0.212
NP_441716.1_1 Forward -351 -337 13.0776 0.0689
NP_443013.1_3 Reverse -72 -91 3.14605 0.297
NP_442111.1_4 Reverse -341 -355 8.94771 0.0661
NP_440906.1_5 Forward -350 -343 15.8704 0.0124
NP_440906.1_5 Reverse -343 -350 15.8704 0.0124
NP_440747.1_10 Reverse -339 -351 16.8536 0.00143
NP_440747.1_10 Forward -354 -342 -2.02597 0.0196
NP_441130.1_10 Forward -353 -339 19.7641 0.00955
NP_441130.1_10 Reverse -340 -354 6.58777 0.183
NP_441486.1_1 Forward -354 -340 13.2743 0.00871
NP_441486.1_1 Reverse -339 -353 11.3077 0.0164
NP_442634.1_4 Reverse -340 -354 -2.06536 0.149
NP_440842.1_10 Forward -252 -238 2.85119 0.273
NP_442848.1_1 Forward -357 -343 5.21113 0.0859
NP_442848.1_1 Reverse -336 -350 -1.96703 0.263
NP_442848.1_4 Reverse -191 -205 11.0127 0.274
NP_443018.1_3 Forward -350 -343 14.8871 0.0123
NP_443018.1_3 Reverse -343 -350 14.8871 0.0123
NP_441634.1_8 Reverse -340 -354 14.7492 0.0248
NP_441634.1_8 Forward -256 -242 -2.65535 0.295
NP_441634.1_9 Forward -399 -380 8.4551 0.294
NP_440376.1_1 Forward -351 -342 19.4693 0.000692
NP_440376.1_1 Reverse -342 -351 19.4693 0.000692
NP_441588.1_4 Forward -349 -339 8.73149 0.14
NP_441588.1_4 Reverse -344 -354 6.96153 0.178
NP_442687.1_7 Forward -352 -342 15.8113 0.0125
NP_442687.1_7 Reverse -341 -351 8.92815 0.0994
NP_442687.1_7 Forward -11 -1 5.28991 0.211
NP_442191.1_4 Reverse -227 -241 11.5748 0.252
NP_442191.1_4 Reverse -343 -357 10.8961 0.283
NP_442530.1_2 Forward -107 -97 17.2863 0.178
NP_440533.1_9 Forward -351 -332 6.29264 0.19
NP_441763.1_10 Reverse -105 -124 8.84842 0.207
NP_442658.1_1 Forward -353 -343 15.9091 0.00966
NP_442658.1_1 Reverse -340 -350 7.94438 0.199
NP_442782.1_2 Forward -187 -173 2.2612 0.275
NP_442782.1_2 Reverse -116 -130 1.67122 0.281
NP_442782.1_2 Forward -287 -273 1.37622 0.281
NP_442782.1_2 Reverse -342 -356 0.294584 0.291
NP_442205.1_1 Reverse -92 -111 17.7965 0.168
NP_442205.1_9 Reverse -110 -126 -1.71142 0.264
NP_441414.1_9 Reverse -342 -361 1.86774 0.0705
NP_441487.1_9 Forward -352 -333 4.22769 0.15
NP_442937.1_5 Reverse -337 -356 7.7676 0.241
NP_442937.1_5 Forward -127 -108 6.58763 0.275
NP_441958.1_5 Forward -352 -342 12.2714 0.00183
NP_441958.1_5 Reverse -341 -351 12.2714 0.00183
NP_442605.1_4 Reverse -59 -78 9.63589 0.275
NP_441137.1_4 Reverse -226 -245 13.1758 0.0779
NP_442836.1_5 Reverse -336 -355 14.8474 0.0588
NP_440203.1_5 Forward -90 -80 9.91099 0.245
NP_439905.1_1 Forward -181 -168 6.80412 0.275
NP_439990.1_5 Reverse -337 -350 22.0454 0.00173
NP_442690.1_1 Forward -61 -42 -16.1268 0.283
NP_442911.1_2 Forward -361 -342 -2.45882 0.0982
NP_440153.1_5 Reverse -343 -357 10.3243 0.0989
NP_441591.1_10 Forward -247 -228 7.47261 0.275
NP_442064.1_1 Reverse -337 -356 -10.7186 0.259
NP_440602.1_8 Reverse -342 -356 18.4858 0.0898
NP_441348.1_3 Forward -356 -337 6.4893 0.277
NP_441099.1_5 Reverse -332 -351 6.68596 0.0443
NP_442002.1_9 Forward -352 -345 10.7572 0.185
NP_441294.1_7 Forward -355 -341 18.7535 0.0046
NP_442438.1_1 Forward -48 -29 19.8257 0.181
NP_442438.1_10 Forward -356 -342 19.4691 0.0137
NP_441000.1_6 Reverse -341 -355 5.30946 0.0933
NP_441000.1_6 Forward -352 -338 4.91614 0.0933
NP_440147.1_4 Forward -353 -340 11.0324 0.0341
NP_440147.1_4 Reverse -340 -353 7.39411 0.0695
NP_441550.1_8 Reverse -340 -350 15.1225 0.0132
NP_441550.1_8 Forward -353 -343 6.0761 0.214
NP_441916.1_7 Reverse -342 -352 18.4663 0.00144
NP_441916.1_7 Forward -351 -341 10.3048 0.0261
NP_441916.1_7 Forward -400 -390 3.22496 0.223
NP_441041.1_4 Reverse -342 -361 -10.817 0.237
