Your browser is old and dusty. Try Google Chrome!

Details for ssr1391

ORF ssr1391
Accession NP_441452.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -37 -51 0.491246 0.207
NP_440795.1_7 Forward -44 -37 14.6904 0.0123
NP_440795.1_7 Reverse -37 -44 14.6904 0.0123
NP_440795.1_7 Reverse -279 -286 7.80726 0.232
NP_441418.1_6 Forward -396 -377 -29.4015 0.224
NP_441418.1_6 Forward -45 -26 -29.4015 0.224
NP_441418.1_6 Reverse -36 -55 -29.4015 0.224
NP_441418.1_6 Forward -399 -380 -29.4998 0.228
NP_442291.1_5 Forward -46 -30 8.12167 0.0575
NP_441453.1_1 Forward -52 -34 4.54162 0.258
NP_441453.1_4 Reverse -36 -44 16.539 0.00633
NP_441453.1_4 Forward -45 -37 16.539 0.00633
NP_441453.1_4 Reverse -224 -232 7.29591 0.0589
NP_441453.1_4 Forward -233 -225 6.70593 0.121
NP_442151.1_6 Reverse -151 -165 6.19444 0.244
NP_442151.1_6 Reverse -36 -50 5.01447 0.298
NP_441818.1_9 Reverse -257 -276 -10.6203 0.296
NP_440226.1_1 Forward -233 -214 13.5691 0.0352
NP_440226.1_1 Forward -45 -26 8.06259 0.0944
NP_440226.1_1 Reverse -36 -55 2.85105 0.249
NP_442173.1_1 Forward -44 -36 15.4574 0.00633
NP_442173.1_1 Reverse -37 -45 15.4574 0.00633
NP_442173.1_1 Forward -232 -224 7.59091 0.163
NP_442173.1_1 Reverse -225 -233 5.82095 0.2
NP_442752.1_4 Forward -233 -226 13.8055 0.0199
NP_442752.1_4 Forward -45 -38 13.8055 0.0199
NP_442752.1_4 Reverse -36 -43 13.8055 0.0199
NP_443027.1_4 Reverse -34 -44 13.2547 0.0521
NP_443027.1_4 Forward -235 -225 12.3697 0.079
NP_443027.1_4 Forward -47 -37 5.87989 0.294
NP_442975.1_10 Reverse -220 -234 10.717 0.0535
NP_442975.1_10 Forward -49 -35 2.94893 0.266
NP_440784.1_7 Forward -44 -37 15.9687 0.0123
NP_440784.1_7 Reverse -37 -44 15.9687 0.0123
NP_440784.1_7 Reverse -225 -232 6.23397 0.241
NP_440784.1_7 Forward -232 -225 6.13563 0.241
NP_440061.1_9 Reverse -232 -246 14.1586 0.0722
NP_440061.1_9 Forward -47 -33 10.6187 0.124
NP_440061.1_9 Reverse -386 -400 7.07881 0.219
NP_440061.1_9 Forward -221 -207 6.58715 0.239
NP_442062.1_8 Reverse -36 -46 19.4496 0.000558
NP_442062.1_8 Forward -243 -233 11.2881 0.0483
NP_442062.1_8 Forward -45 -35 10.3048 0.0493
NP_442062.1_8 Forward -233 -223 9.61647 0.0587
NP_441859.1_3 Reverse -35 -54 4.71854 0.215
NP_440304.1_4 Reverse -34 -44 10.8948 0.051
NP_440304.1_4 Forward -235 -225 10.1081 0.051
NP_440304.1_4 Reverse -99 -109 1.84832 0.299
NP_440304.1_4 Forward -47 -37 1.84832 0.299
NP_440304.1_10 Forward -232 -214 15.2604 0.189
NP_442242.1_4 Forward -44 -37 14.3954 0.0124
NP_442242.1_4 Reverse -37 -44 14.3954 0.0124
NP_442242.1_4 Forward -232 -225 12.4288 0.0393
NP_440044.1_8 Reverse -225 -244 3.83436 0.125
NP_440044.1_8 Forward -348 -329 3.04771 0.14
NP_440044.1_8 Reverse -37 -56 -2.26216 0.261
NP_439918.1_2 Reverse -251 -270 -3.44213 0.254
NP_441200.1_4 Reverse -172 -191 17.8957 0.146
NP_441935.1_1 Reverse -201 -220 5.70265 0.292
NP_441208.1_9 Forward -48 -34 8.84938 0.219
NP_441594.1_6 Forward -222 -203 6.98095 0.181
NP_441594.1_6 Reverse -39 -58 3.83436 0.225
NP_441594.1_6 Reverse -208 -227 0.786102 0.281
NP_440370.1_10 Forward -54 -35 6.78429 0.283
NP_442110.1_7 Reverse -228 -242 6.48943 0.142
NP_441925.1_4 Forward -276 -257 -11.801 0.253
NP_441925.1_4 Forward -217 -198 -16.2258 0.281
NP_441925.1_4 Forward -279 -260 -16.6192 0.284
NP_441925.1_4 Reverse -211 -230 -17.5041 0.296
NP_441925.1_4 Reverse -72 -91 -17.6025 0.297
NP_440856.1_4 Reverse -29 -48 -1.18052 0.193
NP_441083.1_3 Forward -220 -210 13.9425 0.195
NP_441083.1_3 Reverse -209 -219 13.9425 0.195
NP_441083.1_5 Reverse -36 -46 11.3864 0.0159
NP_441083.1_5 Forward -45 -35 11.2881 0.0159
NP_441083.1_5 Reverse -151 -161 6.76487 0.0775
NP_441083.1_5 Reverse -375 -385 4.40493 0.146
NP_441738.1_2 Reverse -226 -233 15.28 0.0102
NP_441738.1_2 Forward -43 -36 15.28 0.0102
NP_441738.1_2 Reverse -38 -45 15.28 0.0102
NP_441955.1_8 Forward -249 -232 6.62702 0.281
NP_440209.1_1 Reverse -36 -44 18.1123 0.00295
NP_440209.1_1 Forward -45 -37 18.1123 0.00295
NP_440209.1_1 Forward -233 -225 14.8674 0.012
NP_442889.1_8 Reverse -148 -162 9.6354 0.0952
NP_440447.1_1 Reverse -31 -49 3.85406 0.245
NP_440447.1_5 Reverse -170 -180 12.6647 0.291
NP_440447.1_6 Forward -53 -35 1.19912 0.267
NP_441713.1_1 Forward -51 -32 11.7008 0.0344
NP_441713.1_1 Forward -361 -342 -15.6352 0.268
NP_441783.1_2 Reverse -383 -392 17.1093 0.108
NP_442570.1_3 Reverse -255 -274 -5.50708 0.244
NP_441716.1_1 Forward -45 -31 8.25939 0.145
NP_441598.1_1 Reverse -76 -95 7.37428 0.295
NP_442111.1_4 Forward -46 -32 11.701 0.0486
NP_442111.1_4 Reverse -35 -49 7.57108 0.0923
NP_442111.1_4 Reverse -150 -164 2.35953 0.28
NP_440906.1_5 Forward -44 -37 15.8704 0.0124
NP_440906.1_5 Reverse -37 -44 15.8704 0.0124
NP_440906.1_5 Forward -232 -225 12.0355 0.0724
NP_440906.1_5 Reverse -225 -232 12.0355 0.0724
NP_440747.1_10 Reverse -33 -45 17.1486 0.000663
NP_440747.1_10 Forward -48 -36 15.1819 0.00196
NP_440747.1_10 Reverse -221 -233 -12.1541 0.227
NP_440322.1_2 Reverse -34 -52 19.587 0.204
NP_441486.1_1 Forward -48 -34 -3.44199 0.178
NP_441486.1_1 Reverse -33 -47 -3.83532 0.183
NP_441486.1_1 Forward -236 -222 -4.91696 0.213
NP_442850.1_7 Forward -161 -143 10.7364 0.187
NP_442634.1_2 Reverse -30 -49 -0.000545616 0.293
NP_442634.1_4 Reverse -34 -48 7.86607 0.0479
NP_442634.1_4 Forward -47 -33 -1.27871 0.149
NP_440403.1_10 Forward -399 -380 0.884433 0.293
NP_441014.1_10 Forward -362 -343 -3.04956 0.292
NP_442848.1_1 Reverse -334 -348 3.44117 0.133
NP_442848.1_1 Reverse -30 -44 -2.65535 0.263
NP_441012.1_4 Forward -114 -101 7.00078 0.272
NP_443018.1_3 Forward -44 -37 14.8871 0.0123
NP_443018.1_3 Reverse -37 -44 14.8871 0.0123
NP_443018.1_3 Forward -242 -235 8.49558 0.141
NP_443018.1_3 Forward -232 -225 5.34899 0.212
NP_443018.1_3 Reverse -225 -232 5.34899 0.212
NP_441316.1_7 Reverse -34 -49 2.5365 0.154
NP_441316.1_7 Forward -47 -32 -2.97003 0.273
NP_441634.1_8 Forward -351 -337 -0.885388 0.272
NP_441634.1_8 Reverse -34 -48 -2.85201 0.295
NP_440376.1_1 Forward -45 -36 19.4693 0.000692
NP_440376.1_1 Reverse -36 -45 19.4693 0.000692
NP_440376.1_1 Reverse -263 -272 0.983037 0.258
NP_440376.1_1 Reverse -224 -233 -0.000272808 0.285
NP_440376.1_1 Forward -233 -224 -0.0986038 0.285
