Your browser is old and dusty. Try Google Chrome!

Details for ssr1175

ORF ssr1175
Accession NP_442668.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100v: 3095975 - 3096319, join 3097194 - 3097362, join 3098314 - 3098743]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -239 -232 14.1988 0.0267
NP_441418.1_6 Forward -240 -221 -19.0768 0.0844
NP_441418.1_6 Forward -304 -285 -22.0267 0.166
NP_441453.1_1 Reverse -288 -306 3.55831 0.264
NP_441453.1_4 Forward -240 -232 6.80426 0.121
NP_441453.1_4 Reverse -231 -239 6.70593 0.121
NP_442151.1_6 Reverse -231 -245 19.2725 0.00487
NP_441342.1_2 Forward -244 -230 12.9793 0.185
NP_441098.1_3 Reverse -120 -139 -5.83193 0.28
NP_441098.1_3 Forward -134 -115 -7.746 0.296
NP_442655.1_10 Forward -307 -288 -12.3902 0.261
NP_443002.1_5 Forward -341 -323 12.6047 0.217
NP_442173.1_1 Forward -239 -231 5.72262 0.203
NP_442173.1_1 Reverse -232 -240 5.72262 0.203
NP_442752.1_4 Reverse -231 -238 13.5105 0.0314
NP_442752.1_4 Forward -240 -233 4.26735 0.293
NP_442975.1_10 Reverse -227 -241 16.0269 0.0289
NP_442975.1_10 Reverse -291 -305 1.76896 0.291
NP_440784.1_7 Reverse -232 -239 13.2155 0.0365
NP_440784.1_7 Forward -239 -232 12.1338 0.0604
NP_440061.1_9 Reverse -181 -195 9.14375 0.151
NP_440878.1_9 Forward -250 -231 6.19431 0.174
NP_442062.1_8 Forward -240 -230 9.7148 0.0559
NP_442062.1_8 Reverse -231 -241 7.64985 0.0911
NP_441859.1_3 Forward -317 -298 1.37531 0.287
NP_442972.1_1 Reverse -103 -121 6.8091 0.291
NP_442242.1_4 Forward -239 -232 12.0355 0.0521
NP_442242.1_4 Reverse -232 -239 11.5438 0.089
NP_442242.1_4 Reverse -296 -303 9.47889 0.251
NP_440044.1_8 Reverse -232 -251 2.45773 0.15
NP_441492.1_1 Forward -21 -2 11.1109 0.148
NP_441594.1_6 Reverse -286 -305 1.57275 0.266
NP_441365.1_5 Forward -21 -2 37.5619 0.000000115
NP_441082.1_5 Reverse -72 -91 9.43923 0.28
NP_440300.1_5 Reverse -30 -48 12.225 0.271
NP_441083.1_5 Reverse -231 -241 10.6981 0.0184
NP_441083.1_5 Forward -240 -230 8.82982 0.03
NP_441083.1_5 Reverse -295 -305 -1.10161 0.295
NP_442827.1_8 Reverse -287 -306 5.80018 0.113
NP_441558.1_5 Forward -306 -287 5.11266 0.26
NP_440209.1_1 Forward -240 -232 8.37755 0.0576
NP_440209.1_1 Reverse -231 -239 8.27922 0.0687
NP_442889.1_8 Reverse -228 -242 11.012 0.0764
NP_441716.1_2 Reverse -53 -72 3.35565 0.229
NP_441716.1_2 Forward -134 -115 0.293125 0.264
NP_442111.1_4 Forward -241 -227 5.99778 0.142
NP_440851.1_3 Reverse -110 -129 9.53756 0.179
NP_440906.1_5 Reverse -232 -239 13.3138 0.0268
NP_440906.1_5 Forward -239 -232 6.13563 0.241
NP_440747.1_10 Forward -243 -231 5.15219 0.0179
NP_440747.1_10 Reverse -228 -240 -4.48425 0.101
NP_440747.1_10 Forward -307 -295 -12.2524 0.254
NP_441486.1_1 Reverse -228 -242 4.32615 0.0462
NP_441486.1_1 Forward -243 -229 4.12949 0.0492
NP_440944.1_2 Forward -365 -346 5.211 0.194