NP_441041.1_7 Forward -354 -342 10.916 0.0864
NP_441041.1_7 Reverse -339 -351 10.8188 0.0864
NP_442396.1_5 Forward -355 -342 5.91914 0.26
NP_440703.1_9 Reverse -110 -123 5.13193 0.293
NP_441725.1_5 Reverse -343 -353 11.2881 0.0247
NP_441725.1_5 Forward -350 -340 2.04498 0.115
NP_439966.1_7 Forward -353 -343 18.4657 0.00473
NP_439966.1_7 Reverse -340 -350 15.3192 0.0152
NP_439966.1_7 Reverse -286 -296 4.60114 0.265
NP_439966.1_9 Forward -353 -344 0.983037 0.253
NP_442941.1_3 Forward -350 -340 19.2529 0.00262
NP_442941.1_3 Reverse -343 -353 11.4848 0.0116
NP_440674.1_3 Forward -187 -168 7.47261 0.199
NP_440289.1_2 Forward -354 -341 21.3571 0.00262
NP_440289.1_2 Reverse -339 -352 5.91914 0.0605
NP_440260.1_8 Forward -122 -104 -7.06068 0.295
NP_442281.1_1 Forward -356 -342 11.7003 0.0438
NP_442281.1_1 Reverse -337 -351 8.3571 0.0823
NP_001035871.2_7 Forward -299 -289 19.2529 0.0547
NP_440437.1_1 Forward -357 -338 7.7676 0.0622
NP_441087.1_6 Reverse -76 -94 2.96833 0.258
NP_441556.1_7 Reverse -277 -296 3.73524 0.263
NP_440498.1_1 Forward -360 -342 -0.7675 0.219
NP_443030.1_4 Reverse -193 -212 -2.16383 0.241
NP_441644.1_6 Forward -351 -341 17.3841 0.00127
NP_441644.1_6 Reverse -342 -352 10.1076 0.0628
NP_442215.1_2 Forward -95 -79 5.6634 0.0775
NP_442215.1_2 Reverse -340 -356 4.87675 0.0815
NP_442215.1_2 Forward -353 -337 -1.41643 0.185
NP_442215.1_2 Forward -387 -371 -5.448 0.25
NP_442177.1_5 Reverse -261 -275 8.45605 0.276
NP_440253.1_2 Forward -351 -333 21.062 0.00457
NP_440253.1_2 Reverse -342 -360 5.62401 0.0906
NP_440929.1_8 Forward -351 -342 19.2726 0.000701
NP_440929.1_8 Reverse -342 -351 19.2726 0.000701
NP_442933.1_10 Forward -351 -342 17.601 0.00325
NP_442933.1_10 Reverse -342 -351 17.601 0.00325
NP_441751.2_8 Forward -350 -336 2.75286 0.0759
NP_441751.2_8 Reverse -343 -357 -1.8687 0.132
NP_442554.1_8 Forward -350 -340 16.2046 0.0065
NP_442554.1_8 Reverse -343 -353 13.8447 0.0145
NP_442167.1_6 Forward -70 -54 10.4809 0.276
NP_441762.1_7 Reverse -341 -353 2.89058 0.0676
NP_441762.1_7 Forward -352 -340 2.39892 0.0676
NP_442142.1_4 Forward -354 -341 15.85 0.0264
NP_442142.1_4 Reverse -339 -352 14.7683 0.0302
NP_442142.1_4 Forward -89 -76 2.18201 0.299
NP_442292.1_1 Forward -350 -341 18.486 0.00229
NP_442292.1_1 Reverse -343 -352 9.63616 0.0183
NP_442476.1_6 Reverse -343 -357 2.16287 0.191
NP_440895.1_3 Forward -183 -164 18.6672 0.165
NP_440895.1_6 Reverse -336 -349 8.86907 0.242
NP_442381.1_8 Forward -354 -335 -13.1769 0.267
NP_443009.1_2 Forward -349 -330 2.26107 0.216
NP_443009.1_5 Reverse -341 -352 18.3477 0.00265
NP_441715.1_4 Forward -350 -340 17.3846 0.0106
NP_441715.1_4 Reverse -343 -353 16.303 0.0117
NP_440379.1_5 Forward -96 -77 -8.65367 0.253
NP_441468.1_1 Forward -350 -343 15.8704 0.0124
NP_441468.1_1 Reverse -343 -350 15.8704 0.0124
NP_441468.1_2 Reverse -173 -187 16.9125 0.252
NP_441468.1_9 Reverse -223 -237 16.4209 0.282
NP_441015.1_8 Reverse -286 -305 7.57094 0.258
NP_441015.1_10 Reverse -168 -187 -11.4069 0.296
NP_441673.1_1 Forward -351 -342 20.8459 0.000698
NP_441673.1_1 Reverse -342 -351 20.8459 0.000698
NP_441876.1_9 Forward -387 -377 11.8776 0.269
NP_441826.1_2 Forward -357 -343 19.6658 0.00847
NP_441826.1_2 Reverse -77 -91 1.76955 0.142
NP_441826.1_2 Reverse -336 -350 -2.55701 0.273
NP_442868.1_6 Reverse -340 -350 19.2529 0.00563
NP_442868.1_6 Forward -353 -343 0.963343 0.205
NP_441612.1_2 Forward -199 -189 12.325 0.21
NP_441612.1_2 Forward -351 -341 8.54929 0.21