NP_441588.1_4 Reverse -38 -48 7.35486 0.178
NP_442687.1_7 Forward -46 -36 15.8113 0.0125
NP_442687.1_7 Reverse -35 -45 9.02648 0.0994
NP_442687.1_7 Forward -234 -224 6.46988 0.165
NP_442687.1_7 Forward -398 -388 5.68323 0.189
NP_442485.1_3 Forward -56 -37 -4.81876 0.285
NP_441846.1_10 Forward -398 -379 -15.4385 0.25
NP_440642.1_10 Forward -368 -354 2.8506 0.277
NP_441013.1_2 Forward -272 -254 -3.71743 0.29
NP_441422.1_7 Reverse -34 -51 -2.81276 0.223
NP_441422.1_7 Forward -47 -30 -3.5994 0.235
NP_441422.1_7 Reverse -222 -239 -4.68105 0.247
NP_442296.1_9 Forward -51 -32 -1.86883 0.217
NP_440360.1_4 Forward -218 -199 17.7974 0.158
NP_440360.1_10 Reverse -236 -250 3.73617 0.227
NP_442658.1_1 Forward -47 -37 15.9091 0.00966
NP_442658.1_1 Reverse -34 -44 14.2375 0.0237
NP_442658.1_1 Reverse -222 -232 12.8609 0.0445
NP_442782.1_2 Forward -233 -219 6.3911 0.226
NP_442782.1_2 Forward -45 -31 4.03116 0.257
NP_442782.1_2 Reverse -257 -271 0.786239 0.284
NP_441414.1_9 Reverse -36 -55 -4.32711 0.152
NP_441414.1_9 Forward -45 -26 -4.42544 0.153
NP_440607.1_5 Forward -399 -380 1.57275 0.251
NP_441487.1_9 Forward -234 -215 3.14605 0.163
NP_442300.1_5 Reverse -268 -287 12.0942 0.282
NP_442300.1_10 Forward -54 -35 13.5691 0.247
NP_441256.1_8 Reverse -202 -221 5.89931 0.271
NP_442937.1_5 Forward -389 -370 6.19431 0.286
NP_441958.1_5 Reverse -35 -45 21.2195 0.000805
NP_441958.1_5 Forward -46 -36 12.2714 0.00183
NP_441958.1_5 Forward -234 -224 10.4031 0.0126
NP_441958.1_5 Forward -398 -388 -1.00328 0.227
NP_441127.1_1 Reverse -303 -317 7.57108 0.3
NP_440203.1_5 Reverse -227 -237 11.6809 0.182
NP_440984.1_7 Forward -50 -36 9.34103 0.127
NP_440984.1_7 Reverse -383 -397 5.80112 0.24
NP_442911.1_2 Reverse -26 -45 -0.787193 0.0786
NP_442911.1_2 Forward -55 -36 -4.13045 0.126
NP_440153.1_5 Forward -44 -30 10.7177 0.0916
NP_442119.1_6 Forward -47 -28 12.3892 0.12
NP_442064.1_1 Forward -50 -31 -13.6686 0.297
NP_443055.1_3 Forward -242 -223 14.8467 0.115
NP_443055.1_6 Reverse -158 -176 1.5917 0.227
NP_440993.1_2 Reverse -31 -47 3.10679 0.262
NP_440602.1_2 Forward -50 -31 2.94938 0.263
NP_441099.1_5 Reverse -141 -160 -3.24547 0.131
NP_442002.1_9 Forward -46 -39 10.7572 0.185
NP_441294.1_7 Reverse -147 -161 13.6661 0.0583
NP_441294.1_7 Forward -276 -262 12.2263 0.107
NP_441294.1_7 Reverse -220 -234 9.25063 0.256
NP_441646.1_1 Forward -220 -201 0.786102 0.243
NP_442438.1_10 Forward -50 -36 5.40779 0.134
NP_442438.1_10 Forward -392 -378 4.32615 0.148
NP_442438.1_10 Forward -395 -381 2.5562 0.173
NP_442431.1_10 Reverse -270 -288 4.34571 0.206
NP_442431.1_10 Forward -91 -73 2.0841 0.243
NP_441000.1_6 Forward -234 -220 4.81781 0.0933
NP_441000.1_6 Forward -46 -32 4.71948 0.0933
NP_440484.1_3 Reverse -34 -48 11.406 0.242
NP_440147.1_4 Forward -47 -34 19.6855 0.00258
NP_440147.1_4 Reverse -34 -47 9.06573 0.0437
NP_440147.1_4 Forward -399 -386 6.1158 0.103
NP_441175.1_2 Forward -228 -209 7.66927 0.226
NP_441550.1_8 Reverse -34 -44 15.8108 0.0132
NP_441550.1_8 Forward -47 -37 8.3377 0.124
NP_441916.1_7 Forward -45 -35 18.9579 0.00144
NP_441916.1_7 Reverse -36 -46 18.4663 0.00144
NP_441916.1_7 Reverse -224 -234 10.1081 0.0283
NP_441916.1_7 Forward -233 -223 6.56821 0.0919
NP_441916.1_10 Reverse -99 -118 3.53937 0.229
NP_440465.1_10 Reverse -33 -52 6.39097 0.198
NP_441041.1_4 Reverse -36 -55 7.66927 0.0385
NP_441041.1_7 Forward -48 -36 15.6777 0.0222
NP_441041.1_7 Reverse -33 -45 13.3454 0.0485
NP_441041.1_7 Reverse -221 -233 13.1511 0.0508
NP_442396.1_5 Forward -49 -36 9.36073 0.13
NP_440174.1_2 Reverse -286 -305 12.2908 0.272
NP_442004.1_6 Reverse -36 -50 5.99778 0.181
NP_440703.1_9 Forward -219 -206 11.6217 0.192
NP_440703.1_9 Reverse -211 -224 9.45847 0.216
NP_441725.1_4 Reverse -31 -45 12.9786 0.0693
NP_441725.1_4 Reverse -345 -359 3.8339 0.278
NP_441725.1_5 Reverse -37 -47 2.04498 0.115
NP_441725.1_5 Forward -44 -34 1.94665 0.115
NP_441725.1_5 Reverse -225 -235 1.455 0.135
NP_439966.1_7 Reverse -34 -44 14.3359 0.0203
NP_439966.1_7 Forward -47 -37 9.91099 0.0968
NP_439966.1_7 Forward -235 -225 4.99446 0.248
NP_439966.1_9 Forward -47 -38 0.884706 0.253
NP_440736.1_3 Forward -235 -216 2.55606 0.282
NP_440736.1_3 Forward -169 -150 -0.000545616 0.282
NP_440736.1_10 Forward -220 -202 12.6055 0.293
NP_442941.1_3 Forward -44 -34 19.2529 0.00262
NP_442941.1_3 Reverse -225 -235 10.2065 0.0213
NP_442941.1_3 Reverse -37 -47 2.63497 0.14
NP_442941.1_3 Reverse -341 -351 -1.19994 0.288
NP_440289.1_2 Reverse -385 -398 1.88757 0.112
NP_440289.1_2 Reverse -33 -46 -3.52063 0.267
NP_440289.1_2 Forward -48 -35 -3.71729 0.267
NP_440289.1_2 Reverse -221 -234 -4.79893 0.294
NP_440983.1_9 Reverse -27 -46 0.491109 0.292
NP_440260.1_8 Forward -228 -210 -6.76569 0.295
NP_441514.1_6 Forward -327 -320 12.8221 0.252
NP_442281.1_1 Forward -50 -36 18.5835 0.00414
NP_442281.1_1 Reverse -219 -233 10.9137 0.0525
NP_442281.1_1 Reverse -31 -45 9.24208 0.0726
NP_442281.1_1 Reverse -383 -397 5.21053 0.166
NP_440177.1_1 Forward -310 -292 4.05072 0.28
NP_440437.1_1 Reverse -218 -237 -1.37718 0.201
NP_440437.1_1 Forward -125 -106 -4.03212 0.248
NP_442012.1_1 Reverse -30 -49 0.982764 0.226
NP_440723.1_8 Forward -397 -383 20.5508 0.117
NP_441556.1_7 Forward -283 -264 -0.00131823 0.3
NP_441556.1_10 Forward -50 -36 13.6286 0.178
NP_440498.1_1 Forward -54 -36 5.13236 0.11
NP_442982.1_2 Reverse -12 -30 16.7354 0.177
NP_440375.1_8 Reverse -37 -56 -0.4922 0.266
NP_441644.1_6 Forward -45 -35 19.0557 0.000803
NP_441644.1_6 Reverse -36 -46 10.1076 0.0628
NP_441644.1_6 Reverse -224 -234 7.84605 0.115
NP_441644.1_6 Forward -390 -380 4.99446 0.216
NP_441644.1_6 Reverse -273 -283 4.89613 0.22
NP_441644.1_6 Reverse -151 -161 4.60114 0.233
NP_441644.1_6 Reverse -388 -398 4.40448 0.239
NP_442215.1_2 Forward -162 -146 -0.629782 0.17
NP_442215.1_2 Forward -47 -31 -3.48138 0.216
NP_440253.1_2 Forward -233 -215 -0.669169 0.218
NP_440929.1_8 Forward -45 -36 19.2726 0.000701
NP_440929.1_8 Reverse -36 -45 19.2726 0.000701
NP_440929.1_8 Reverse -388 -397 5.50626 0.132
NP_440929.1_8 Reverse -340 -349 3.04799 0.238
NP_442933.1_10 Forward -45 -36 17.601 0.00325
NP_442933.1_10 Reverse -36 -45 17.601 0.00325
NP_442933.1_10 Forward -233 -224 13.9627 0.0192