NP_442634.1_4 Forward -306 -292 -5.80194 0.279
NP_441014.1_10 Forward -241 -222 -1.18128 0.257
NP_443018.1_3 Forward -239 -232 5.15232 0.226
NP_443018.1_3 Reverse -232 -239 5.05399 0.238
NP_441634.1_8 Forward -306 -292 -3.04867 0.295
NP_440376.1_1 Reverse -231 -240 9.83282 0.0339
NP_440376.1_1 Forward -240 -231 9.73449 0.0365
NP_440376.1_1 Reverse -295 -304 6.29291 0.104
NP_440376.1_1 Forward -194 -185 1.96635 0.236
NP_440376.1_1 Forward -304 -295 0.0980582 0.285
NP_441588.1_4 Forward -238 -228 11.6814 0.14
NP_441588.1_4 Reverse -233 -243 6.07655 0.214
NP_442687.1_7 Reverse -230 -240 14.828 0.0247
NP_442687.1_7 Forward -305 -295 8.1415 0.113
NP_440642.1_10 Forward -249 -235 11.7003 0.145
NP_440642.1_10 Reverse -360 -374 3.04726 0.277
NP_442658.1_1 Reverse -229 -239 6.0761 0.238
NP_442198.1_3 Forward -249 -230 6.09597 0.251
NP_442937.1_5 Reverse -226 -245 12.5858 0.105
NP_441958.1_5 Forward -241 -231 2.53664 0.0409
NP_441958.1_5 Reverse -230 -240 2.43831 0.0422
NP_441958.1_5 Forward -305 -295 1.65166 0.0872
NP_442486.1_4 Forward -314 -295 7.17762 0.273
NP_442836.1_10 Reverse -333 -343 9.32148 0.277
NP_442816.1_7 Reverse -107 -126 8.73709 0.238
NP_442690.1_1 Forward -138 -119 -16.7168 0.291
NP_440153.1_5 Forward -303 -289 3.24451 0.217
NP_443055.1_6 Reverse -223 -241 2.77167 0.203
NP_440993.1_2 Forward -222 -206 2.71347 0.262
NP_440993.1_3 Forward -250 -231 4.71854 0.161
NP_441099.1_5 Reverse -221 -240 -11.3086 0.276
NP_442002.1_9 Reverse -294 -301 9.67555 0.27
NP_441712.1_1 Forward -128 -109 12.13 0.251
NP_441294.1_7 Reverse -227 -241 8.77068 0.281
NP_442438.1_10 Reverse -290 -304 -0.0987402 0.248
NP_441000.1_1 Forward -22 -4 13.3937 0.184
NP_440147.1_4 Forward -242 -229 7.09911 0.0755
NP_440147.1_4 Forward -306 -293 6.01747 0.106
NP_440147.1_4 Reverse -229 -242 2.87088 0.202
NP_441295.1_4 Forward -245 -226 -3.83545 0.29
NP_441550.1_8 Forward -242 -232 9.51767 0.0926
NP_441550.1_8 Reverse -229 -239 5.78111 0.23
NP_441916.1_7 Forward -240 -230 8.73149 0.042
NP_441916.1_7 Reverse -307 -317 1.74999 0.275
NP_442396.1_5 Reverse -369 -382 5.91914 0.26
NP_441369.1_1 Forward -56 -37 38.7419 0.000000157
NP_441369.1_2 Forward -26 -7 38.9385 0.0000000955
NP_441369.1_3 Forward -73 -59 28.5156 0.00021
NP_441725.1_4 Forward -309 -295 7.27547 0.24
NP_442941.1_3 Reverse -296 -306 6.8632 0.0954
NP_442941.1_3 Reverse -232 -242 1.55333 0.15
NP_442941.1_3 Forward -239 -229 0.0783647 0.231
NP_440983.1_5 Reverse -231 -250 -1.37718 0.228
NP_440260.1_8 Reverse -141 -159 -3.02911 0.246
NP_442281.1_1 Reverse -226 -240 2.94893 0.249
NP_440437.1_1 Reverse -177 -196 -3.63879 0.242
NP_442012.1_1 Forward -322 -303 -1.47551 0.289
NP_441087.1_6 Reverse -149 -167 -2.83317 0.296
NP_442288.1_5 Forward -58 -44 16.7159 0.12
NP_441556.1_6 Forward -54 -36 12.4797 0.296
NP_441644.1_6 Reverse -295 -305 11.8776 0.0417