NP_442227.1_4 Reverse -285 -304 10.6184 0.287
NP_442808.1_1 Forward -352 -342 18.4657 0.00201
NP_442808.1_1 Reverse -341 -351 8.63269 0.0481
NP_442808.1_1 Forward -243 -233 4.40448 0.199
NP_442808.1_1 Reverse -286 -296 1.94622 0.281
NP_441101.1_10 Reverse -338 -357 -8.06369 0.297
NP_440145.1_3 Reverse -332 -351 23.0089 0.00632
NP_442542.1_2 Forward -353 -340 9.45906 0.134
NP_442050.1_5 Reverse -340 -350 14.3359 0.0206
NP_442050.1_5 Forward -353 -343 9.12434 0.193
NP_440630.1_1 Reverse -224 -243 5.60432 0.263
NP_440346.1_6 Forward -202 -192 13.7586 0.291
NP_441114.1_3 Forward -91 -82 7.66954 0.231
NP_440558.1_2 Reverse -169 -188 0.294447 0.193
NP_440558.1_2 Reverse -333 -352 -2.95047 0.232
NP_440558.1_2 Forward -122 -103 -3.54046 0.236
NP_441878.1_6 Forward -352 -342 10.4031 0.0176
NP_441878.1_6 Reverse -341 -351 10.4031 0.0176
NP_441878.1_6 Reverse -83 -93 -6.70647 0.194
NP_441878.1_6 Forward -93 -83 -7.49312 0.231
NP_441036.1_8 Forward -352 -342 17.7779 0.000554
NP_441036.1_8 Reverse -341 -351 8.33817 0.174
NP_441557.1_5 Forward -351 -342 19.9609 0.000699
NP_441557.1_5 Reverse -342 -351 19.9609 0.000699
NP_441445.1_1 Forward -360 -341 2.0644 0.243
NP_442066.2_4 Reverse -342 -361 -2.45882 0.211
NP_442066.2_9 Reverse -338 -351 8.37742 0.185
NP_441308.1_8 Forward -353 -343 10.1081 0.22
NP_440101.1_3 Forward -130 -111 11.7992 0.0993
NP_442830.1_5 Forward -119 -105 -1.77094 0.299
NP_442183.1_1 Reverse -342 -356 4.42448 0.261
NP_441549.1_9 Reverse -338 -356 -3.91409 0.198
NP_442347.1_2 Forward -350 -341 12.4878 0.056
NP_442347.1_2 Reverse -343 -352 11.1111 0.056
NP_442645.1_2 Reverse -334 -353 -11.9969 0.144
NP_442645.1_2 Forward -217 -198 -15.6352 0.206
NP_441037.1_4 Forward -353 -343 7.02532 0.237
NP_441633.1_3 Reverse -340 -353 10.7374 0.0286
NP_441633.1_3 Forward -353 -340 -3.71729 0.177
NP_440136.1_2 Forward -350 -343 15.9687 0.0123
NP_440136.1_2 Reverse -343 -350 15.9687 0.0123
NP_442590.1_10 Forward -99 -80 9.3409 0.2
NP_442998.1_5 Forward -81 -71 14.533 0.149
NP_442998.1_5 Reverse -65 -75 12.6647 0.162
NP_442998.1_10 Forward -349 -342 15.5754 0.0102
NP_442998.1_10 Reverse -344 -351 15.5754 0.0102
NP_440899.1_2 Forward -247 -228 10.2251 0.169
NP_440299.1_1 Reverse -338 -351 12.0151 0.0427
NP_440299.1_1 Forward -355 -342 8.18017 0.0964
NP_441799.1_1 Forward -355 -341 10.0287 0.0797
NP_441799.1_1 Reverse -338 -352 7.27547 0.147
NP_442333.2_5 Forward -246 -227 -10.817 0.246
NP_440256.1_1 Reverse -339 -358 26.5488 0.00127
NP_440256.1_1 Forward -354 -335 -10.0303 0.293
NP_441559.1_8 Reverse -337 -351 3.73617 0.143
NP_441559.1_8 Forward -316 -302 -0.393733 0.175
NP_440915.1_6 Reverse -338 -352 11.3077 0.0263
NP_440915.1_6 Forward -355 -341 3.63784 0.101
NP_440915.1_6 Forward -129 -115 -1.37704 0.233
NP_442866.1_1 Reverse -221 -240 -8.26035 0.279
NP_440748.1_5 Reverse -112 -131 2.0644 0.224
NP_441464.1_10 Reverse -231 -245 9.93102 0.262
NP_442993.1_1 Forward -125 -109 -5.05468 0.144
NP_442993.1_1 Forward -351 -335 -7.21796 0.146
NP_442993.1_1 Reverse -342 -358 -7.41462 0.146
NP_442386.1_9 Forward -352 -343 15.7322 0.0144
NP_442386.1_9 Reverse -341 -350 13.8639 0.0289
NP_442386.1_9 Forward -183 -174 6.88247 0.219
NP_442386.1_9 Reverse -199 -208 6.29249 0.226
NP_441340.1_5 Forward -350 -343 15.6737 0.0124
NP_441340.1_5 Reverse -343 -350 15.6737 0.0124
NP_440168.1_9 Reverse -225 -244 -5.60541 0.296
NP_440327.1_6 Reverse -254 -273 9.3409 0.206
NP_442506.1_2 Reverse -216 -235 4.71934 0.269
NP_440586.1_8 Forward -350 -343 13.2151 0.026