NP_442933.1_10 Reverse -224 -233 8.1612 0.0885
NP_441751.2_8 Forward -44 -30 15.9292 0.0109
NP_441751.2_8 Reverse -37 -51 -3.147 0.134
NP_441751.2_8 Reverse -225 -239 -5.50694 0.214
NP_442554.1_8 Forward -44 -34 17.2863 0.00543
NP_442554.1_8 Reverse -37 -47 13.2547 0.0187
NP_442554.1_8 Reverse -225 -235 7.25653 0.0955
NP_441762.1_7 Reverse -35 -47 10.2654 0.0142
NP_441762.1_7 Forward -46 -34 2.30059 0.0676
NP_441762.1_7 Reverse -223 -235 -5.76255 0.238
NP_442142.1_4 Reverse -33 -46 15.4566 0.0264
NP_442142.1_4 Forward -48 -35 14.4733 0.0311
NP_442142.1_4 Forward -285 -272 13.6867 0.0348
NP_442142.1_4 Reverse -221 -234 7.88518 0.127
NP_442142.1_4 Forward -269 -256 7.19687 0.144
NP_442142.1_4 Forward -113 -100 4.64028 0.214
NP_442142.1_4 Reverse -378 -391 2.47701 0.29
NP_442142.1_4 Reverse -381 -394 2.28034 0.295
NP_442292.1_1 Forward -44 -35 17.5026 0.00435
NP_442292.1_1 Reverse -37 -46 9.63616 0.0183
NP_442292.1_1 Reverse -225 -234 7.76787 0.0615
NP_442476.1_6 Reverse -37 -51 13.0776 0.0454
NP_442476.1_6 Forward -44 -30 5.21113 0.139
NP_440895.1_6 Forward -51 -38 10.7374 0.202
NP_441523.1_6 Reverse -32 -51 5.50599 0.238
NP_443009.1_5 Reverse -35 -46 19.626 0.00102
NP_443009.1_5 Forward -234 -223 8.71129 0.102
NP_443009.1_5 Forward -46 -35 7.82632 0.118
NP_443009.1_5 Forward -244 -233 3.79477 0.278
NP_442271.1_6 Reverse -71 -90 16.5191 0.294
NP_441715.1_4 Forward -44 -34 16.7946 0.0106
NP_441715.1_4 Reverse -37 -47 9.41981 0.097
NP_441715.1_4 Forward -232 -222 7.74818 0.108
NP_441715.1_4 Reverse -225 -235 4.50326 0.27
NP_440183.1_9 Reverse -236 -255 -13.7669 0.26
NP_441468.1_1 Forward -44 -37 15.8704 0.0124
NP_441468.1_1 Reverse -37 -44 15.8704 0.0124
NP_441468.1_1 Reverse -225 -232 6.13563 0.209
NP_441468.1_1 Forward -232 -225 6.0373 0.223
NP_441020.2_6 Forward -47 -30 12.4285 0.0949
NP_441020.2_6 Forward -83 -66 7.217 0.237
NP_441015.1_10 Reverse -205 -224 -5.40875 0.223
NP_441015.1_10 Forward -389 -370 -6.39206 0.248
NP_441015.1_10 Reverse -252 -271 -10.6203 0.286
NP_441673.1_1 Forward -45 -36 20.8459 0.000698
NP_441673.1_1 Reverse -36 -45 20.8459 0.000698
NP_441673.1_1 Reverse -224 -233 1.37636 0.114
NP_441673.1_1 Forward -233 -224 1.1797 0.163
NP_442253.1_5 Reverse -207 -224 -1.33779 0.254
NP_441826.1_2 Reverse -30 -44 1.17956 0.161
NP_441826.1_2 Forward -302 -288 -4.4253 0.296
NP_441330.1_1 Reverse -31 -50 5.211 0.0304
NP_442745.1_5 Forward -66 -47 12.6841 0.288
NP_442490.1_9 Reverse -36 -55 -8.85033 0.295
NP_442490.1_10 Forward -220 -202 7.88563 0.286
NP_442868.1_6 Reverse -34 -44 10.4031 0.038
NP_442868.1_6 Forward -47 -37 0.865012 0.205
NP_441056.1_1 Forward -349 -330 -2.16383 0.2
NP_441612.1_2 Forward -175 -165 8.83972 0.21
NP_442808.1_1 Forward -46 -36 18.4657 0.00201
NP_442808.1_1 Reverse -35 -45 8.73102 0.0481
NP_442808.1_1 Reverse -223 -233 8.63269 0.0481
NP_442808.1_1 Reverse -189 -199 6.37109 0.116
NP_442808.1_1 Reverse -78 -88 5.87944 0.137
NP_442808.1_1 Forward -304 -294 4.20782 0.203
NP_441101.1_10 Forward -109 -90 -2.75381 0.242
NP_442775.1_4 Forward -248 -229 14.0608 0.263
NP_440145.1_3 Reverse -26 -45 11.1109 0.0386
NP_440145.1_3 Forward -55 -36 2.94938 0.111
NP_440145.1_3 Reverse -97 -116 -4.03212 0.217
NP_442820.1_3 Forward -279 -269 13.5492 0.277
NP_442542.1_2 Forward -392 -379 9.65572 0.133
NP_442542.1_9 Forward -397 -383 16.5185 0.0619
NP_442542.1_9 Reverse -217 -231 7.76712 0.183
NP_442050.1_5 Reverse -34 -44 15.9091 0.0091
NP_442050.1_5 Forward -351 -341 8.92768 0.206
NP_442050.1_5 Forward -235 -225 8.23937 0.234
NP_442342.1_9 Reverse -295 -311 2.12349 0.29
NP_440558.1_2 Reverse -207 -226 5.80098 0.137
NP_440558.1_2 Forward -222 -203 -0.688862 0.204
NP_440558.1_2 Reverse -27 -46 -0.983855 0.206
NP_440558.1_2 Forward -285 -266 -7.08038 0.287
NP_441878.1_6 Reverse -35 -45 10.5014 0.0176
NP_441878.1_6 Forward -46 -36 10.4031 0.0176
NP_441878.1_6 Reverse -387 -397 0.865012 0.132
NP_441878.1_6 Reverse -143 -153 0.57002 0.14
NP_441878.1_6 Forward -220 -210 0.275027 0.146
NP_441878.1_6 Reverse -209 -219 0.275027 0.146
NP_441878.1_6 Forward -398 -388 0.0783647 0.152
NP_441878.1_6 Reverse -150 -160 -7.49312 0.231
NP_441036.1_8 Forward -46 -36 17.7779 0.000554
NP_441036.1_8 Reverse -223 -233 15.9097 0.00724
NP_441036.1_8 Reverse -35 -45 15.713 0.00724
NP_441557.1_5 Forward -45 -36 19.9609 0.000699
NP_441557.1_5 Reverse -36 -45 19.9609 0.000699
NP_441557.1_5 Forward -233 -224 8.84951 0.0343
NP_441557.1_5 Reverse -224 -233 0.786375 0.106
NP_441445.1_1 Forward -54 -35 7.96426 0.124
NP_441445.1_1 Forward -242 -223 6.98095 0.138
NP_441590.1_4 Reverse -32 -51 3.63691 0.29
NP_441590.1_4 Forward -286 -267 3.04693 0.29
NP_442066.2_4 Reverse -381 -400 -6.49039 0.253
NP_442795.1_5 Forward -45 -26 11.6025 0.149
NP_440101.1_3 Reverse -31 -50 7.57094 0.174
NP_440101.1_3 Reverse -282 -301 5.40766 0.197
NP_440101.1_3 Forward -50 -31 4.52268 0.214
NP_442183.1_1 Reverse -36 -50 9.5377 0.0966
NP_441574.1_1 Forward -57 -38 -1.37718 0.216
NP_441574.1_1 Reverse -95 -114 -7.27704 0.286
NP_441549.1_9 Forward -276 -258 -8.73231 0.237
NP_440540.1_2 Forward -399 -380 6.58763 0.271
NP_442347.1_2 Reverse -37 -46 11.1111 0.056
NP_442347.1_2 Forward -184 -175 6.68623 0.156
NP_442347.1_2 Forward -348 -339 3.83464 0.284
NP_442347.1_2 Forward -44 -35 3.34298 0.284
NP_441597.1_7 Reverse -169 -188 17.994 0.291
NP_442645.1_2 Reverse -28 -47 6.29264 0.0177
NP_442645.1_2 Forward -53 -34 -22.5183 0.291
NP_441037.1_4 Forward -47 -37 14.7245 0.028
NP_441037.1_4 Reverse -34 -44 7.22024 0.237
NP_441037.1_4 Forward -235 -225 6.24566 0.274
NP_441633.1_3 Reverse -34 -47 3.65753 0.0699
NP_441633.1_3 Forward -47 -34 3.36254 0.0699
NP_441633.1_3 Reverse -232 -245 -3.52063 0.177
NP_440136.1_2 Forward -44 -37 15.9687 0.0123
NP_440136.1_2 Reverse -37 -44 15.9687 0.0123
NP_440136.1_2 Reverse -225 -232 6.23397 0.171
NP_440136.1_2 Forward -232 -225 6.13563 0.193
NP_440136.1_2 Reverse -341 -348 4.26735 0.218
NP_442998.1_2 Reverse -69 -88 7.07848 0.25
NP_442998.1_5 Forward -175 -165 14.1397 0.151
NP_442998.1_10 Reverse -226 -233 15.5754 0.0102
NP_442998.1_10 Forward -43 -36 15.5754 0.0102
NP_442998.1_10 Reverse -38 -45 15.5754 0.0102