NP_441644.1_6 Reverse -231 -241 7.55106 0.123
NP_441644.1_6 Forward -240 -230 6.86274 0.144
NP_442215.1_2 Reverse -229 -245 16.7748 0.0154
NP_442215.1_2 Forward -285 -269 7.33503 0.0692
NP_442029.1_1 Forward -106 -87 -20.1584 0.297
NP_442247.1_5 Reverse -29 -43 14.4865 0.234
NP_440253.1_2 Forward -240 -222 5.82068 0.0889
NP_440253.1_2 Forward -304 -286 -0.964162 0.227
NP_440929.1_8 Forward -240 -231 9.53783 0.0296
NP_440929.1_8 Reverse -231 -240 9.4395 0.0326
NP_442933.1_10 Reverse -231 -240 13.9627 0.0192
NP_442933.1_10 Reverse -307 -316 8.1612 0.0885
NP_442933.1_10 Forward -240 -231 7.86621 0.103
NP_442933.1_10 Forward -304 -295 4.22796 0.267
NP_442671.1_2 Forward -48 -29 24.6829 0.000359
NP_440430.1_3 Forward -88 -70 13.7855 0.263
NP_442554.1_8 Reverse -232 -242 5.78156 0.138
NP_442554.1_8 Forward -239 -229 3.51995 0.222
NP_442970.1_1 Forward -46 -32 9.56081 0.269
NP_441762.1_7 Forward -241 -229 0.432302 0.0747
NP_441762.1_7 Reverse -230 -242 -0.256015 0.0768
NP_441762.1_7 Forward -305 -293 -7.04085 0.285
NP_442142.1_4 Reverse -92 -105 4.14862 0.231
NP_442292.1_1 Reverse -232 -241 9.04618 0.0226
NP_442292.1_1 Forward -239 -230 -0.0986038 0.239
NP_440421.1_1 Forward -249 -235 15.0442 0.213
NP_442381.1_8 Reverse -292 -311 -13.5702 0.276
NP_443009.1_5 Forward -305 -294 15.0044 0.0173
NP_443009.1_5 Forward -241 -230 9.10461 0.0965
NP_441715.1_4 Reverse -296 -306 14.238 0.0295
NP_441715.1_4 Forward -239 -229 9.41981 0.097
NP_442076.1_5 Forward -52 -33 9.93088 0.186
NP_440464.1_10 Reverse -232 -242 15.3 0.169
NP_441468.1_1 Reverse -232 -239 6.3323 0.202
NP_441468.1_1 Forward -239 -232 6.13563 0.209
NP_441020.2_6 Forward -242 -225 5.74204 0.291
NP_441015.1_10 Forward -171 -152 -9.047 0.278
NP_441673.1_1 Forward -240 -231 11.1111 0.0121
NP_441673.1_1 Reverse -231 -240 11.0128 0.018
NP_441673.1_1 Forward -304 -295 1.27803 0.155
NP_441673.1_1 Reverse -295 -304 1.27803 0.155
NP_441826.1_2 Reverse -289 -303 -2.55701 0.273
NP_441330.1_1 Forward -309 -290 -14.1602 0.214
NP_442868.1_6 Forward -242 -232 0.275027 0.243
NP_442719.1_2 Forward -134 -116 -0.571569 0.162
NP_442227.1_2 Reverse -151 -170 5.01433 0.202
NP_442808.1_1 Reverse -230 -240 8.82935 0.0481
NP_440871.1_3 Reverse -52 -66 15.905 0.166
NP_442775.1_1 Reverse -155 -174 10.1275 0.291
NP_440334.1_2 Reverse -180 -193 14.8673 0.226
NP_441048.1_6 Forward -127 -113 16.0543 0.296
NP_442789.1_4 Reverse -296 -315 -4.32711 0.259
NP_441878.1_6 Forward -241 -231 0.668351 0.139
NP_441878.1_6 Reverse -230 -240 0.57002 0.14
NP_441878.1_6 Reverse -294 -304 -7.59145 0.245
NP_441878.1_6 Forward -195 -185 -7.98478 0.285
NP_441036.1_8 Reverse -230 -240 8.92815 0.174
NP_441557.1_5 Forward -240 -231 10.2261 0.0144
NP_441557.1_5 Reverse -231 -240 10.1278 0.0188
NP_441557.1_5 Forward -304 -295 0.393051 0.166
NP_441557.1_5 Reverse -295 -304 0.393051 0.166