NP_440586.1_8 Reverse -343 -350 13.2151 0.026
NP_442251.1_6 Forward -350 -343 15.2804 0.0124
NP_442251.1_6 Reverse -343 -350 15.2804 0.0124
NP_440684.1_9 Reverse -343 -357 6.78443 0.29
NP_441262.1_3 Reverse -342 -349 14.7888 0.0223
NP_441262.1_3 Forward -351 -344 14.7888 0.0223
NP_440027.1_3 Forward -351 -333 1.78836 0.295
NP_443051.1_1 Reverse -341 -350 10.4228 0.00754
NP_443051.1_1 Forward -352 -343 10.4228 0.00754
NP_439937.1_9 Forward -352 -335 -8.61494 0.176
NP_439937.1_9 Forward -183 -166 -11.9582 0.269
NP_439937.1_9 Reverse -341 -358 -16.678 0.287
NP_440439.1_1 Reverse -339 -352 1.9859 0.138
NP_440439.1_1 Forward -354 -341 1.19926 0.159
NP_440372.1_2 Forward -350 -343 16.3621 0.0124
NP_440372.1_2 Reverse -343 -350 16.3621 0.0124
NP_439977.1_5 Reverse -336 -355 -0.39387 0.225
NP_440139.1_1 Forward -357 -338 5.40686 0.159
NP_441572.1_7 Reverse -336 -355 -2.85214 0.203
NP_441572.1_7 Forward -357 -338 -3.63879 0.217
NP_440267.1_2 Forward -356 -342 7.47213 0.196
NP_442384.1_10 Forward -351 -338 13.4906 0.0197
NP_442384.1_10 Reverse -342 -355 7.39411 0.0822
NP_442384.1_10 Forward -92 -79 3.95252 0.172
NP_441604.1_4 Reverse -76 -95 -2.95047 0.212
NP_441877.1_7 Forward -246 -227 8.84842 0.206
NP_441018.1_7 Reverse -338 -357 13.7658 0.132
NP_442262.1_10 Forward -350 -343 14.1988 0.0123
NP_442262.1_10 Reverse -343 -350 14.1988 0.0123
NP_441689.1_5 Forward -353 -343 8.53436 0.132
NP_441689.1_5 Reverse -340 -350 5.78111 0.197
NP_440163.1_10 Forward -354 -344 15.2213 0.0762
NP_440163.1_10 Forward -179 -169 8.04317 0.292
NP_440344.1_10 Forward -358 -341 4.07041 0.0253
NP_440344.1_10 Reverse -335 -352 1.90713 0.0294
NP_440562.1_3 Forward -350 -333 14.8868 0.0567
NP_440562.1_10 Reverse -333 -351 11.3272 0.228
NP_441640.1_8 Forward -350 -331 -0.000545616 0.196
NP_440297.1_9 Reverse -343 -353 9.32148 0.0917
NP_440297.1_9 Forward -350 -340 -0.118297 0.282
NP_441592.1_4 Forward -249 -230 -0.39387 0.243
NP_441592.1_4 Forward -351 -332 -0.885524 0.247
NP_441592.1_10 Reverse -67 -81 12.5853 0.294
NP_441896.1_3 Reverse -333 -352 14.4541 0.0587
NP_441103.1_9 Forward -115 -105 12.3919 0.298
NP_440999.1_9 Forward -355 -341 4.62115 0.116
NP_440999.1_9 Reverse -338 -352 2.06454 0.154
NP_440888.1_2 Reverse -342 -356 19.0751 0.00173
NP_440888.1_2 Forward -351 -337 18.3868 0.00256
NP_440888.1_2 Reverse -121 -135 9.14375 0.137
NP_440888.1_2 Forward -209 -195 5.21053 0.288
NP_442033.1_10 Forward -353 -334 10.4225 0.0475
NP_442077.1_9 Reverse -47 -66 -6.09707 0.288
NP_441543.1_2 Reverse -343 -352 18.486 0.00236
NP_441543.1_2 Forward -350 -341 16.9127 0.00359
NP_442845.1_2 Forward -188 -174 3.24451 0.298
NP_441319.1_5 Forward -350 -331 8.06259 0.292
NP_441469.1_8 Forward -352 -343 16.126 0.00797
NP_441469.1_8 Reverse -341 -350 6.48957 0.227
NP_443064.1_6 Forward -351 -341 12.5669 0.0796
NP_442578.1_7 Forward -350 -343 14.5921 0.026
NP_442578.1_7 Reverse -343 -350 14.5921 0.026
NP_441462.1_2 Forward -351 -341 11.5831 0.00406
NP_441462.1_2 Reverse -342 -352 11.5831 0.00406
NP_443062.1_1 Reverse -342 -360 7.96088 0.163
NP_443062.1_1 Reverse -149 -167 4.74314 0.25
NP_443062.1_6 Forward -359 -340 8.55425 0.142
NP_442204.1_1 Reverse -338 -349 2.22195 0.266
NP_442204.1_5 Forward -361 -342 1.47442 0.235
NP_440544.1_5 Forward -306 -299 13.8024 0.28
NP_441351.1_8 Forward -353 -334 5.50599 0.202
NP_441351.1_8 Forward -172 -153 4.12936 0.225
NP_440516.1_8 Forward -351 -342 16.9127 0.00442
NP_440516.1_8 Reverse -342 -351 16.9127 0.00442
NP_442080.1_7 Reverse -79 -98 -1.08219 0.287