NP_440731.1_2 Reverse -95 -114 5.80098 0.293
NP_440299.1_1 Forward -49 -36 10.4418 0.0573
NP_440299.1_1 Reverse -32 -45 7.39353 0.113
NP_441799.1_1 Reverse -32 -46 18.1901 0.0089
NP_441799.1_1 Forward -49 -35 17.4035 0.011
NP_441799.1_1 Forward -237 -223 9.14375 0.0988
NP_441007.1_10 Forward -50 -37 3.85419 0.182
NP_441007.1_10 Reverse -31 -44 1.10092 0.209
NP_441007.1_10 Forward -238 -225 1.10092 0.209
NP_441007.1_10 Forward -395 -382 -0.767364 0.293
NP_442334.1_2 Reverse -207 -224 -6.451 0.256
NP_440256.1_1 Reverse -33 -52 0.392778 0.0847
NP_440256.1_1 Forward -48 -29 -0.4922 0.0936
NP_440256.1_1 Forward -400 -381 -2.0655 0.112
NP_440256.1_1 Forward -236 -217 -3.04881 0.126
NP_440256.1_1 Reverse -221 -240 -9.44032 0.28
NP_440087.1_1 Forward -252 -233 -1.86883 0.197
NP_440087.1_1 Reverse -27 -46 -1.96717 0.197
NP_442007.1_8 Reverse -380 -398 12.4081 0.258
NP_441512.1_4 Reverse -32 -51 9.73422 0.237
NP_441559.1_8 Reverse -31 -45 8.75105 0.0676
NP_441559.1_8 Reverse -229 -243 1.17956 0.156
NP_441559.1_8 Forward -40 -26 -4.03198 0.215
NP_441559.1_8 Reverse -171 -185 -6.49025 0.279
NP_441559.1_8 Forward -50 -36 -7.08024 0.283
NP_440915.1_6 Reverse -32 -46 7.86607 0.0637
NP_440915.1_6 Forward -49 -35 5.01447 0.0943
NP_440915.1_6 Reverse -220 -234 1.08123 0.147
NP_440915.1_6 Reverse -384 -398 0.88457 0.151
NP_442785.1_7 Reverse -34 -48 10.0294 0.231
NP_442069.1_4 Reverse -213 -232 22.4189 0.0396
NP_442452.1_7 Reverse -324 -343 15.8307 0.215
NP_442866.1_1 Reverse -282 -301 -7.17871 0.264
NP_442866.1_1 Forward -50 -31 -7.86702 0.271
NP_440748.1_5 Forward -300 -281 13.3725 0.0995
NP_442031.1_5 Reverse -268 -287 13.2741 0.157
NP_440537.1_4 Forward -262 -243 17.404 0.271
NP_441464.1_8 Forward -276 -262 4.12949 0.283
NP_440306.1_8 Forward -31 -12 -0.197979 0.211
NP_440695.1_5 Reverse -36 -55 9.83255 0.15
NP_441199.1_6 Reverse -67 -86 10.8159 0.0743
NP_439985.1_7 Reverse -204 -223 4.52268 0.235
NP_442993.1_1 Forward -233 -217 -6.03799 0.146
NP_442993.1_1 Reverse -36 -52 -10.8562 0.229
NP_442993.1_1 Reverse -144 -160 -11.7412 0.257
NP_442993.1_1 Reverse -158 -174 -13.0195 0.283
NP_440677.1_6 Forward -335 -316 8.35759 0.277
NP_442386.1_9 Forward -46 -37 15.7322 0.0144
NP_442386.1_9 Reverse -339 -348 8.94741 0.178
NP_442386.1_9 Reverse -223 -232 7.07914 0.219
NP_442386.1_9 Reverse -35 -44 6.39082 0.219
NP_442386.1_9 Reverse -356 -365 6.29249 0.226
NP_440570.1_5 Forward -270 -251 2.3594 0.234
NP_441750.1_1 Reverse -108 -127 -7.4737 0.265
NP_441340.1_5 Forward -44 -37 15.6737 0.0124
NP_441340.1_5 Reverse -37 -44 15.6737 0.0124
NP_441340.1_5 Forward -232 -225 6.13563 0.175
NP_441340.1_5 Reverse -225 -232 5.93897 0.198
NP_442484.1_2 Forward -56 -37 -0.000545616 0.254
NP_442791.1_5 Forward -193 -174 -10.7186 0.281
NP_442240.1_2 Forward -44 -25 -20.7484 0.295
NP_440161.1_3 Reverse -222 -241 8.65258 0.268
NP_440586.1_1 Forward -400 -381 2.85105 0.219
NP_440586.1_8 Forward -44 -37 13.2151 0.026
NP_440586.1_8 Reverse -37 -44 13.2151 0.026
NP_440586.1_8 Forward -232 -225 11.4451 0.0645
NP_440586.1_8 Forward -305 -298 7.1186 0.272
NP_440586.1_8 Forward -152 -145 7.02027 0.279
NP_440586.1_8 Reverse -274 -281 5.8403 0.283
NP_442251.1_6 Forward -44 -37 15.2804 0.0124
NP_442251.1_6 Reverse -37 -44 15.2804 0.0124
NP_442251.1_6 Reverse -225 -232 12.0355 0.0627
NP_440684.1_9 Forward -51 -37 7.07942 0.28
NP_441262.1_1 Reverse -347 -365 16.6371 0.199
NP_441262.1_3 Reverse -36 -43 14.7888 0.0223
NP_441262.1_3 Forward -233 -226 14.7888 0.0223
NP_441262.1_3 Forward -45 -38 14.7888 0.0223
NP_440027.1_3 Forward -282 -264 9.35981 0.184
NP_440027.1_3 Reverse -378 -396 7.29487 0.211
NP_440027.1_3 Reverse -26 -44 6.60656 0.225
NP_440027.1_3 Reverse -70 -88 5.81991 0.236
NP_440027.1_3 Forward -243 -225 4.73828 0.253
NP_443051.1_1 Reverse -35 -44 19.5676 0.00335
NP_443051.1_1 Forward -46 -37 10.4228 0.00754
NP_443051.1_1 Forward -234 -225 9.93116 0.0146
NP_439937.1_9 Forward -283 -266 -10.9749 0.237
NP_439937.1_9 Reverse -35 -52 -16.2847 0.287
NP_441595.1_3 Forward -394 -384 17.5813 0.202
NP_440408.1_7 Forward -219 -200 6.88262 0.298
NP_440439.1_1 Reverse -33 -46 18.1122 0.0105
NP_440439.1_1 Forward -236 -223 9.65572 0.0447
NP_440439.1_1 Forward -48 -35 8.27909 0.0547
NP_440372.1_2 Forward -44 -37 16.3621 0.0124
NP_440372.1_2 Reverse -37 -44 16.3621 0.0124
NP_440372.1_2 Forward -232 -225 6.72562 0.0929
NP_440372.1_2 Reverse -225 -232 6.62729 0.151
NP_440819.1_5 Forward -176 -168 7.98423 0.228
NP_440819.1_5 Forward -175 -167 7.68924 0.266
NP_440316.1_10 Reverse -100 -110 7.15819 0.251
NP_441803.1_2 Forward -218 -199 2.75272 0.204
NP_441803.1_2 Reverse -376 -395 1.76941 0.226
NP_439977.1_5 Reverse -334 -353 -1.08219 0.241
NP_440210.1_8 Reverse -381 -397 7.04003 0.294
NP_441572.1_7 Forward -51 -32 5.70265 0.0867
NP_441572.1_7 Reverse -257 -276 -2.0655 0.19
NP_441572.1_7 Reverse -30 -49 -4.91709 0.245
NP_440267.1_2 Reverse -31 -45 20.5501 0.00946
NP_440267.1_2 Forward -266 -252 5.60385 0.261
NP_442384.1_10 Forward -45 -32 17.9155 0.00564
NP_442384.1_10 Reverse -36 -49 13.884 0.018
NP_442384.1_10 Reverse -224 -237 11.229 0.0372
NP_442384.1_10 Reverse -96 -109 3.36254 0.193
NP_442384.1_10 Reverse -151 -164 2.2809 0.23
NP_442384.1_10 Reverse -263 -276 0.904263 0.275
NP_442384.1_10 Reverse -204 -217 0.60927 0.286
NP_440948.1_4 Reverse -72 -91 11.9958 0.208
NP_442114.1_5 Reverse -200 -219 16.1257 0.14
NP_440699.1_2 Reverse -194 -213 18.0924 0.286
NP_441877.1_7 Reverse -31 -50 3.04693 0.218
NP_441018.1_7 Reverse -253 -272 9.63589 0.22
NP_442262.1_10 Forward -44 -37 14.1988 0.0123
NP_442262.1_10 Reverse -37 -44 14.1988 0.0123
NP_442262.1_10 Forward -242 -235 8.59391 0.22
NP_441689.1_5 Reverse -34 -44 8.3377 0.132
NP_441689.1_5 Forward -235 -225 8.23937 0.142
NP_440163.1_10 Forward -92 -82 10.9931 0.18
NP_440163.1_10 Reverse -290 -300 8.4365 0.274
NP_440163.1_10 Forward -393 -383 7.84651 0.299
NP_440163.1_10 Reverse -104 -114 7.84651 0.299
NP_440344.1_10 Forward -52 -35 1.31714 0.0311
NP_440344.1_10 Reverse -144 -161 -10.5809 0.185
NP_440531.1_6 Forward -241 -222 12.3892 0.051
NP_440531.1_6 Reverse -380 -399 -1.37718 0.231
NP_440531.1_6 Forward -96 -77 -3.14714 0.262