NP_442397.1_9 Forward -329 -310 2.85105 0.27
NP_442347.1_2 Reverse -232 -241 14.7494 0.056
NP_442347.1_2 Forward -239 -230 4.71961 0.266
NP_442347.1_2 Forward -303 -294 3.63797 0.284
NP_442645.1_2 Forward -248 -229 -22.42 0.291
NP_441633.1_3 Forward -306 -293 10.2457 0.0309
NP_441633.1_3 Forward -242 -229 6.31247 0.0481
NP_441633.1_3 Reverse -229 -242 1.19926 0.109
NP_440136.1_2 Reverse -232 -239 6.43063 0.154
NP_440136.1_2 Forward -239 -232 6.23397 0.171
NP_442998.1_5 Forward -88 -78 9.32148 0.243
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_442998.1_10 Reverse -233 -240 5.93897 0.206
NP_442998.1_10 Forward -238 -231 5.84064 0.235
NP_440899.1_8 Reverse -358 -377 -8.85033 0.258
NP_440899.1_8 Reverse -33 -52 -9.14533 0.258
NP_440299.1_1 Forward -244 -231 13.195 0.0319
NP_441799.1_1 Forward -244 -230 5.40719 0.21
NP_441799.1_1 Forward -308 -294 4.22722 0.261
NP_440087.1_9 Reverse -137 -156 17.4032 0.145
NP_441362.1_2 Forward -50 -31 5.55684 0.243
NP_441559.1_8 Reverse -290 -304 3.93283 0.136
NP_440915.1_6 Reverse -291 -305 -2.16369 0.26
NP_442158.1_4 Forward -201 -191 11.0914 0.282
NP_440537.1_7 Forward -72 -53 16.6629 0.0599
NP_442150.1_8 Reverse -121 -140 16.2306 0.265
NP_440787.1_5 Reverse -223 -237 10.816 0.256
NP_441113.1_3 Forward -96 -82 15.5352 0.235
NP_440695.1_6 Forward -363 -349 12.3505 0.26
NP_442386.1_9 Reverse -230 -239 6.29249 0.226
NP_442386.1_10 Reverse -339 -352 3.46087 0.273
NP_441340.1_5 Forward -239 -232 5.93897 0.198
NP_441340.1_5 Reverse -232 -239 5.84064 0.208
NP_442484.1_2 Forward -251 -232 21.6323 0.0161
NP_442240.1_2 Forward -303 -284 -9.93197 0.137
NP_440161.1_3 Reverse -293 -312 7.37428 0.299
NP_440586.1_8 Forward -239 -232 11.1501 0.0845
NP_440586.1_8 Forward -315 -308 10.7568 0.128
NP_442251.1_6 Forward -239 -232 13.7071 0.0268
NP_442251.1_6 Reverse -296 -303 10.3639 0.134
NP_440684.1_9 Reverse -225 -239 11.111 0.18
NP_443051.1_1 Forward -241 -232 0.688044 0.134
NP_443051.1_1 Reverse -230 -239 0.589713 0.143
NP_443051.1_1 Forward -305 -296 -0.000272808 0.245
NP_439937.1_9 Forward -305 -288 -17.268 0.296
NP_440408.1_7 Forward -387 -368 6.78429 0.299
NP_440439.1_1 Reverse -292 -305 -0.767364 0.236
NP_440372.1_2 Forward -239 -232 6.62729 0.151
NP_440372.1_2 Reverse -232 -239 6.52896 0.188
NP_440372.1_3 Forward -45 -31 15.0039 0.165
NP_440819.1_5 Forward -89 -81 7.8859 0.266
NP_441572.1_7 Reverse -173 -192 -5.9004 0.276
NP_442887.1_5 Forward -330 -311 -11.5053 0.264
NP_442384.1_10 Reverse -231 -244 16.6372 0.0078
NP_442384.1_10 Forward -240 -227 3.85419 0.176
NP_442384.1_10 Forward -304 -291 0.412608 0.291
NP_442339.1_1 Forward -363 -344 13.0766 0.204
NP_442085.1_1 Forward -130 -111 12.1748 0.278
NP_441604.1_4 Forward -277 -258 1.57275 0.211
NP_441877.1_7 Forward -309 -290 4.22689 0.218
NP_441877.1_7 Reverse -226 -245 1.17865 0.242
NP_441877.1_9 Forward -141 -124 3.67709 0.284