NP_442428.1_5 Forward -350 -343 15.8704 0.0124
NP_442428.1_5 Reverse -343 -350 15.8704 0.0124
NP_441443.1_7 Reverse -379 -398 -1.86883 0.268
NP_440673.1_3 Forward -349 -342 12.4288 0.0426
NP_440673.1_3 Reverse -344 -351 12.4288 0.0426
NP_441052.1_2 Forward -351 -341 19.9412 0.00106
NP_441052.1_2 Reverse -342 -352 10.5014 0.0285
NP_442219.1_9 Forward -350 -341 17.7976 0.00718
NP_442219.1_9 Reverse -343 -352 8.35786 0.0681
NP_440436.1_4 Reverse -343 -352 18.1905 0.00233
NP_440436.1_4 Forward -350 -341 17.2072 0.00233
NP_441884.1_9 Forward -354 -335 -22.8133 0.284
NP_441884.1_9 Reverse -379 -398 -23.5016 0.284
NP_442412.1_3 Reverse -324 -343 12.2908 0.248
NP_440314.1_9 Forward -350 -331 7.86593 0.0427
NP_442577.1_5 Forward -362 -343 7.96426 0.233
NP_441719.1_4 Forward -350 -343 16.3621 0.0124
NP_441719.1_4 Reverse -343 -350 16.3621 0.0124
NP_441733.1_10 Reverse -339 -352 9.85238 0.106
NP_441004.1_1 Reverse -155 -174 -5.40875 0.176
NP_442366.1_3 Forward -352 -334 -3.6191 0.253
NP_441115.1_4 Reverse -341 -359 10.6381 0.17
NP_442694.1_4 Reverse -154 -163 14.8477 0.164
NP_442854.1_6 Forward -130 -111 5.50599 0.249
NP_440094.1_9 Reverse -341 -360 -0.983855 0.199
NP_443054.1_2 Reverse -340 -354 10.521 0.0761
NP_443054.1_2 Forward -353 -339 3.44117 0.24
NP_441966.1_7 Forward -305 -286 -2.06626 0.297
NP_441851.1_10 Forward -352 -342 16.008 0.00552
NP_441851.1_10 Reverse -341 -351 15.8113 0.00552
NP_442622.1_6 Reverse -137 -156 5.70265 0.274
NP_442515.1_1 Reverse -341 -355 -5.01529 0.298
NP_440463.1_7 Reverse -285 -299 14.2576 0.296
NP_440165.1_5 Forward -352 -333 -8.06369 0.288
NP_441046.1_2 Forward -104 -85 2.55606 0.24
NP_441349.1_10 Forward -361 -342 -0.000545616 0.0918
NP_441349.1_10 Reverse -332 -351 -1.7705 0.108
NP_441349.1_10 Forward -186 -167 -5.40875 0.201
NP_441409.1_6 Reverse -336 -355 -9.24366 0.18
NP_440474.1_8 Reverse -343 -357 8.3571 0.189
NP_441124.1_5 Forward -107 -97 12.4352 0.221
NP_442450.1_5 Forward -353 -343 9.32148 0.115
NP_440588.1_2 Reverse -333 -352 3.6377 0.0983
NP_442006.1_2 Reverse -382 -399 -15.0058 0.214
NP_441570.1_1 Reverse -342 -360 -7.45401 0.0895
NP_441570.1_1 Forward -311 -293 -10.7973 0.18
NP_441570.1_2 Reverse -295 -313 5.91901 0.267
NP_441078.1_4 Forward -351 -342 19.6659 0.0007
NP_441078.1_4 Reverse -342 -351 19.6659 0.0007
NP_441078.1_4 Forward -118 -109 3.44131 0.14
NP_442348.1_2 Reverse -154 -163 6.68623 0.299
NP_440526.1_3 Forward -350 -339 10.2846 0.0646
NP_440526.1_3 Reverse -343 -354 1.92649 0.267
NP_441432.1_8 Reverse -341 -350 16.8143 0.00595
NP_441432.1_8 Forward -352 -343 8.25953 0.0755
NP_441432.1_8 Reverse -232 -241 4.22796 0.235
NP_441432.1_8 Forward -188 -179 3.24465 0.252
NP_442320.1_8 Reverse -336 -350 6.48943 0.0272
NP_442320.1_8 Forward -357 -343 4.81781 0.0459
NP_442344.1_7 Reverse -343 -362 -0.197208 0.109
NP_441732.1_2 Forward -355 -339 -16.5594 0.174
NP_441732.1_2 Reverse -295 -311 -17.7394 0.292
NP_440760.1_1 Forward -351 -332 -12.5869 0.0942
NP_442797.1_7 Reverse -171 -189 5.32902 0.216
NP_440199.1_10 Forward -354 -344 14.533 0.0861
NP_440199.1_10 Reverse -339 -349 7.25653 0.231
NP_441945.1_10 Reverse -226 -245 8.25926 0.273
NP_442400.1_2 Forward -175 -156 7.7676 0.268
NP_442489.1_2 Forward -362 -343 1.27776 0.293
NP_442489.1_7 Forward -351 -342 20.1576 0.000695
NP_442489.1_7 Reverse -342 -351 20.1576 0.000695
NP_442079.1_7 Forward -399 -380 0.687771 0.275
NP_440559.1_1 Forward -350 -341 17.4043 0.00658
NP_440559.1_1 Reverse -343 -352 8.75118 0.0586
NP_441659.2_8 Forward -351 -341 18.1713 0.00133
NP_441659.2_8 Reverse -342 -352 11.9764 0.0147
NP_441659.2_8 Reverse -349 -359 1.55333 0.238
NP_442913.1_10 Forward -108 -89 -3.83545 0.219
NP_441040.1_2 Reverse -75 -94 -11.8986 0.255
NP_441040.1_5 Forward -356 -337 5.01433 0.241
NP_442776.1_1 Forward -241 -222 5.80098 0.24
NP_442346.1_5 Reverse -341 -351 16.6963 0.00248
NP_442346.1_5 Forward -352 -342 9.02648 0.118
NP_440352.1_5 Forward -90 -71 11.001 0.267
NP_440545.1_3 Reverse -338 -355 -6.64766 0.285
NP_441629.1_1 Forward -359 -340 8.84924 0.235
NP_441923.1_8 Reverse -69 -83 12.9793 0.286
NP_440459.1_2 Reverse -340 -357 7.217 0.299
NP_442603.1_7 Forward -351 -337 11.7003 0.113
NP_441888.1_7 Reverse -337 -351 2.45787 0.225
NP_441888.1_7 Reverse -148 -162 2.45787 0.225
NP_441948.1_4 Forward -358 -340 13.5888 0.0368
NP_441833.1_4 Forward -350 -343 15.9687 0.0124
NP_441833.1_4 Reverse -343 -350 15.9687 0.0124
NP_441895.1_2 Forward -111 -92 -17.7001 0.234
NP_441112.1_3 Reverse -284 -303 11.9958 0.215
NP_442162.1_9 Forward -350 -343 16.2637 0.0124
NP_442162.1_9 Reverse -343 -350 16.2637 0.0124
NP_440671.1_4 Forward -357 -343 15.1426 0.049
NP_440671.1_4 Reverse -336 -350 6.58777 0.243
NP_440224.1_1 Reverse -331 -350 0.982764 0.132
NP_442140.1_3 Forward -350 -340 10.3048 0.0902
NP_442140.1_3 Reverse -343 -353 8.33817 0.119
NP_440875.1_9 Reverse -344 -354 8.37203 0.233
NP_440875.1_9 Forward -299 -289 7.78801 0.255
NP_440875.1_9 Forward -349 -339 7.69067 0.255
NP_441813.1_5 Reverse -340 -350 18.1713 0.00743
NP_441813.1_5 Forward -353 -343 17.188 0.00979
NP_441227.1_7 Forward -350 -331 13.9343 0.271
NP_441227.1_7 Reverse -84 -103 11.8889 0.275
NP_440590.1_4 Forward -350 -337 23.0287 0.00377
NP_440590.1_4 Reverse -343 -356 3.26421 0.0749
NP_440590.1_4 Forward -357 -344 -2.63565 0.247
NP_440567.1_1 Reverse -343 -357 9.63603 0.0422
NP_440567.1_1 Forward -350 -336 0.196253 0.254
NP_442497.1_10 Forward -350 -341 10.4228 0.0087
NP_442497.1_10 Reverse -343 -352 10.4228 0.0087
NP_440821.1_4 Forward -353 -343 19.0562 0.00399
NP_440821.1_4 Reverse -340 -350 9.41981 0.0286
NP_441239.1_9 Forward -353 -341 13.3137 0.037
NP_441239.1_9 Reverse -340 -352 7.80712 0.148
NP_441951.1_9 Forward -399 -380 3.44104 0.254
NP_442897.1_7 Forward -84 -65 16.7157 0.228
NP_440604.1_6 Reverse -116 -135 -4.6221 0.253
NP_442270.1_9 Reverse -79 -98 -6.1954 0.207
NP_442643.1_5 Forward -90 -71 -6.1954 0.293
NP_441017.1_6 Reverse -338 -352 12.2903 0.221
NP_442138.1_10 Reverse -178 -197 -3.3438 0.236
NP_440546.1_4 Reverse -342 -352 11.8882 0.0679
NP_440546.1_4 Forward -351 -341 10.046 0.109
NP_440546.1_4 Reverse -184 -194 7.62206 0.23
NP_440546.1_6 Forward -225 -206 6.4893 0.3
NP_440462.1_6 Forward -353 -343 15.418 0.0142
NP_440462.1_6 Reverse -340 -350 9.61647 0.0429
NP_440868.1_4 Forward -355 -343 8.79043 0.0582
NP_440868.1_4 Reverse -338 -350 1.02229 0.193
NP_440374.1_1 Reverse -265 -284 10.2259 0.292
NP_441848.1_4 Forward -59 -43 15.19 0.154
NP_441848.1_4 Reverse -42 -58 7.26419 0.292
NP_441848.1_7 Forward -286 -267 -1.18128 0.246
NP_440653.1_10 Forward -241 -222 13.2741 0.117
NP_441843.2_9 Reverse -344 -362 9.42214 0.285
NP_442039.1_4 Forward -350 -343 15.1821 0.0124
NP_442039.1_4 Reverse -343 -350 15.1821 0.0124
NP_442837.1_3 Forward -350 -343 15.7721 0.0124
NP_442837.1_3 Reverse -343 -350 15.7721 0.0124
NP_442053.1_1 Forward -351 -342 18.3876 0.0007
NP_442053.1_1 Reverse -342 -351 18.3876 0.0007
NP_440505.1_3 Reverse -340 -350 18.3679 0.00213
NP_440505.1_3 Forward -353 -343 13.8447 0.0247
NP_441252.1_6 Forward -55 -48 14.1004 0.25
NP_441252.1_6 Forward -252 -245 11.6422 0.288
NP_441203.1_6 Forward -353 -334 12.1925 0.0899
NP_440914.1_1 Forward -351 -341 17.5935 0.000537
NP_440914.1_1 Forward -92 -82 10.6645 0.129
NP_440914.1_1 Reverse -342 -352 8.6151 0.186
NP_440914.1_1 Reverse -200 -210 7.15123 0.249
NP_441011.1_8 Reverse -343 -352 16.9127 0.00602
NP_441011.1_8 Forward -350 -341 8.25953 0.144
NP_442533.1_6 Forward -351 -342 17.2076 0.00137
NP_442533.1_6 Reverse -342 -351 17.2076 0.00137
NP_442533.1_6 Forward -92 -83 2.16301 0.27
NP_443016.1_1 Forward -188 -169 -6.68705 0.263
NP_441482.1_7 Forward -357 -343 -8.94853 0.193
NP_441482.1_7 Reverse -336 -350 -10.0302 0.209
NP_439944.1_9 Forward -350 -340 10.5014 0.0887
NP_439944.1_9 Reverse -343 -353 10.3048 0.0887
NP_441028.1_6 Forward -387 -377 5.78111 0.243
NP_441028.1_6 Reverse -282 -292 5.48612 0.255
NP_441028.1_6 Forward -306 -296 4.7978 0.277
NP_441028.1_6 Forward -115 -105 3.42118 0.296
NP_442202.1_10 Forward -183 -169 6.88276 0.255
NP_440116.1_8 Forward -350 -331 7.96426 0.0405
NP_440116.1_8 Reverse -343 -362 -10.1286 0.299
NP_440115.1_6 Reverse -339 -349 6.8632 0.167
NP_440007.1_9 Forward -239 -225 2.94952 0.277
NP_440007.1_9 Reverse -175 -189 1.76955 0.285
NP_440007.1_9 Forward -355 -341 0.982901 0.29
NP_440007.1_9 Reverse -338 -352 0.392915 0.298
NP_442728.1_7 Forward -242 -228 16.0275 0.219
NP_439965.1_1 Forward -360 -341 -9.83364 0.299
NP_441106.1_1 Forward -352 -343 18.191 0.0028
NP_441106.1_1 Reverse -341 -350 9.63616 0.0311
NP_440429.1_4 Forward -106 -87 11.0125 0.299
NP_441825.1_4 Reverse -153 -163 13.8447 0.249
NP_439903.1_6 Forward -128 -109 9.63507 0.12
NP_442588.1_1 Reverse -224 -243 9.24257 0.226
NP_442928.1_4 Forward -300 -286 19.1741 0.117
NP_441286.1_1 Reverse -341 -353 14.4936 0.00418
NP_441286.1_1 Forward -352 -340 3.38223 0.0467
NP_440670.1_8 Forward -351 -342 18.3876 0.000699
NP_440670.1_8 Reverse -342 -351 18.3876 0.000699
NP_440670.1_8 Forward -358 -349 3.53964 0.257
NP_441930.1_1 Forward -122 -103 7.37428 0.235
NP_440886.1_7 Forward -352 -342 17.7774 0.0011
NP_440886.1_7 Reverse -341 -351 7.94438 0.0805
NP_442614.1_2 Reverse -170 -184 12.291 0.165
NP_442614.1_2 Forward -351 -337 5.89945 0.296
NP_442072.1_9 Reverse -341 -359 4.9357 0.0183
NP_442963.1_7 Forward -95 -76 13.2741 0.204
NP_440907.2_8 Reverse -343 -353 7.84605 0.117
NP_442264.1_2 Reverse -163 -180 12.0352 0.173
NP_442264.1_5 Forward -188 -174 11.996 0.253
NP_441463.1_3 Forward -361 -342 -0.4922 0.133
NP_441626.1_2 Forward -350 -343 15.7721 0.0124
NP_441626.1_2 Reverse -343 -350 15.7721 0.0124
NP_442365.1_7 Reverse -338 -357 -2.75381 0.204
NP_442794.1_1 Reverse -338 -350 10.4621 0.0721
NP_442615.1_1 Forward -360 -342 13.0972 0.0119
NP_442615.1_1 Reverse -333 -351 -7.25734 0.283
NP_441962.1_9 Forward -105 -86 4.71934 0.29
NP_440387.1_1 Reverse -342 -358 -2.69473 0.148
NP_441488.1_8 Reverse -337 -351 7.86545 0.221
NP_441993.1_1 Forward -92 -73 8.96362 0.136
NP_441993.1_1 Reverse -77 -96 2.1416 0.262
NP_440143.1_1 Forward -245 -226 13.2741 0.284
NP_440114.1_10 Reverse -342 -356 14.7492 0.0346
NP_442684.1_3 Reverse -20 -39 13.8641 0.254
NP_441510.2_2 Reverse -274 -293 5.50519 0.26
NP_440293.1_3 Forward -189 -170 1.47442 0.207
NP_440293.1_3 Reverse -225 -244 -6.98204 0.296
NP_440766.1_4 Reverse -338 -352 9.04604 0.0871
NP_440766.1_5 Reverse -270 -282 9.08817 0.277
NP_439910.1_2 Forward -359 -342 -3.8944 0.0691
NP_439910.1_2 Reverse -334 -351 -22.184 0.215
NP_440502.1_3 Reverse -244 -254 13.9847 0.278
NP_440457.1_1 Forward -355 -343 9.57708 0.092
NP_440457.1_1 Reverse -338 -350 6.33216 0.123
NP_440798.1_6 Reverse -343 -356 5.32916 0.14
NP_442297.1_4 Forward -355 -336 13.016 0.255
NP_442297.1_10 Reverse -55 -74 13.5691 0.221
NP_441984.1_3 Reverse -73 -91 7.19731 0.255
NP_442509.1_9 Reverse -342 -352 16.2041 0.00739
NP_442509.1_9 Forward -358 -348 8.92768 0.192
NP_442509.1_9 Forward -351 -341 8.14104 0.192
NP_442439.1_10 Forward -48 -29 19.8257 0.188
NP_441610.1_1 Forward -122 -106 18.1514 0.123
NP_441159.1_1 Reverse -219 -238 -1.96717 0.226
NP_440554.1_4 Reverse -343 -353 14.6313 0.02
NP_440554.1_4 Forward -350 -340 8.92815 0.0646
NP_442862.1_3 Reverse -43 -60 10.5603 0.202
NP_442862.1_3 Forward -86 -69 4.56207 0.29
NP_441885.1_5 Forward -351 -341 20.9245 0.000538
NP_441885.1_5 Reverse -342 -352 11.4848 0.00668
NP_442341.1_7 Forward -352 -338 11.2093 0.0567
NP_442341.1_7 Reverse -341 -355 10.0294 0.0682
NP_442341.1_9 Forward -353 -339 5.89884 0.252
NP_442341.1_9 Reverse -176 -190 5.1122 0.279
NP_443000.1_7 Reverse -340 -350 19.9412 0.00223
NP_443000.1_7 Forward -353 -343 8.73149 0.0437
NP_440507.2_3 Reverse -333 -352 10.9134 0.197
NP_442513.1_6 Forward -141 -122 5.99684 0.296
NP_441842.1_10 Forward -358 -344 8.16106 0.233
NP_440275.1_3 Reverse -340 -350 15.123 0.0182
NP_440275.1_3 Forward -353 -343 8.4365 0.0602
NP_442932.1_7 Forward -320 -301 12.2908 0.251
NP_440091.1_1 Forward -355 -343 20.1968 0.00953
NP_440091.1_1 Reverse -338 -350 1.31728 0.198
NP_443010.1_10 Forward -354 -337 13.2072 0.0767
NP_441105.1_3 Reverse -331 -350 -3.44213 0.179
NP_441105.1_3 Reverse -72 -91 -6.49039 0.236
NP_441105.1_3 Forward -256 -237 -9.14533 0.284
NP_440216.1_1 Reverse -342 -356 17.4042 0.00188
NP_440216.1_1 Forward -351 -337 0.196253 0.0284
NP_440172.1_1 Forward -351 -341 15.0247 0.00945
NP_440172.1_1 Reverse -342 -352 8.73149 0.0586
NP_440172.1_1 Reverse -116 -126 4.60159 0.178
NP_440172.1_1 Forward -92 -82 3.22496 0.238
NP_442015.1_10 Reverse -338 -351 12.6056 0.0365
NP_442015.1_10 Forward -355 -342 0.904263 0.216
NP_441226.1_7 Forward -350 -343 14.4934 0.0123
NP_441226.1_7 Reverse -343 -350 14.4934 0.0123
NP_441111.1_7 Forward -350 -342 18.7023 0.00294
NP_441111.1_7 Reverse -343 -351 18.7023 0.00294
NP_442379.1_10 Forward -132 -115 -3.50107 0.263
NP_441766.1_2 Forward -351 -342 17.5026 0.00297
NP_441766.1_2 Reverse -342 -351 17.5026 0.00297
NP_440416.1_1 Forward -351 -332 -11.1119 0.272
NP_440416.1_9 Forward -358 -339 -6.1954 0.0866
NP_440416.1_9 Reverse -76 -95 -10.9153 0.147
NP_443052.1_8 Forward -361 -342 -9.53865 0.193
NP_442226.1_8 Reverse -98 -108 17.3846 0.164
NP_440261.1_5 Forward -350 -337 -4.50394 0.151
NP_440261.1_5 Reverse -343 -356 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTCGACGGCCTAATTGGCCCCTATCCAGAAAGAAAGGATTTATACGAACGGCGATCGCCAGTGAACCATGCAGACCAGCTTACTTGCCCGGTGATTTTCTTCCAGGGCTTGGAGGACAAAGTTGTGCCCCCTAACCAAACGGAAATGATGGTGCAAGCCCTCAAAGCCAAAGGCATTAAGGTGGAATATGTGGCCTTTCCCGAAGAACAACATGGCTTCCGCATGGCCGCCAACATTAAAAAAGCCCTGGAGTCAGAACTTGCTTTCTACGGCGAAGTGTTCGGCTTTACCCCTGCCAAAAATTGACGGCCAATGACCAGGGGCAGATTTTGTCCCAAGACTAATTTGTGCAATAATCAGAGTTTGCGTATAAATTACCGTATTCCTTCCCGCAACAGTT

CDS

ATGGCTAAAAAAGGTAAGGGGGCACGCCTCGTCATCACCCTAGAATGCACCGAGTGCCGCAGTAACCCCGACAAGCGTTCCAATGGCGTTAATCGTTACACCACGATGAAAAATCGTCGTAACACCACCGCCCGGTTGGAACTGAAAAAATTCTGCACCCACTGCAACAAACACACTATCCACAAGGAAACCAAATAA

Protein

MAKKGKGARLVITLECTECRSNPDKRSNGVNRYTTMKNRRNTTARLELKKFCTHCNKHTIHKETK