NP_442832.1_3 Forward -366 -347 11.6025 0.293
NP_441965.1_10 Reverse -33 -49 11.7599 0.107
NP_442693.1_6 Reverse -73 -92 -0.4922 0.29
NP_440297.1_9 Reverse -37 -47 -0.118297 0.282
NP_440297.1_9 Forward -44 -34 -0.216628 0.282
NP_440297.1_9 Reverse -225 -235 -0.511621 0.289
NP_442280.1_10 Forward -44 -26 8.08424 0.268
NP_441896.1_3 Reverse -225 -244 2.65439 0.189
NP_440894.1_10 Reverse -146 -165 2.3594 0.29
NP_440999.1_2 Reverse -102 -121 15.2408 0.155
NP_440999.1_9 Forward -49 -35 7.47274 0.086
NP_440999.1_9 Reverse -220 -234 -0.590395 0.212
NP_440888.1_2 Forward -45 -31 12.487 0.0442
NP_440888.1_2 Reverse -381 -395 6.29216 0.241
NP_440888.1_2 Forward -397 -383 5.21053 0.288
NP_440600.1_4 Forward -367 -349 -5.29072 0.276
NP_440052.1_5 Forward -56 -37 -2.36049 0.212
NP_439969.1_3 Reverse -229 -248 -1.37718 0.278
NP_439969.1_3 Forward -50 -31 -2.16383 0.297
NP_442033.1_10 Forward -245 -226 -2.26216 0.149
NP_442871.1_4 Forward -280 -261 -9.53937 0.283
NP_441543.1_2 Reverse -37 -46 18.486 0.00236
NP_441543.1_2 Forward -44 -35 15.9293 0.00518
NP_441543.1_2 Reverse -225 -234 6.19458 0.153
NP_441543.1_2 Forward -232 -223 5.99792 0.159
NP_442845.1_2 Forward -51 -37 7.17775 0.198
NP_442845.1_2 Reverse -25 -39 4.12949 0.267
NP_441304.1_10 Forward -327 -318 13.0777 0.255
NP_441551.1_5 Forward -49 -33 10.2842 0.193
NP_441469.1_8 Forward -46 -37 16.126 0.00797
NP_441469.1_8 Reverse -35 -44 6.5879 0.227
NP_442637.1_10 Forward -344 -325 10.1275 0.186
NP_443064.1_6 Forward -45 -35 10.8217 0.13
NP_442578.1_7 Forward -44 -37 14.5921 0.026
NP_442578.1_7 Reverse -37 -44 14.5921 0.026
NP_442578.1_7 Forward -232 -225 5.93897 0.183
NP_440710.1_1 Reverse -28 -46 -1.65248 0.185
NP_441462.1_2 Forward -45 -35 20.2362 0.000805
NP_441462.1_2 Reverse -36 -46 11.5831 0.00406
NP_441462.1_2 Forward -233 -223 1.16001 0.0976
NP_441462.1_2 Reverse -224 -234 0.766681 0.125
NP_441462.1_2 Forward -160 -150 -1.29827 0.299
NP_441621.1_7 Reverse -271 -285 4.62115 0.0934
NP_441621.1_7 Forward -47 -33 4.22782 0.0934
NP_441621.1_7 Reverse -34 -48 -3.24533 0.188
NP_443062.1_1 Forward -45 -27 15.859 0.0346
NP_443062.1_1 Reverse -36 -54 15.3714 0.0385
NP_443062.1_1 Forward -233 -215 4.06059 0.276
NP_443062.1_6 Forward -241 -222 2.94938 0.247
NP_441410.1_3 Reverse -27 -46 4.81767 0.261
NP_442204.1_1 Reverse -32 -43 11.3667 0.0565
NP_442204.1_1 Forward -237 -226 7.63016 0.123
NP_442204.1_1 Reverse -346 -357 4.68023 0.242
NP_442204.1_1 Reverse -103 -114 3.20526 0.266
NP_442204.1_5 Forward -55 -36 3.34271 0.192
NP_442487.1_5 Reverse -223 -242 10.2251 0.198
NP_440255.1_5 Forward -332 -318 15.5768 0.246
NP_440516.1_2 Forward -51 -33 6.50899 0.122
NP_440516.1_2 Reverse -228 -246 4.44404 0.138
NP_440516.1_8 Forward -45 -36 16.9127 0.00442
NP_440516.1_8 Reverse -36 -45 16.9127 0.00442
NP_440516.1_8 Forward -233 -224 8.1612 0.0417
NP_441033.1_2 Reverse -214 -233 -7.76869 0.293
NP_442428.1_5 Forward -44 -37 15.8704 0.0124
NP_442428.1_5 Reverse -37 -44 15.8704 0.0124
NP_442428.1_5 Reverse -225 -232 6.13563 0.209
NP_442428.1_5 Forward -232 -225 6.0373 0.212
NP_440818.1_6 Reverse -329 -348 12.0942 0.228
NP_440818.1_6 Reverse -213 -232 10.5209 0.228
NP_440673.1_2 Forward -243 -224 9.12141 0.257
NP_440673.1_3 Forward -43 -36 12.4288 0.0426
NP_440673.1_3 Reverse -226 -233 12.4288 0.0426
NP_440673.1_3 Reverse -38 -45 12.4288 0.0426
NP_440673.1_3 Forward -114 -107 8.8889 0.206
NP_441052.1_2 Reverse -36 -46 10.5014 0.0285
NP_441052.1_2 Forward -45 -35 10.4031 0.0285
NP_441052.1_2 Forward -213 -203 0.963343 0.255
NP_442219.1_8 Forward -394 -375 10.6796 0.202
NP_442219.1_9 Reverse -37 -46 8.35786 0.0681
NP_442219.1_9 Forward -44 -35 8.25953 0.0681
NP_442219.1_9 Forward -348 -339 4.32629 0.198
NP_440436.1_4 Reverse -37 -46 18.1905 0.00233
NP_440436.1_4 Forward -232 -223 13.6673 0.0225
NP_440436.1_4 Forward -44 -35 9.24241 0.0871
NP_440436.1_4 Reverse -225 -234 5.9975 0.174
NP_441884.1_8 Forward -46 -27 -11.0136 0.268
NP_442864.1_2 Reverse -376 -395 13.2741 0.227
NP_442864.1_3 Forward -365 -346 13.8641 0.163
NP_440314.1_9 Reverse -37 -56 -7.08038 0.237
NP_440041.1_2 Forward -251 -232 -3.93378 0.293
NP_441719.1_4 Forward -44 -37 16.3621 0.0124
NP_441719.1_4 Reverse -37 -44 16.3621 0.0124
NP_441719.1_4 Forward -232 -225 6.72562 0.093
NP_441719.1_4 Reverse -225 -232 6.62729 0.151
NP_441733.1_10 Reverse -33 -46 5.82081 0.203
NP_441004.1_4 Forward -399 -389 8.1415 0.281
NP_442813.1_4 Forward -97 -78 5.211 0.197
NP_442366.1_3 Forward -46 -28 -2.53746 0.229
NP_442366.1_5 Forward -48 -38 11.9759 0.148
NP_442873.1_3 Reverse -380 -399 4.32522 0.269
NP_442694.1_4 Reverse -293 -302 11.6028 0.277
NP_442206.1_10 Forward -45 -30 4.40479 0.178
NP_442206.1_10 Reverse -36 -51 3.22482 0.188
NP_442854.1_6 Forward -45 -26 15.8307 0.143
NP_443054.1_2 Reverse -34 -48 9.04604 0.102
NP_441851.1_10 Forward -46 -36 16.008 0.00552
NP_441851.1_10 Reverse -339 -349 10.2065 0.0998
NP_441851.1_10 Reverse -35 -45 8.53483 0.114
NP_442208.1_5 Reverse -202 -221 -0.197208 0.248
NP_442856.1_7 Forward -222 -203 -4.81876 0.268
NP_441668.1_4 Reverse -26 -45 -2.36049 0.288
NP_442515.1_1 Forward -306 -292 -0.197071 0.214
NP_440593.1_3 Forward -121 -102 12.5858 0.099
NP_440593.1_3 Reverse -199 -218 2.26107 0.178
NP_440165.1_5 Forward -46 -27 0.196116 0.154
NP_442709.1_3 Reverse -29 -48 9.0459 0.121
NP_442709.1_3 Forward -52 -33 2.55606 0.294
NP_441046.1_2 Forward -244 -225 -0.4922 0.281
NP_440940.1_7 Reverse -26 -44 8.57317 0.171
NP_441349.1_10 Reverse -26 -45 16.0274 0.0114
NP_441349.1_10 Forward -55 -36 -7.96535 0.262
NP_441409.1_6 Forward -51 -32 -4.81876 0.095
NP_441409.1_6 Forward -239 -220 -8.16202 0.164
NP_440432.1_9 Forward -44 -29 3.22482 0.0967
NP_440432.1_9 Forward -232 -217 -5.42831 0.248
NP_442843.1_1 Reverse -288 -307 -2.36049 0.203
NP_439960.1_3 Forward -219 -200 7.86593 0.202
NP_441524.1_8 Reverse -79 -98 17.2074 0.182
NP_440431.1_3 Reverse -35 -54 -6.68705 0.195
NP_442450.1_5 Forward -47 -37 7.55152 0.13
NP_440588.1_2 Reverse -27 -46 0.982764 0.141
NP_440588.1_2 Forward -54 -35 -3.14714 0.179
NP_440588.1_2 Forward -162 -143 -6.29373 0.276
NP_442006.1_2 Reverse -101 -118 -4.58271 0.136
NP_442006.1_2 Reverse -273 -290 -15.7924 0.228