NP_441877.1_9 Reverse -115 -132 2.89044 0.285
NP_441877.1_9 Reverse -114 -131 1.90713 0.292
NP_441018.1_7 Reverse -322 -341 7.96426 0.259
NP_440344.1_10 Forward -247 -230 -8.90928 0.135
NP_440344.1_10 Reverse -224 -241 -11.0726 0.2
NP_442280.1_10 Forward -250 -232 5.94143 0.28
NP_441896.1_3 Reverse -286 -305 10.0292 0.0865
NP_442129.1_6 Forward -47 -28 13.9464 0.246
NP_440834.1_6 Reverse -334 -353 11.5042 0.206
NP_440999.1_9 Reverse -291 -305 -0.197071 0.201
NP_440999.1_9 Reverse -85 -99 -2.45868 0.27
NP_440999.1_9 Reverse -227 -241 -3.04867 0.283
NP_440888.1_2 Reverse -231 -245 11.012 0.0783
NP_440888.1_2 Forward -304 -290 7.66879 0.186
NP_440792.1_5 Forward -239 -220 10.4225 0.237
NP_440052.1_5 Forward -251 -232 -2.85214 0.221
NP_442033.1_10 Reverse -155 -174 -9.44032 0.215
NP_441949.1_2 Reverse -221 -240 2.55606 0.261
NP_441543.1_2 Forward -239 -230 15.4377 0.00784
NP_441543.1_2 Reverse -232 -241 7.07956 0.131
NP_442845.1_2 Forward -246 -232 4.03116 0.271
NP_442710.1_7 Forward -49 -30 -7.22274 0.294
NP_441469.1_8 Reverse -230 -239 6.68623 0.227
NP_443064.1_6 Reverse -295 -305 11.1125 0.13
NP_443064.1_6 Forward -240 -230 8.6886 0.276
NP_442578.1_7 Forward -239 -232 12.5271 0.0544
NP_441462.1_2 Forward -240 -230 1.84832 0.081
NP_441462.1_2 Reverse -231 -241 1.74999 0.0811
NP_441462.1_2 Reverse -295 -305 0.668351 0.135
NP_443062.1_1 Reverse -231 -249 4.45062 0.26
NP_440516.1_8 Forward -240 -231 7.17789 0.0754
NP_440516.1_8 Reverse -231 -240 7.07956 0.0867
NP_442428.1_5 Reverse -232 -239 13.1171 0.038
NP_442428.1_5 Forward -239 -232 6.23397 0.201
NP_442120.1_6 Reverse -288 -307 6.4893 0.142
NP_440673.1_3 Reverse -233 -240 10.1672 0.149
NP_441052.1_2 Reverse -231 -241 17.6796 0.00337
NP_441052.1_2 Forward -240 -230 7.45319 0.0712
NP_442219.1_9 Reverse -232 -241 14.5527 0.0295
NP_440436.1_4 Forward -239 -230 8.65242 0.0997
NP_440436.1_4 Reverse -232 -241 7.37413 0.132
NP_441893.1_10 Forward -173 -154 11.8975 0.232
NP_442864.1_2 Reverse -232 -251 13.0775 0.227
NP_440648.1_6 Reverse -68 -87 10.9134 0.174
NP_441719.1_4 Forward -239 -232 6.62729 0.151
NP_441719.1_4 Reverse -232 -239 6.52896 0.188
NP_441733.1_10 Forward -385 -372 4.8375 0.24
NP_442366.1_3 Reverse -230 -248 -2.63579 0.231
NP_442366.1_5 Forward -243 -233 14.5325 0.0497
NP_442694.1_4 Reverse -207 -216 12.8811 0.239
NP_442694.1_8 Reverse -32 -50 12.3105 0.191
NP_443054.1_2 Reverse -183 -197 3.53951 0.24
NP_443054.1_2 Forward -306 -292 1.37622 0.247
NP_441851.1_10 Reverse -230 -240 6.66654 0.159
NP_441851.1_10 Forward -241 -231 6.46988 0.167
NP_441851.1_10 Reverse -294 -304 4.99491 0.233
NP_441668.1_4 Forward -250 -231 1.47442 0.214
NP_442515.1_1 Forward -241 -227 4.71948 0.107
NP_441396.1_5 Forward -103 -94 7.47288 0.252
NP_440593.1_3 Forward -245 -226 1.0811 0.19
NP_441982.1_10 Reverse -4 -23 8.55343 0.143