NP_440483.1_1 Forward -93 -74 -1.96717 0.208
NP_440483.1_1 Reverse -79 -98 -5.11376 0.222
NP_441570.1_1 Forward -45 -27 0.314141 0.0395
NP_441570.1_1 Reverse -224 -242 -6.37237 0.0792
NP_441570.1_1 Reverse -107 -125 -12.7639 0.218
NP_441078.1_4 Forward -45 -36 19.6659 0.0007
NP_441078.1_4 Reverse -36 -45 19.6659 0.0007
NP_441078.1_4 Reverse -224 -233 0.196389 0.205
NP_441078.1_4 Forward -233 -224 -0.000272808 0.205
NP_441078.1_4 Forward -160 -151 -1.47524 0.266
NP_441078.1_4 Reverse -388 -397 -1.96689 0.282
NP_442729.1_5 Reverse -272 -282 8.33817 0.248
NP_442729.1_8 Forward -291 -278 9.2624 0.125
NP_441663.1_8 Reverse -30 -49 -0.000545616 0.225
NP_440526.1_3 Forward -348 -337 8.51463 0.122
NP_441432.1_8 Reverse -35 -44 16.8143 0.00595
NP_441432.1_8 Forward -46 -37 8.25953 0.0755
NP_441432.1_8 Forward -234 -225 7.17789 0.102
NP_441432.1_8 Forward -161 -152 2.94966 0.28
NP_442320.1_8 Forward -51 -37 -0.393733 0.0817
NP_442320.1_8 Reverse -218 -232 -4.81863 0.188
NP_442344.1_7 Reverse -37 -56 21.4356 0.00852
NP_442344.1_7 Forward -232 -213 -5.40875 0.168
NP_441732.1_2 Reverse -371 -387 1.43517 0.0402
NP_441732.1_2 Reverse -32 -48 -16.1661 0.165
NP_441732.1_2 Forward -49 -33 -17.346 0.253
NP_440629.1_6 Reverse -30 -49 19.3368 0.0338
NP_440760.1_1 Reverse -36 -55 -19.3717 0.219
NP_440760.1_1 Forward -45 -26 -22.3217 0.253
NP_440760.1_1 Reverse -234 -253 -23.4033 0.297
NP_440199.1_10 Forward -236 -226 12.9597 0.114
NP_442353.1_4 Reverse -228 -247 3.04693 0.223
NP_442751.1_2 Reverse -223 -242 4.42355 0.261
NP_441072.1_2 Reverse -25 -44 8.25926 0.24
NP_441072.1_2 Reverse -252 -271 6.29264 0.283
NP_440713.1_4 Reverse -253 -272 2.16274 0.27
NP_442489.1_7 Forward -45 -36 20.1576 0.000695
NP_442489.1_7 Reverse -36 -45 20.1576 0.000695
NP_442489.1_7 Reverse -224 -233 0.884706 0.145
NP_442489.1_7 Forward -233 -224 0.491382 0.178
NP_442489.1_7 Reverse -388 -397 -1.27858 0.185
NP_440757.1_7 Reverse -199 -217 1.59244 0.269
NP_441452.1_1 Forward -124 -105 15.7324 0.223
NP_441452.1_9 Forward -242 -223 16.3224 0.226
NP_441452.1_10 Forward -306 -287 19.9606 0.105
NP_442079.1_7 Reverse -37 -56 2.16274 0.234
NP_442079.1_7 Reverse -225 -244 1.86774 0.24
NP_440559.1_1 Reverse -37 -46 8.75118 0.0586
NP_440559.1_1 Forward -44 -35 8.65285 0.0586
NP_440559.1_1 Reverse -225 -234 5.40793 0.14
NP_441659.2_8 Forward -45 -35 20.9245 0.000805
NP_441659.2_8 Reverse -36 -46 11.9764 0.0147
NP_441659.2_8 Reverse -224 -234 9.12481 0.0355
NP_441022.1_1 Reverse -160 -169 10.7788 0.285
NP_442913.1_10 Reverse -215 -234 1.96607 0.133
NP_442913.1_10 Reverse -27 -46 -5.31042 0.262
NP_441040.1_2 Forward -118 -99 -8.45701 0.236
NP_440708.1_6 Reverse -226 -245 -7.96535 0.255
NP_441800.1_7 Reverse -379 -397 -0.7675 0.232
NP_441800.1_7 Reverse -376 -394 -2.73412 0.265
NP_441800.1_7 Forward -215 -197 -4.50408 0.297
NP_442346.1_5 Reverse -35 -45 16.303 0.00248
NP_442346.1_5 Forward -234 -224 14.4347 0.0134
NP_442346.1_5 Forward -46 -36 9.02648 0.118
NP_440545.1_3 Reverse -32 -49 7.11867 0.0518
NP_440545.1_3 Forward -49 -32 4.07041 0.0751
NP_441856.1_7 Reverse -257 -276 8.75091 0.292
NP_440831.1_3 Forward -54 -35 5.41637 0.28
NP_440831.1_3 Reverse -104 -123 4.54267 0.3
NP_441629.1_3 Forward -295 -276 -3.14789 0.277
NP_441923.1_6 Reverse -274 -288 9.83269 0.278
NP_440459.1_2 Reverse -348 -365 10.6586 0.193
NP_440459.1_2 Reverse -379 -396 10.3636 0.2
NP_440459.1_2 Forward -228 -211 9.47861 0.227
NP_441943.1_8 Forward -182 -163 -6.1954 0.261
NP_442551.1_4 Reverse -208 -223 -2.77337 0.276
NP_442828.1_5 Forward -331 -312 10.9134 0.289
NP_441888.1_7 Reverse -31 -45 3.63784 0.225
NP_440170.1_5 Forward -55 -36 8.16093 0.142
NP_441833.1_4 Forward -44 -37 15.9687 0.0124
NP_441833.1_4 Reverse -37 -44 15.9687 0.0124
NP_441833.1_4 Reverse -225 -232 14.1004 0.0258
NP_441833.1_4 Forward -232 -225 6.13563 0.198
NP_441112.1_10 Forward -359 -340 12.8808 0.298
NP_442162.1_9 Forward -44 -37 16.2637 0.0124
NP_442162.1_9 Reverse -37 -44 16.2637 0.0124
NP_442162.1_9 Reverse -225 -232 6.62729 0.142
NP_442162.1_9 Forward -232 -225 6.52896 0.178
NP_440671.1_4 Reverse -30 -44 6.78443 0.235
NP_440671.1_4 Reverse -257 -271 4.91614 0.3
NP_442404.1_9 Reverse -183 -197 9.93039 0.263
NP_442404.1_9 Reverse -378 -392 9.14375 0.279
NP_441915.1_4 Forward -398 -379 16.9115 0.187
NP_442140.1_3 Reverse -37 -47 16.2046 0.0255
NP_442140.1_3 Forward -232 -222 12.4681 0.0632
NP_442140.1_3 Forward -281 -271 4.99491 0.232
NP_442140.1_3 Forward -44 -34 4.69992 0.238
NP_442140.1_3 Reverse -274 -284 3.42162 0.297
NP_441671.1_10 Forward -178 -159 2.3594 0.255
NP_440875.1_9 Forward -43 -33 16.5483 0.0145
NP_440875.1_9 Reverse -38 -48 9.15072 0.233
NP_441813.1_5 Reverse -34 -44 18.1713 0.00743
NP_441813.1_5 Forward -47 -37 9.91146 0.021
NP_441813.1_5 Reverse -222 -232 9.12481 0.0308
NP_441813.1_5 Forward -235 -225 6.07655 0.104
NP_440590.1_4 Forward -396 -383 2.08423 0.101
NP_440590.1_4 Reverse -37 -50 1.88757 0.108
NP_440590.1_4 Reverse -382 -395 -0.472371 0.189
NP_440567.1_1 Reverse -37 -51 16.7159 0.0166
NP_440567.1_1 Forward -44 -30 0.589577 0.24
NP_442497.1_6 Reverse -29 -48 11.1109 0.242
NP_442497.1_10 Forward -44 -35 17.601 0.00813
NP_442497.1_10 Reverse -37 -46 10.4228 0.0087
NP_442497.1_10 Reverse -225 -234 7.86621 0.0695
NP_440821.1_4 Forward -47 -37 10.2065 0.0163
NP_440821.1_4 Reverse -338 -348 4.79825 0.123
NP_440821.1_4 Reverse -34 -44 2.24165 0.131
NP_440821.1_4 Forward -235 -225 1.25834 0.139
NP_441239.1_9 Reverse -34 -46 15.5753 0.0186
NP_441239.1_9 Reverse -386 -398 14.9853 0.0247
NP_441239.1_9 Forward -47 -35 12.3303 0.0477
NP_441239.1_9 Reverse -232 -244 6.03717 0.202
NP_441239.1_9 Forward -42 -30 4.75886 0.243
NP_441239.1_9 Reverse -222 -234 3.38223 0.285
NP_441951.1_4 Reverse -71 -90 6.19431 0.273
NP_441727.1_3 Forward -52 -33 4.32602 0.264
NP_441727.1_3 Forward -117 -98 3.73603 0.281
NP_440400.1_1 Forward -132 -113 0.981987 0.263
NP_441892.1_1 Forward -242 -225 0.333834 0.17
NP_440604.1_6 Forward -45 -26 -1.86883 0.209
NP_442643.1_1 Forward -51 -32 -10.7186 0.231
NP_442629.1_3 Reverse -292 -311 -0.0988766 0.294
NP_442216.1_4 Reverse -318 -326 8.1805 0.255
NP_440354.1_7 Forward -239 -221 10.0489 0.224
NP_440354.1_7 Forward -95 -77 7.88563 0.26
NP_440546.1_4 Forward -45 -35 13.5365 0.0459
NP_440546.1_4 Reverse -36 -46 11.8882 0.0679
NP_440546.1_4 Forward -233 -223 11.5004 0.0806
NP_440546.1_4 Reverse -273 -283 7.71902 0.224
NP_440546.1_4 Reverse -257 -267 7.13728 0.257
NP_440546.1_6 Forward -55 -36 10.5209 0.245
NP_441230.1_3 Forward -245 -226 7.96426 0.263
NP_441230.1_5 Reverse -219 -238 -0.787193 0.292
NP_440462.1_6 Reverse -34 -44 18.7612 0.00454
NP_440462.1_6 Forward -47 -37 9.02648 0.0498
NP_440462.1_6 Forward -235 -225 7.25653 0.0838
NP_440462.1_6 Reverse -222 -232 7.05986 0.0915
NP_442611.1_1 Forward -287 -268 -1.86883 0.283
NP_442565.1_6 Forward -177 -163 15.3392 0.28
NP_440868.1_4 Forward -49 -37 17.7386 0.0124
NP_440868.1_4 Reverse -32 -44 15.0836 0.0164
NP_440868.1_4 Forward -237 -225 8.10212 0.0602
NP_440868.1_7 Reverse -38 -57 17.8948 0.0902
NP_441474.1_1 Reverse -214 -233 3.9319 0.222
NP_441474.1_1 Reverse -242 -261 -1.77127 0.264
NP_442402.1_4 Forward -30 -11 -0.886293 0.189
NP_442402.1_10 Reverse -166 -176 12.0743 0.224
NP_442402.1_10 Reverse -74 -84 10.6976 0.282
NP_440653.1_10 Reverse -165 -184 1.96607 0.29
NP_442460.1_7 Forward -57 -38 -0.39387 0.283
NP_440696.1_3 Reverse -263 -281 1.78911 0.217
NP_440696.1_3 Forward -45 -27 1.78911 0.217
NP_440696.1_3 Forward -229 -211 -3.91409 0.293
NP_442039.1_4 Forward -44 -37 15.1821 0.0124
NP_442039.1_4 Reverse -37 -44 15.1821 0.0124
NP_442039.1_7 Forward -280 -270 13.353 0.211
NP_441811.1_1 Reverse -70 -89 5.50599 0.28
NP_441926.1_3 Forward -45 -29 6.25339 0.17
NP_440825.1_7 Reverse -37 -47 12.4217 0.155
NP_442837.1_3 Forward -44 -37 15.7721 0.0124
NP_442837.1_3 Reverse -37 -44 15.7721 0.0124
NP_442837.1_3 Reverse -225 -232 6.13563 0.25
NP_442837.1_3 Forward -232 -225 5.93897 0.265
NP_439994.1_1 Reverse -257 -276 16.1257 0.12
NP_442053.1_1 Forward -45 -36 18.3876 0.0007
NP_442053.1_1 Reverse -36 -45 18.3876 0.0007
NP_440505.1_3 Reverse -34 -44 17.188 0.00332
NP_440505.1_3 Forward -235 -225 13.8447 0.0247
NP_440505.1_3 Forward -47 -37 6.76487 0.169
NP_441701.1_3 Reverse -254 -271 13.4119 0.198
NP_441203.1_1 Forward -44 -25 -15.3402 0.225
NP_442255.1_3 Reverse -155 -174 8.35759 0.279
NP_440914.1_1 Forward -45 -35 16.3248 0.00196
NP_440914.1_1 Reverse -224 -234 13.4947 0.0297
NP_440914.1_1 Reverse -36 -46 8.6151 0.186
NP_441011.1_8 Reverse -37 -46 16.9127 0.00602
NP_441011.1_8 Forward -44 -35 16.6177 0.00602
NP_441011.1_8 Forward -232 -223 8.45619 0.144
NP_441011.1_8 Reverse -225 -234 6.8829 0.18
NP_441011.1_8 Forward -159 -150 5.3096 0.271
NP_442533.1_6 Forward -45 -36 17.2076 0.00137
NP_442533.1_6 Reverse -36 -45 17.2076 0.00137
NP_442533.1_6 Forward -233 -224 5.3096 0.145
NP_442533.1_6 Forward -109 -100 5.21127 0.15
NP_442533.1_6 Forward -397 -388 5.11294 0.155
NP_442533.1_6 Forward -219 -210 4.52295 0.179
NP_442533.1_6 Reverse -210 -219 4.52295 0.179
NP_442533.1_6 Forward -153 -144 4.22796 0.186
NP_442533.1_6 Reverse -388 -397 3.93297 0.197
NP_442533.1_6 Forward -272 -263 2.75299 0.241
NP_442533.1_6 Reverse -151 -160 2.55633 0.25
NP_442533.1_6 Forward -110 -101 1.37636 0.3
NP_442541.1_10 Reverse -69 -83 6.29216 0.248
NP_442541.1_10 Reverse -210 -224 5.01387 0.248
NP_442541.1_10 Forward -219 -205 3.73557 0.252
NP_442232.1_3 Reverse -28 -47 -14.3569 0.288
NP_442322.1_4 Forward -274 -257 -10.1882 0.298
NP_442229.1_1 Reverse -34 -48 8.45543 0.184
NP_443016.1_1 Reverse -30 -49 -5.21209 0.245
NP_441482.1_7 Reverse -30 -44 14.2576 0.0125
NP_441482.1_7 Forward -51 -37 -8.94853 0.193
NP_441482.1_7 Forward -239 -225 -11.3085 0.254
NP_439944.1_9 Forward -44 -34 9.12481 0.1
NP_439944.1_9 Reverse -225 -235 7.94484 0.123
NP_441028.1_6 Reverse -167 -177 12.6642 0.183
NP_441028.1_6 Reverse -168 -178 5.78111 0.243
NP_440116.1_5 Forward -48 -31 21.9666 0.0248
NP_440116.1_8 Forward -232 -213 2.65439 0.0857
NP_440116.1_8 Reverse -37 -56 -10.0303 0.297
NP_441527.1_4 Reverse -49 -68 -7.974 0.24
NP_440115.1_6 Reverse -33 -43 14.0414 0.0615
NP_440115.1_6 Forward -236 -226 6.46988 0.181
NP_440007.1_9 Forward -92 -78 1.37622 0.285
NP_439965.1_1 Forward -54 -35 -3.63879 0.182
NP_439965.1_1 Reverse -27 -46 -4.32711 0.189
NP_441347.1_5 Reverse -30 -44 9.6354 0.269
NP_441106.1_1 Reverse -35 -44 18.486 0.0028
NP_441106.1_1 Forward -46 -37 18.191 0.0028
NP_441106.1_1 Reverse -223 -232 13.9627 0.0279
NP_441106.1_1 Forward -234 -225 8.65285 0.0522
NP_441106.1_1 Reverse -106 -115 2.458 0.283
NP_440429.1_2 Forward -354 -335 6.98095 0.295
NP_441216.1_5 Reverse -379 -398 15.7316 0.188
NP_439903.1_6 Reverse -33 -52 3.53858 0.209
NP_439903.1_6 Reverse -221 -240 1.08032 0.255
NP_442306.1_10 Reverse -31 -50 -10.7186 0.111
NP_442306.1_10 Forward -238 -219 -20.5517 0.213
NP_441286.1_1 Reverse -35 -47 -3.40261 0.145
NP_441286.1_1 Forward -46 -34 -3.59927 0.145
NP_440670.1_8 Forward -45 -36 18.3876 0.000699
NP_440670.1_8 Reverse -36 -45 18.3876 0.000699
NP_440670.1_8 Reverse -224 -233 6.98123 0.0882
NP_441479.1_1 Forward -48 -29 7.37428 0.281
NP_441705.1_3 Reverse -107 -126 -3.24547 0.285
NP_440886.1_7 Forward -46 -36 17.7774 0.0011
NP_440886.1_7 Reverse -35 -45 8.04271 0.0805
NP_440886.1_7 Reverse -242 -252 4.60114 0.227
NP_440828.1_1 Reverse -380 -399 4.91521 0.207
NP_440828.1_4 Forward -313 -294 -5.31116 0.255
NP_440828.1_4 Forward -292 -273 -8.35941 0.296
NP_442614.1_2 Reverse -36 -50 8.35772 0.255
NP_442072.1_9 Forward -46 -28 -13.5505 0.115
NP_442072.1_9 Forward -398 -380 -15.8121 0.19
NP_442072.1_9 Reverse -150 -168 -22.9903 0.271
NP_440907.2_8 Reverse -37 -47 14.2375 0.0312
NP_440907.2_8 Forward -44 -34 9.616 0.103
NP_442264.1_2 Forward -55 -38 7.80699 0.228
NP_441463.1_3 Forward -55 -36 -0.590531 0.133
NP_441463.1_6 Forward -136 -122 6.02939 0.283
NP_441626.1_2 Forward -44 -37 15.7721 0.0124
NP_441626.1_2 Reverse -37 -44 15.7721 0.0124
NP_441626.1_2 Forward -232 -225 6.0373 0.212
NP_441626.1_2 Reverse -225 -232 6.0373 0.212
NP_442221.1_4 Forward -122 -103 7.17762 0.296
NP_442221.1_4 Forward -95 -76 5.89931 0.296
NP_442365.1_7 Forward -49 -30 -1.67217 0.195
NP_440107.1_5 Forward -289 -270 -7.4737 0.295
NP_442794.1_1 Forward -164 -152 4.5622 0.256
NP_442794.1_1 Forward -49 -37 2.59558 0.287
NP_442615.1_1 Forward -54 -36 17.9154 0.00593
NP_442615.1_1 Reverse -27 -45 2.37909 0.0686
NP_442615.1_1 Reverse -215 -233 -7.55234 0.296
NP_441962.1_5 Forward -128 -109 11.6025 0.17
NP_441962.1_9 Reverse -198 -217 8.06259 0.258
NP_440387.1_1 Forward -45 -29 14.6115 0.00635
NP_440387.1_1 Reverse -36 -52 3.79511 0.0519
NP_441431.1_2 Reverse -33 -47 16.7152 0.033
NP_441431.1_2 Reverse -385 -399 10.717 0.155
NP_441431.1_2 Forward -48 -34 8.06211 0.226
NP_441993.1_1 Reverse -198 -217 6.13735 0.186
NP_441993.1_1 Reverse -95 -114 4.28566 0.222
NP_441993.1_1 Forward -116 -97 2.72635 0.254
NP_441993.1_1 Forward -51 -32 0.582284 0.297
NP_441993.1_4 Forward -282 -263 11.7983 0.246
NP_441174.1_2 Reverse -33 -47 16.0275 0.0864
NP_440114.1_10 Reverse -224 -238 11.6026 0.107
NP_440114.1_10 Forward -45 -31 8.75105 0.195
NP_440114.1_10 Reverse -36 -50 7.66941 0.229
NP_441510.2_9 Forward -44 -25 7.37428 0.192
NP_440293.1_3 Reverse -256 -275 1.17943 0.209
NP_440293.1_3 Forward -232 -213 -0.000545616 0.228
NP_440293.1_10 Forward -399 -380 23.7955 0.0075
NP_440766.1_4 Forward -237 -223 0.88457 0.263
NP_442743.1_1 Reverse -70 -89 5.11187 0.286
NP_442743.1_4 Forward -162 -143 -7.67036 0.28
NP_442743.1_5 Reverse -31 -50 6.78429 0.175
NP_439910.1_2 Reverse -216 -233 -21.594 0.183
NP_440502.1_7 Reverse -301 -320 16.0274 0.268
NP_442867.1_8 Forward -94 -75 5.40766 0.276
NP_440457.1_1 Reverse -32 -44 10.2654 0.092
NP_440798.1_6 Reverse -37 -50 3.26421 0.151
NP_440798.1_6 Forward -44 -31 1.00259 0.24
NP_441332.1_6 Reverse -78 -88 12.034 0.236
NP_442509.1_9 Reverse -36 -46 16.2041 0.00739
NP_442509.1_9 Forward -45 -35 8.04271 0.192
NP_442784.1_9 Reverse -379 -398 16.6174 0.107
NP_440554.1_4 Forward -44 -34 17.9746 0.0131
NP_440554.1_4 Forward -232 -222 8.73149 0.0668
NP_440554.1_4 Reverse -37 -47 7.35486 0.103
NP_440554.1_4 Reverse -225 -235 6.56821 0.121
NP_441885.1_5 Reverse -36 -46 11.4848 0.00668
NP_441885.1_5 Forward -45 -35 11.3864 0.00668
NP_441885.1_5 Forward -233 -223 0.668351 0.133
NP_440478.1_10 Forward -47 -33 15.0442 0.107
NP_441428.1_8 Forward -115 -96 6.58763 0.216
NP_442703.1_4 Reverse -36 -55 1.47364 0.284
NP_442341.1_7 Reverse -150 -164 10.521 0.0625
NP_442341.1_7 Reverse -35 -49 5.60446 0.151
NP_442341.1_7 Forward -161 -147 1.37622 0.292
NP_442341.1_9 Reverse -34 -48 13.8636 0.0744
NP_442341.1_9 Reverse -117 -131 7.47213 0.198
NP_442341.1_9 Forward -47 -33 7.07881 0.204
NP_441756.1_5 Forward -391 -372 -4.81876 0.296
NP_441173.1_9 Forward -31 -23 10.9338 0.242
NP_441173.1_9 Reverse -168 -176 9.75379 0.284
NP_440423.1_10 Forward -240 -221 15.9291 0.172
NP_443000.1_7 Reverse -34 -44 20.3345 0.00223
NP_443000.1_7 Forward -235 -225 7.64985 0.0734
NP_443000.1_7 Forward -47 -37 1.94665 0.226
NP_443000.1_7 Reverse -222 -232 1.16001 0.271
NP_441842.1_10 Forward -52 -38 8.06273 0.237
NP_440275.1_3 Reverse -34 -44 16.1063 0.0155
NP_440275.1_3 Forward -47 -37 8.33817 0.0602
NP_440275.1_3 Reverse -222 -232 4.0116 0.205
NP_440091.1_1 Reverse -220 -232 11.1504 0.0429
NP_441359.1_5 Forward -216 -197 9.93088 0.155
NP_441359.1_5 Reverse -378 -397 3.73603 0.246
NP_442451.1_2 Reverse -380 -399 -11.0136 0.284
NP_439962.1_4 Forward -97 -78 -5.31042 0.278
NP_441105.1_3 Forward -56 -37 1.67108 0.111
NP_442373.1_2 Reverse -267 -286 -11.0136 0.293
NP_440216.1_1 Forward -45 -31 16.4209 0.00307
NP_440216.1_1 Forward -233 -219 6.29277 0.0156
NP_440216.1_1 Reverse -36 -50 -2.16369 0.0482
NP_440216.1_1 Forward -397 -383 -10.9151 0.153
NP_440172.1_1 Forward -45 -35 17.5813 0.00421
NP_440172.1_1 Reverse -36 -46 8.73149 0.0586
NP_442371.1_1 Reverse -307 -317 14.2375 0.191
NP_442015.1_3 Reverse -214 -233 10.1267 0.296
NP_442015.1_10 Forward -49 -36 10.344 0.0391
NP_442015.1_10 Reverse -32 -45 3.75586 0.178
NP_442015.1_10 Reverse -230 -243 2.18257 0.199
NP_441226.1_7 Forward -44 -37 14.4934 0.0123
NP_441226.1_7 Reverse -37 -44 14.4934 0.0123
NP_441226.1_7 Reverse -80 -87 6.52862 0.253
NP_441111.1_7 Forward -44 -36 18.7023 0.00294
NP_441111.1_7 Reverse -37 -45 18.7023 0.00294
NP_441111.1_7 Reverse -225 -233 8.96754 0.0463
NP_442379.1_10 Reverse -29 -46 0.432165 0.223
NP_441766.1_2 Forward -45 -36 17.5026 0.00297
NP_441766.1_2 Reverse -36 -45 17.5026 0.00297
NP_441766.1_2 Forward -233 -224 8.06287 0.0691
NP_441766.1_2 Forward -359 -350 1.57302 0.282
NP_442417.1_5 Forward -45 -31 6.3911 0.222
NP_440416.1_1 Forward -233 -214 -13.2752 0.281
NP_440416.1_9 Forward -52 -33 3.93269 0.0355
NP_440416.1_9 Forward -123 -104 -11.1119 0.148
NP_440416.1_9 Reverse -29 -48 -17.7985 0.247
NP_440416.1_9 Reverse -256 -275 -18.0934 0.251
NP_443052.1_8 Reverse -214 -233 1.0811 0.0618
NP_443052.1_8 Forward -55 -36 -8.16202 0.169
NP_443052.1_9 Reverse -377 -396 3.14605 0.164
NP_443052.1_9 Forward -114 -95 -5.9004 0.274
NP_443052.1_9 Forward -217 -198 -6.09707 0.276
NP_443052.1_9 Reverse -69 -88 -7.27704 0.295
NP_442154.1_1 Reverse -295 -313 -13.7472 0.217
NP_442154.1_1 Forward -398 -380 -15.7138 0.224
NP_442154.1_1 Reverse -274 -292 -16.3038 0.238
NP_442154.1_1 Forward -232 -214 -19.2537 0.294
NP_441430.1_6 Reverse -335 -354 13.8641 0.186
NP_440261.1_5 Reverse -37 -50 -0.964025 0.0655
NP_440261.1_5 Forward -44 -31 -2.83231 0.0932
NP_440261.1_5 Reverse -225 -238 -4.89726 0.178
NP_440261.1_5 Reverse -235 -248 -6.17557 0.196
NP_440988.1_10 Reverse -40 -54 4.22114 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGGGCCAGCGGCGGTGGTGATCTGTTACGAATCTGCCTTTCCCGATCTATTGCGTTCCCAACTGTTACAGGGAGGGGAATTTATTCTTTCCAGTGCCAACAACGCCCATTACAGCGACACCATGGCGGCCCAACACCATGCCCTAGACGTGATGCGGGCCATTGAAGGCGATCGTTGGTTGGCCCGGGCCACCAACACTGGACTTTCGGCGATAATTAATCCCCGGGGAAAAACCCTTTGGTTATCGGCCATGAACCAGTATGAAATCCATGCTGCCCCCATTTACCGTCGCCGGGGCCTCATTCTCTACAGCCGTTGGGGGGACTGGGTAGTGTTTTTATTACTGGTTGTCTCGGCGATCGCCTGGCTTTACCAAATTGTTTTCCCACTTAACCAACG

CDS

GTGAAAAATACTGAAAACATAATGGAATTAATTTTATACAGCAAGCCCGGTTGCCATCTTTGTGAAGGATTGATGGAAAAATTAGCCCAGATTAATAGCCTAACCATTGAGCTAGAAGTCCGTGACATCACCACTGACGAACAATGGTGGGCCGCCTACCAATACGAAATTCCGGTATTAGTGTGGCGATCGCCGACGGGGGAAATTACTTTGCCGAGGCTATCTCCCCGGGCCCCTGTTAGTCAATTGGAAAAGTTACTGCAACAATACGTTAATGGCTGA

Protein

MKNTENIMELILYSKPGCHLCEGLMEKLAQINSLTIELEVRDITTDEQWWAAYQYEIPVLVWRSPTGEITLPRLSPRAPVSQLEKLLQQYVNG