NP_442689.1_8 Reverse -32 -49 -8.61428 0.294
NP_441349.1_10 Forward -250 -231 -7.76869 0.258
NP_440432.1_9 Forward -239 -224 -1.29841 0.167
NP_440432.1_9 Reverse -296 -311 -3.95334 0.194
NP_440474.1_8 Forward -239 -225 4.52221 0.276
NP_441124.1_5 Forward -53 -43 12.7217 0.215
NP_440431.1_3 Forward -317 -298 -1.27885 0.155
NP_442450.1_5 Reverse -229 -239 5.48657 0.242
NP_440588.1_2 Forward -249 -230 1.47442 0.137
NP_441078.1_4 Forward -240 -231 10.1278 0.016
NP_441078.1_4 Reverse -231 -240 9.83282 0.0226
NP_441078.1_4 Reverse -295 -304 0.786375 0.157
NP_441078.1_4 Forward -304 -295 0.589713 0.174
NP_442729.1_8 Forward -244 -231 9.06573 0.125
NP_442348.1_2 Reverse -340 -349 11.8978 0.225
NP_442348.1_2 Reverse -207 -216 6.78456 0.299
NP_441432.1_8 Forward -241 -232 13.7661 0.0281
NP_441432.1_8 Forward -305 -296 7.96454 0.0953
NP_441333.1_1 Forward -139 -129 10.8273 0.293
NP_442320.1_8 Forward -246 -232 4.03116 0.0559
NP_442320.1_8 Reverse -225 -239 -4.91696 0.192
NP_440760.1_1 Reverse -185 -204 -13.7669 0.112
NP_440578.1_10 Reverse -209 -228 9.24257 0.286
NP_442489.1_2 Reverse -226 -245 2.94938 0.254
NP_442489.1_7 Forward -240 -231 10.4228 0.0151
NP_442489.1_7 Reverse -231 -240 10.3245 0.0193
NP_442489.1_7 Reverse -295 -304 7.86621 0.0448
NP_442489.1_7 Forward -304 -295 0.589713 0.17
NP_440559.1_1 Reverse -232 -241 7.57121 0.106
NP_441659.2_8 Reverse -231 -241 8.33817 0.0443
NP_441659.2_8 Forward -240 -230 2.24165 0.207
NP_441659.2_8 Reverse -295 -305 1.35667 0.242
NP_442346.1_5 Forward -241 -231 13.353 0.0261
NP_442346.1_5 Forward -305 -295 9.12481 0.118
NP_442346.1_5 Reverse -340 -350 4.60159 0.281
NP_442346.1_5 Reverse -230 -240 4.60159 0.281
NP_442346.1_10 Reverse -146 -165 -3.44213 0.294
NP_440459.1_2 Reverse -229 -246 11.2486 0.18
NP_442603.1_7 Reverse -231 -245 11.2087 0.119
NP_441502.1_5 Forward -93 -74 12.4875 0.221
NP_441833.1_3 Forward -372 -358 16.2242 0.213
NP_441833.1_4 Reverse -232 -239 6.3323 0.134
NP_441833.1_4 Forward -239 -232 6.23397 0.163
NP_442162.1_9 Forward -239 -232 6.52896 0.178
NP_442162.1_9 Reverse -232 -239 6.43063 0.208
NP_442404.1_9 Forward -301 -287 11.1104 0.263
NP_442943.1_1 Reverse -119 -134 5.30681 0.211
NP_442943.1_1 Reverse -104 -119 5.0197 0.216
NP_442045.1_5 Reverse -154 -173 -1.86883 0.29
NP_442073.1_8 Reverse -126 -145 9.7334 0.241
NP_442199.1_5 Forward -312 -293 0.982764 0.165
NP_442140.1_3 Forward -239 -229 6.46988 0.168
NP_440875.1_9 Forward -302 -292 7.20399 0.277
NP_441813.1_5 Reverse -229 -239 0.0783647 0.222
NP_440590.1_4 Reverse -232 -245 8.27909 0.0466
NP_440590.1_4 Forward -303 -290 4.93583 0.0585
NP_440590.1_4 Reverse -286 -299 -5.09393 0.274
NP_440567.1_1 Reverse -232 -246 3.53951 0.141
NP_442497.1_10 Forward -239 -230 0.688044 0.141
NP_442497.1_10 Reverse -232 -241 0.589713 0.153
NP_440821.1_4 Reverse -229 -239 0.57002 0.169
NP_440821.1_4 Forward -242 -232 -0.314959 0.251
NP_440821.1_4 Reverse -293 -303 -0.806614 0.296
NP_441239.1_9 Forward -306 -294 4.07055 0.264
NP_440156.1_4 Reverse -77 -87 15.8108 0.176
NP_441892.1_1 Forward -325 -308 -0.846137 0.192
NP_440945.1_1 Reverse -345 -364 6.19431 0.292
NP_441541.1_1 Forward -36 -18 -3.43572 0.264
NP_441541.1_1 Forward -140 -122 -3.91318 0.27
NP_440546.1_4 Forward -276 -266 8.20381 0.199
NP_440675.1_3 Forward -240 -221 9.83255 0.186
NP_440462.1_6 Forward -384 -374 4.10993 0.216
NP_440374.1_6 Forward -272 -253 11.9958 0.174
NP_441582.1_5 Forward -242 -223 8.06178 0.164
NP_441848.1_4 Forward -135 -119 15.6675 0.154
NP_441848.1_4 Reverse -119 -135 8.60108 0.288
NP_440653.1_10 Reverse -232 -251 14.1591 0.104
NP_440696.1_3 Forward -256 -238 -2.43913 0.274
NP_440825.1_7 Reverse -232 -242 12.812 0.155
NP_442696.1_6 Forward -354 -335 -3.83545 0.155
NP_442837.1_3 Reverse -232 -239 13.5105 0.0268
NP_442837.1_3 Forward -239 -232 6.13563 0.25
NP_442053.1_1 Forward -240 -231 8.75118 0.0728
NP_442053.1_1 Reverse -231 -240 8.65285 0.0741
NP_440505.1_3 Forward -306 -296 6.37155 0.183
NP_440351.1_1 Reverse -187 -206 5.89931 0.067
NP_441959.1_8 Forward -46 -33 8.61288 0.286
NP_440914.1_1 Reverse -231 -241 7.83437 0.219
NP_440914.1_1 Forward -240 -230 6.76087 0.267
NP_441011.1_8 Forward -239 -230 7.27622 0.179
NP_441011.1_8 Reverse -232 -241 5.50626 0.256
NP_442533.1_6 Forward -240 -231 14.651 0.01
NP_442533.1_6 Reverse -231 -240 7.37455 0.0898
NP_442533.1_6 Reverse -295 -304 5.40793 0.14
NP_442533.1_6 Reverse -185 -194 2.65466 0.246
NP_440854.1_5 Forward -128 -114 17.1047 0.274
NP_441028.1_6 Reverse -387 -397 7.74772 0.218
NP_441028.1_6 Reverse -90 -100 5.48612 0.255
NP_440116.1_8 Reverse -232 -251 -3.04881 0.145
NP_439965.1_1 Forward -249 -230 2.45773 0.112
NP_441170.1_4 Reverse -141 -159 1.88744 0.296
NP_441972.1_5 Reverse -232 -251 2.3594 0.121
NP_441106.1_1 Reverse -230 -239 8.35786 0.0585
NP_440429.1_9 Forward -211 -192 1.86774 0.278
NP_441286.1_1 Forward -241 -229 -3.6976 0.146
NP_441286.1_1 Reverse -230 -242 -6.45087 0.265
NP_440670.1_8 Forward -240 -231 8.84951 0.0606
NP_440670.1_8 Reverse -231 -240 8.55452 0.066
NP_440670.1_8 Reverse -295 -304 5.60459 0.149
NP_440886.1_7 Reverse -230 -240 7.94438 0.0805
NP_440886.1_7 Reverse -294 -304 7.35439 0.0966
NP_440886.1_7 Forward -241 -231 7.35439 0.0966
NP_439940.1_1 Forward -74 -55 31.957 0.00000438
NP_442072.1_9 Forward -277 -259 -15.6155 0.184
NP_440907.2_8 Forward -239 -229 5.09279 0.222
NP_441021.1_1 Reverse -296 -315 -12.3902 0.286
NP_441463.1_3 Forward -314 -295 7.86593 0.0503
NP_441463.1_3 Reverse -221 -240 1.17943 0.127
NP_441626.1_2 Forward -239 -232 6.0373 0.212
NP_441626.1_2 Reverse -232 -239 5.93897 0.231
NP_442794.1_1 Forward -244 -232 9.38042 0.0795
NP_442615.1_1 Forward -249 -231 6.50899 0.0344
NP_442615.1_1 Reverse -222 -240 -3.32411 0.159
NP_440387.1_1 Forward -240 -224 6.15506 0.0288
NP_441431.1_1 Reverse -31 -49 5.06306 0.245
NP_441488.1_7 Forward -310 -291 4.42435 0.188
NP_441488.1_8 Forward -245 -231 8.65209 0.179
NP_441836.1_2 Forward -356 -337 -5.9004 0.288
NP_440634.1_6 Reverse -184 -198 14.6509 0.28
NP_440422.1_2 Forward -364 -345 21.6323 0.0387
NP_442743.1_4 Forward -303 -284 -7.08038 0.279
NP_442930.1_1 Forward -127 -117 13.0576 0.239
NP_439910.1_2 Reverse -223 -240 -21.6923 0.184
NP_440142.1_7 Forward -364 -345 9.0459 0.214
NP_442509.1_9 Forward -304 -294 13.0576 0.0661
NP_442509.1_9 Reverse -231 -241 8.04271 0.192
NP_442509.1_9 Forward -240 -230 7.15773 0.234
NP_442509.1_9 Forward -217 -207 6.96107 0.244
NP_441885.1_5 Reverse -231 -241 11.0914 0.00874
NP_441885.1_5 Forward -240 -230 2.04498 0.0868
NP_442341.1_7 Forward -241 -227 8.45605 0.0881
NP_442341.1_7 Reverse -230 -244 7.9644 0.0956
NP_442341.1_7 Forward -305 -291 2.16287 0.267
NP_440191.1_6 Reverse -123 -137 17.2957 0.294
NP_440191.1_6 Reverse -31 -45 13.1895 0.294
NP_443000.1_7 Forward -306 -296 7.74818 0.0666
NP_443000.1_7 Forward -242 -232 7.45319 0.0803
NP_442932.1_9 Forward -379 -360 7.37428 0.241
NP_442451.1_7 Forward -51 -32 12.9791 0.113
NP_440149.1_8 Forward -304 -285 -5.40875 0.226
NP_440216.1_1 Forward -240 -226 -4.32697 0.107
NP_440216.1_1 Reverse -295 -309 -4.7203 0.114
NP_440216.1_1 Reverse -231 -245 -10.6202 0.145
NP_440172.1_1 Reverse -295 -305 11.6814 0.0359
NP_440172.1_1 Forward -240 -230 5.87989 0.127
NP_440172.1_1 Reverse -231 -241 5.19158 0.149
NP_442290.1_8 Reverse -340 -354 15.0442 0.288
NP_442015.1_10 Forward -244 -231 8.37742 0.067
NP_442015.1_10 Reverse -291 -304 0.412608 0.227
NP_442015.1_10 Reverse -227 -240 -0.767364 0.281
NP_441045.1_6 Forward -314 -296 15.7513 0.284
NP_441111.1_7 Forward -239 -231 8.96754 0.0463
NP_441111.1_7 Reverse -232 -240 8.86921 0.0589
NP_441766.1_2 Forward -240 -231 7.86621 0.0703
NP_441766.1_2 Reverse -231 -240 7.66954 0.0723
NP_440416.1_9 Reverse -155 -174 -18.6834 0.262
NP_440416.1_9 Forward -247 -228 -18.8801 0.266
NP_442116.1_6 Reverse -30 -47 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTATGGCGGAAAGAAGAATGGATCGAGGAACAAGCGGAAAGTCTTAGGCAACCAAGGCCCCAATTCTACAAGCTAACAACCTAAGCCATCAATCAGGTAATCGCCGCCGATGTATCGGAGTCTACCCATAGGCTCTGGATTTGTGGACTCGTTTCCTTTGGCGATCACCGAATTGTTAGAGATAAAAACGCCCCTACTAATTTTGGGGGCCTGCCATTTTCAGTAGCATCGGAGGCAAGAGGGGAGTGTCAAACCGGGATAGTTTAGTTTTTAAAAAATTACCTTTTAAACAATTATCGATGGAGGTTAACGGGCAAAATGTTGATATAGTCATTTCAATTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACA

CDS

ATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAATAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAGAGCGTGTTTGA

Protein

MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPIKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALERV