Your browser is old and dusty. Try Google Chrome!

Details for ssr1114

ORF ssr1114
Accession NP_442875.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -57 -43 -0.885388 0.242
NP_441061.1_2 Reverse -50 -64 -1.18038 0.252
NP_440557.1_1 Forward -57 -38 3.24438 0.211
NP_440795.1_7 Forward -57 -50 14.6904 0.0123
NP_440795.1_7 Reverse -50 -57 14.6904 0.0123
NP_441418.1_6 Forward -58 -39 -18.7818 0.0837
NP_441418.1_6 Reverse -49 -68 -20.945 0.133
NP_441418.1_6 Forward -339 -320 -21.6334 0.156
NP_441418.1_6 Forward -238 -219 -24.485 0.2
NP_442291.1_5 Reverse -48 -64 -2.98973 0.232
NP_442272.1_2 Forward -264 -245 11.2199 0.232
NP_440897.1_6 Reverse -49 -68 16.2232 0.0255
NP_440897.1_6 Forward -331 -312 -1.96793 0.2
NP_441453.1_4 Reverse -49 -57 16.539 0.00633
NP_441453.1_4 Forward -58 -50 16.539 0.00633
NP_441453.1_4 Reverse -330 -338 4.93597 0.224
NP_442151.1_6 Forward -58 -44 6.19444 0.244
NP_441818.1_1 Reverse -50 -61 9.30127 0.246
NP_441818.1_6 Reverse -42 -56 8.35772 0.274
NP_441818.1_9 Forward -229 -210 -9.73531 0.291
NP_440226.1_1 Forward -58 -39 10.0292 0.0665
NP_440226.1_1 Reverse -330 -349 1.96607 0.282
NP_442169.1_1 Reverse -146 -165 -1.57384 0.265
NP_441630.1_3 Forward -347 -328 -0.000545616 0.285
NP_440150.1_6 Forward -61 -42 2.45773 0.27
NP_440996.1_2 Forward -198 -189 14.8477 0.248
NP_442173.1_1 Forward -57 -49 15.4574 0.00633
NP_442173.1_1 Reverse -50 -58 15.4574 0.00633
NP_442173.1_1 Forward -297 -289 9.1642 0.085
NP_442752.1_4 Forward -58 -51 13.8055 0.0199
NP_442752.1_4 Reverse -49 -56 13.8055 0.0199
NP_442752.1_4 Forward -339 -332 4.26735 0.293
NP_443027.1_4 Forward -60 -50 14.828 0.0437
NP_443027.1_4 Reverse -47 -57 7.25653 0.24
NP_443027.1_4 Forward -160 -150 5.78156 0.298
NP_441812.1_3 Forward -59 -45 6.88276 0.287
NP_442975.1_10 Forward -62 -48 13.1753 0.0459
NP_441675.1_8 Forward -140 -126 17.5018 0.289
NP_440784.1_7 Forward -57 -50 15.9687 0.0123
NP_440784.1_7 Reverse -50 -57 15.9687 0.0123
NP_441934.1_4 Reverse -101 -120 10.4225 0.237
NP_440061.1_9 Forward -170 -156 6.58715 0.239
NP_440110.1_4 Forward -69 -50 9.3409 0.125
NP_442062.1_8 Reverse -49 -59 19.4496 0.000558
NP_442062.1_8 Forward -58 -48 10.3048 0.0493
NP_442062.1_8 Forward -331 -321 4.3066 0.221
NP_442062.1_8 Forward -298 -288 3.61828 0.26
NP_440304.1_4 Forward -60 -50 10.8948 0.051
NP_440304.1_4 Reverse -47 -57 10.8948 0.051
NP_440304.1_4 Reverse -287 -297 5.38824 0.211
NP_440304.1_4 Reverse -114 -124 2.04498 0.299
NP_442242.1_1 Reverse -137 -156 16.2148 0.28
NP_442242.1_1 Forward -61 -42 16.2148 0.28
NP_442242.1_4 Forward -57 -50 14.3954 0.0124
NP_442242.1_4 Reverse -50 -57 14.3954 0.0124
NP_442242.1_4 Forward -297 -290 10.7572 0.153
NP_440044.1_8 Reverse -50 -69 12.3892 0.0427
NP_441208.1_9 Reverse -46 -60 14.7492 0.093
NP_442196.1_4 Reverse -206 -225 14.8474 0.263
NP_442276.1_2 Reverse -318 -337 4.03102 0.299
NP_440132.1_1 Forward -60 -42 19.1937 0.0283
NP_442110.1_7 Reverse -49 -63 1.57289 0.222
NP_442896.1_3 Forward -316 -302 14.7492 0.244
NP_440856.1_4 Forward -346 -327 -1.27885 0.195
NP_441083.1_5 Forward -339 -329 14.238 0.0159
NP_441083.1_5 Reverse -49 -59 11.3864 0.0159
NP_441083.1_5 Forward -58 -48 11.2881 0.0159
NP_441083.1_5 Reverse -330 -340 0.373358 0.231
NP_439957.1_9 Reverse -348 -367 2.7211 0.3
NP_442827.1_8 Forward -347 -328 0.981987 0.191
NP_442841.1_10 Reverse -48 -67 14.6508 0.124
NP_441434.1_1 Forward -316 -302 7.26901 0.287
NP_441738.1_2 Forward -56 -49 15.28 0.0102
NP_441738.1_2 Reverse -51 -58 15.28 0.0102
NP_441738.1_2 Forward -122 -115 6.72528 0.236
NP_440209.1_1 Reverse -49 -57 18.1123 0.00295
NP_440209.1_1 Forward -58 -50 18.1123 0.00295
NP_441444.1_1 Reverse -304 -323 5.80098 0.26
NP_442889.1_1 Forward -175 -156 -13.9635 0.271
NP_442889.1_1 Reverse -153 -172 -14.0619 0.271
NP_442889.1_1 Reverse -163 -182 -15.5368 0.296
NP_442889.1_8 Forward -61 -47 4.12889 0.27
NP_441713.1_1 Reverse -43 -62 -3.14714 0.113
NP_441713.1_3 Reverse -140 -159 2.3594 0.277
NP_440178.1_7 Reverse -329 -348 -12.7836 0.124
NP_442059.1_10 Forward -278 -259 15.2408 0.126
NP_441716.1_1 Reverse -49 -63 6.88276 0.186
NP_443013.1_8 Reverse -38 -56 8.18062 0.258
NP_442111.1_4 Reverse -48 -62 12.8809 0.0413
NP_442111.1_4 Forward -59 -45 1.86788 0.293
NP_441163.1_1 Forward -66 -49 8.00291 0.233
NP_440906.1_5 Forward -57 -50 15.8704 0.0124
NP_440906.1_5 Reverse -50 -57 15.8704 0.0124
NP_440747.1_10 Reverse -46 -58 15.2803 0.0019
NP_440747.1_10 Forward -61 -49 -2.02597 0.0196
NP_440747.1_10 Forward -342 -330 -4.18925 0.0817
NP_442973.1_5 Forward -67 -48 15.5357 0.113
NP_441486.1_1 Forward -61 -47 14.0609 0.00683
NP_441486.1_1 Reverse -46 -60 2.35953 0.0844
NP_440944.1_2 Reverse -147 -166 -3.24547 0.287
NP_442634.1_4 Reverse -328 -342 2.75286 0.129
NP_442634.1_4 Forward -60 -46 -1.18038 0.149
NP_442634.1_4 Reverse -47 -61 -2.36035 0.149
NP_441265.1_6 Forward -280 -261 20.1564 0.0786
NP_441014.1_5 Forward -154 -136 13.4905 0.209
NP_442848.1_1 Forward -64 -50 -3.04867 0.263
NP_442848.1_4 Reverse -263 -277 7.66941 0.282
NP_443018.1_3 Forward -57 -50 14.8871 0.0123
NP_443018.1_3 Reverse -50 -57 14.8871 0.0123
NP_443018.1_3 Forward -330 -323 7.6106 0.156
NP_441316.1_7 Forward -60 -45 22.596 0.0143
NP_441634.1_1 Reverse -44 -63 -3.14714 0.275
NP_441634.1_5 Reverse -259 -273 15.2409 0.262
NP_441634.1_8 Reverse -47 -61 -3.63866 0.295
NP_440376.1_1 Forward -58 -49 19.4693 0.000692
NP_440376.1_1 Reverse -49 -58 19.4693 0.000692
NP_440376.1_1 Forward -339 -330 5.99792 0.111
NP_440376.1_1 Reverse -330 -339 -0.000272808 0.285
NP_441588.1_4 Forward -56 -46 7.05986 0.178
NP_442730.1_8 Forward -347 -328 4.32522 0.273
NP_442687.1_1 Forward -315 -302 12.5067 0.272
NP_442687.1_7 Forward -59 -49 15.8113 0.0125
NP_442687.1_7 Reverse -48 -58 9.02648 0.0994
NP_442687.1_7 Reverse -329 -339 7.74818 0.125
NP_442191.1_4 Reverse -50 -64 11.9627 0.233
NP_441846.1_10 Reverse -106 -125 -22.2233 0.257
NP_440042.1_2 Reverse -320 -339 10.7175 0.153
NP_441029.1_7 Reverse -334 -353 10.9142 0.237
NP_442296.1_9 Reverse -50 -69 -1.7705 0.214
NP_442658.1_1 Forward -60 -50 15.9091 0.00966
NP_442658.1_1 Reverse -47 -57 13.0576 0.04
NP_442198.1_3 Forward -70 -51 3.14605 0.294
NP_440141.1_8 Forward -230 -211 10.7175 0.208
NP_440141.1_8 Reverse -220 -239 6.98095 0.251
NP_442782.1_2 Reverse -49 -63 0.294584 0.291
NP_442205.1_9 Forward -64 -48 -2.30141 0.268
NP_441414.1_9 Reverse -49 -68 1.86774 0.0705
NP_441414.1_9 Forward -58 -39 -2.65548 0.12
NP_441256.1_1 Forward -61 -42 -7.67036 0.239
NP_442937.1_5 Reverse -284 -303 9.53756 0.187
NP_442937.1_5 Reverse -142 -161 6.78429 0.27
NP_441317.1_4 Reverse -256 -270 17.0077 0.136
NP_441317.1_4 Reverse -257 -271 12.0422 0.236
NP_441958.1_5 Reverse -48 -58 21.2195 0.000805
NP_441958.1_5 Forward -59 -49 12.2714 0.00183
NP_441958.1_5 Forward -340 -330 9.22315 0.0233
NP_441958.1_5 Reverse -329 -339 0.865012 0.12
NP_442486.1_1 Forward -61 -42 17.4424 0.212
NP_440203.1_5 Forward -55 -45 11.091 0.205
NP_440984.1_7 Reverse -44 -58 9.43936 0.127
NP_440984.1_7 Forward -63 -49 4.52282 0.299
NP_442911.1_2 Forward -68 -49 15.8307 0.0103
NP_442911.1_2 Reverse -39 -58 -3.44213 0.112
NP_440153.1_5 Reverse -50 -64 11.5043 0.0763
NP_442064.1_1 Reverse -44 -63 -0.590531 0.146
NP_443055.1_6 Reverse -322 -340 0.608397 0.241
NP_443055.1_6 Forward -124 -106 0.116744 0.249
NP_440993.1_3 Reverse -39 -58 -2.36125 0.299
NP_440602.1_2 Reverse -154 -173 1.27776 0.263
NP_441099.1_5 Reverse -320 -339 -2.16383 0.118
NP_442002.1_9 Forward -59 -52 10.7572 0.185
NP_440809.1_9 Forward -67 -49 -7.45401 0.225
NP_441294.1_7 Forward -62 -48 14.53 0.0409
NP_441294.1_7 Reverse -52 -66 10.1145 0.207
NP_440411.1_10 Forward -31 -12 11.2376 0.265
NP_442438.1_10 Forward -63 -49 21.3374 0.01
NP_441000.1_6 Reverse -48 -62 4.71948 0.0933
NP_441674.1_5 Reverse -51 -70 -0.688862 0.152
NP_440147.1_4 Forward -341 -328 17.8172 0.00568
NP_440147.1_4 Reverse -47 -60 11.6223 0.0326
NP_440147.1_4 Forward -60 -47 2.87088 0.202
NP_440147.1_4 Reverse -287 -300 2.57589 0.207
NP_440147.1_4 Reverse -320 -333 0.904263 0.244
NP_441550.1_8 Reverse -328 -338 16.3025 0.0132
NP_441550.1_8 Reverse -47 -57 15.3192 0.0132
NP_441550.1_8 Forward -341 -331 8.92768 0.112
NP_441550.1_8 Forward -60 -50 6.0761 0.214
NP_441916.1_7 Forward -58 -48 18.9579 0.00144
NP_441916.1_7 Reverse -49 -59 18.4663 0.00144
NP_441916.1_10 Reverse -227 -246 3.14605 0.236
NP_441041.1_4 Reverse -330 -349 -0.590531 0.0958
NP_441041.1_7 Reverse -46 -58 14.4144 0.0348
NP_441041.1_7 Forward -171 -159 6.543 0.206
NP_442396.1_5 Forward -62 -49 5.91914 0.26
NP_440569.1_10 Reverse -264 -283 3.29405 0.278
NP_441547.1_2 Forward -69 -51 7.19731 0.215
NP_442004.1_6 Reverse -49 -63 2.85119 0.255
NP_442004.1_6 Forward -58 -44 2.45787 0.264
NP_441725.1_4 Reverse -44 -58 3.04726 0.279
NP_441725.1_5 Reverse -50 -60 11.2881 0.0247
NP_441725.1_5 Forward -237 -227 2.83163 0.115
NP_441725.1_5 Forward -57 -47 1.94665 0.115
NP_441725.1_5 Forward -338 -328 -0.708283 0.267
NP_439966.1_7 Forward -60 -50 18.4657 0.00473
NP_439966.1_7 Reverse -47 -57 6.27276 0.185
NP_439966.1_9 Forward -60 -51 0.983037 0.253
NP_442941.1_3 Reverse -50 -60 11.4848 0.0116
NP_442941.1_3 Forward -57 -47 11.0914 0.0116
NP_440289.1_2 Forward -61 -48 5.13249 0.0636
NP_442281.1_1 Reverse -44 -58 17.6985 0.00542
NP_442281.1_1 Forward -63 -49 3.14559 0.243
NP_440177.1_9 Forward -72 -53 11.3075 0.277
NP_440177.1_9 Forward -252 -233 10.7175 0.299
NP_442256.1_2 Reverse -328 -346 -8.53565 0.227
NP_440647.1_9 Reverse -328 -346 5.82068 0.23
NP_442012.1_1 Reverse -43 -62 3.04771 0.188
NP_440498.1_1 Reverse -40 -58 6.70565 0.0845
NP_440498.1_1 Forward -67 -49 -0.964162 0.222
NP_442982.1_5 Reverse -39 -58 -2.65548 0.287
NP_440375.1_8 Reverse -331 -350 -1.7705 0.293
NP_441644.1_6 Forward -58 -48 19.0557 0.000803
NP_441644.1_6 Reverse -49 -59 10.1076 0.0628
NP_441644.1_6 Reverse -330 -340 8.92768 0.0895
NP_442215.1_2 Reverse -204 -220 3.10679 0.102
NP_442215.1_2 Reverse -47 -63 -3.18639 0.211
NP_442215.1_2 Forward -60 -44 -3.8747 0.223
NP_442247.1_8 Reverse -47 -61 9.43936 0.247
NP_440253.1_2 Reverse -289 -307 -0.472507 0.212
NP_440929.1_8 Forward -58 -49 19.2726 0.000701
NP_440929.1_8 Reverse -49 -58 19.2726 0.000701
NP_440929.1_8 Reverse -330 -339 6.68623 0.0887
NP_442933.1_10 Forward -58 -49 17.601 0.00325
NP_442933.1_10 Reverse -49 -58 17.601 0.00325
NP_442933.1_10 Reverse -330 -339 4.42462 0.246
NP_442648.1_4 Forward -229 -210 6.29264 0.18
NP_441751.2_8 Forward -57 -43 6.3911 0.0354
NP_442554.1_8 Forward -57 -47 16.4013 0.0065
NP_442554.1_8 Reverse -50 -60 13.8447 0.0145
NP_442554.1_8 Forward -297 -287 6.17489 0.125
NP_442554.1_8 Forward -338 -328 4.89658 0.168
NP_442554.1_8 Reverse -323 -333 4.69992 0.176
NP_442554.1_9 Forward -32 -13 20.7953 0.0277
NP_442970.1_1 Forward -279 -265 8.79688 0.296
NP_441762.1_7 Forward -59 -47 9.47875 0.0142
NP_441762.1_7 Reverse -48 -60 2.98891 0.0676
NP_441762.1_7 Forward -299 -287 -5.95921 0.258
NP_442142.1_4 Reverse -46 -59 14.1783 0.0311
NP_442142.1_4 Forward -61 -48 8.57349 0.112
NP_442292.1_1 Forward -57 -48 17.5026 0.00435
NP_442292.1_1 Reverse -50 -59 9.63616 0.0183
NP_442292.1_1 Forward -297 -288 6.5879 0.101
NP_442476.1_6 Reverse -50 -64 4.81781 0.142
NP_442381.1_8 Reverse -319 -338 -15.1435 0.298
NP_443009.1_5 Reverse -48 -59 19.626 0.00102
NP_443009.1_5 Forward -59 -48 7.82632 0.118
NP_443009.1_5 Reverse -288 -299 6.94134 0.144
NP_443009.1_5 Reverse -158 -169 6.54802 0.157
NP_443009.1_5 Reverse -329 -340 3.49977 0.292
NP_442301.1_2 Reverse -18 -37 16.3215 0.0927
NP_442408.2_1 Forward -58 -39 6.19431 0.143
NP_441715.1_4 Reverse -50 -60 16.303 0.0117
NP_441715.1_4 Forward -57 -47 7.35486 0.108
NP_440357.1_3 Forward -240 -221 0.0977854 0.285
NP_440158.1_8 Forward -31 -12 18.3873 0.084
NP_440183.1_1 Forward -240 -221 7.37428 0.262
NP_441198.1_8 Reverse -47 -57 12.783 0.116
NP_441468.1_1 Forward -57 -50 15.8704 0.0124
NP_441468.1_1 Reverse -50 -57 15.8704 0.0124
NP_441020.2_6 Forward -60 -43 19.5084 0.0076
NP_441020.2_6 Reverse -47 -64 7.41366 0.232
NP_441015.1_10 Reverse -44 -63 -1.57384 0.174
NP_441673.1_1 Forward -58 -49 20.8459 0.000698
NP_441673.1_1 Reverse -49 -58 20.8459 0.000698
NP_441673.1_1 Forward -339 -330 1.37636 0.114
NP_441673.1_1 Reverse -330 -339 1.1797 0.163
NP_441016.2_6 Reverse -16 -35 4.91521 0.292
NP_441876.1_9 Forward -232 -222 13.8442 0.267
NP_441826.1_2 Forward -64 -50 10.4227 0.0475
NP_441826.1_2 Forward -244 -230 -0.590395 0.215
NP_441330.1_1 Forward -336 -317 -5.50708 0.124
NP_442490.1_9 Forward -70 -51 1.76941 0.165
NP_442868.1_6 Reverse -287 -297 4.60159 0.171
NP_442868.1_6 Forward -60 -50 0.963343 0.205
NP_442868.1_6 Reverse -47 -57 0.963343 0.205
NP_442719.1_2 Forward -307 -289 -11.7812 0.296
NP_441612.1_2 Forward -321 -311 8.83972 0.21
NP_442808.1_1 Forward -59 -49 18.4657 0.00201
NP_442808.1_1 Reverse -48 -58 8.73102 0.0481
NP_442808.1_1 Reverse -60 -70 1.65123 0.282
NP_442050.1_5 Reverse -47 -57 9.22267 0.193
NP_442050.1_5 Forward -60 -50 9.12434 0.193
NP_441114.1_3 Forward -167 -158 7.27622 0.247
NP_441114.1_3 Forward -148 -139 6.39124 0.277
NP_440558.1_2 Forward -241 -222 -6.1954 0.272
NP_442789.1_4 Forward -60 -41 -6.98204 0.289
NP_441878.1_1 Forward -168 -149 17.8254 0.23
NP_441878.1_6 Reverse -48 -58 10.5014 0.0176
NP_441878.1_6 Forward -59 -49 10.4031 0.0176
NP_441878.1_6 Reverse -329 -339 0.57002 0.14
NP_441878.1_6 Reverse -133 -143 -7.98478 0.285
NP_441036.1_8 Forward -59 -49 17.7779 0.000554
NP_441036.1_8 Reverse -48 -58 15.713 0.00724
NP_441036.1_8 Forward -299 -289 6.17489 0.242
NP_442721.1_3 Reverse -206 -225 15.2408 0.209
NP_441557.1_4 Reverse -352 -366 13.4709 0.291
NP_441557.1_5 Forward -58 -49 19.9609 0.000699
NP_441557.1_5 Reverse -49 -58 19.9609 0.000699
NP_441557.1_5 Forward -339 -330 0.491382 0.144
NP_441557.1_5 Reverse -330 -339 0.29472 0.174
NP_441557.1_5 Reverse -289 -298 -0.885252 0.26
NP_441445.1_1 Forward -46 -27 0.58944 0.272
NP_441590.1_3 Forward -246 -227 10.5209 0.205
NP_442066.2_9 Forward -302 -289 6.50913 0.284
NP_441433.1_8 Forward -106 -87 0.58944 0.239
NP_442241.1_9 Forward -358 -339 9.24257 0.286
NP_441308.1_8 Forward -60 -50 10.1081 0.22
NP_440101.1_3 Forward -63 -44 3.73603 0.224
NP_442830.1_5 Forward -117 -103 -1.77094 0.299
NP_440762.1_10 Forward -318 -300 17.2271 0.094
NP_442183.1_1 Forward -58 -44 10.9143 0.078
NP_442183.1_1 Forward -298 -284 9.5377 0.0966
NP_442183.1_1 Forward -339 -325 5.30946 0.223
NP_441574.1_1 Forward -241 -222 -7.27704 0.286
NP_441549.1_9 Reverse -45 -63 -5.29072 0.198
NP_441467.1_10 Reverse -258 -272 5.99778 0.281
NP_442347.1_2 Reverse -50 -59 11.1111 0.056
NP_442347.1_2 Reverse -331 -340 3.44131 0.284
NP_442347.1_2 Forward -57 -48 3.34298 0.284
NP_441037.1_4 Reverse -47 -57 15.0168 0.028
NP_441037.1_4 Forward -60 -50 7.02532 0.237
NP_442594.1_8 Forward -46 -27 1.57275 0.299
NP_442047.1_2 Forward -227 -213 16.3225 0.161
NP_441633.1_3 Reverse -47 -60 1.29759 0.109
NP_441633.1_3 Forward -341 -328 1.19926 0.109
NP_441633.1_3 Forward -60 -47 -3.81562 0.177
NP_440136.1_2 Forward -57 -50 15.9687 0.0123
NP_440136.1_2 Reverse -50 -57 15.9687 0.0123
NP_440136.1_2 Forward -297 -290 3.97235 0.288
NP_442998.1_10 Forward -56 -49 15.5754 0.0102
NP_442998.1_10 Reverse -51 -58 15.5754 0.0102
NP_442998.1_10 Forward -296 -289 9.28223 0.117
NP_442998.1_10 Reverse -332 -339 5.93897 0.206
NP_440899.1_2 Reverse -38 -57 8.65176 0.192
NP_440899.1_8 Reverse -191 -210 -11.1119 0.296
NP_440299.1_1 Forward -62 -49 14.08 0.0259
NP_440299.1_1 Reverse -45 -58 3.46031 0.243
NP_441799.1_1 Reverse -45 -59 21.4351 0.0036
NP_441799.1_1 Forward -62 -48 14.7486 0.0222
NP_441007.1_10 Reverse -44 -57 10.5407 0.0656
NP_442201.1_10 Forward -69 -50 2.75272 0.0961
NP_442299.1_9 Forward -213 -196 18.0334 0.257
NP_442333.2_1 Forward -171 -152 -10.7186 0.296
NP_440256.1_1 Reverse -46 -65 25.1722 0.00147
NP_440256.1_1 Forward -334 -315 -6.58872 0.215
NP_441229.1_3 Forward -210 -198 17.0502 0.261
NP_441559.1_8 Forward -359 -345 2.2612 0.147
NP_441559.1_8 Forward -173 -159 0.687908 0.163
NP_441559.1_8 Forward -63 -49 0.196253 0.169
NP_441559.1_8 Reverse -154 -168 -0.393733 0.175
NP_441559.1_8 Forward -302 -288 -6.78525 0.279
NP_441559.1_8 Reverse -317 -331 -7.47356 0.294
NP_442756.1_2 Reverse -322 -341 2.94938 0.296
NP_441270.1_5 Forward -222 -203 10.8472 0.296
NP_440915.1_6 Reverse -318 -332 8.94771 0.0486
NP_440915.1_6 Forward -62 -48 4.22782 0.0986
NP_441179.1_9 Reverse -26 -36 9.71433 0.28
NP_442785.1_7 Reverse -47 -61 8.45605 0.297
NP_441866.1_4 Reverse -258 -271 16.7464 0.234
NP_441866.1_4 Reverse -247 -260 13.7312 0.273
NP_442967.1_10 Forward -150 -136 15.0239 0.286
NP_442866.1_1 Forward -63 -44 -3.04881 0.216
NP_441464.1_8 Forward -339 -325 12.6843 0.159
NP_441464.1_10 Reverse -262 -276 12.6843 0.201
NP_441939.1_3 Reverse -50 -69 5.50599 0.273
NP_441199.1_6 Forward -343 -324 8.75091 0.0985
NP_441199.1_6 Forward -62 -43 -0.983855 0.285
NP_440677.1_1 Reverse -40 -59 11.0125 0.163
NP_440677.1_6 Forward -67 -48 9.0459 0.27
NP_442386.1_9 Forward -59 -50 15.7322 0.0144
NP_442386.1_9 Reverse -61 -70 7.57079 0.219
NP_442386.1_9 Reverse -48 -57 6.39082 0.219
NP_440570.1_4 Forward -230 -212 0.609134 0.281
NP_441340.1_5 Forward -57 -50 15.6737 0.0124
NP_441340.1_5 Reverse -50 -57 15.6737 0.0124
NP_440327.1_6 Forward -241 -222 2.94938 0.285
NP_442240.1_1 Forward -246 -227 8.16011 0.239
NP_442240.1_2 Reverse -50 -69 -16.6185 0.247
NP_440161.1_3 Forward -60 -41 18.0924 0.0611
NP_440586.1_1 Forward -47 -28 -4.72043 0.278
NP_440586.1_8 Forward -57 -50 13.2151 0.026
NP_440586.1_8 Reverse -50 -57 13.2151 0.026
NP_442251.1_6 Forward -57 -50 15.2804 0.0124
NP_442251.1_6 Reverse -50 -57 15.2804 0.0124
NP_442251.1_6 Forward -297 -290 9.67555 0.174
NP_441262.1_3 Reverse -49 -56 14.7888 0.0223
NP_441262.1_3 Forward -58 -51 14.7888 0.0223
NP_443051.1_1 Reverse -48 -57 19.5676 0.00335
NP_443051.1_1 Forward -59 -50 10.4228 0.00754
NP_443051.1_1 Forward -340 -331 6.8829 0.066
NP_441232.1_10 Reverse -319 -338 8.06259 0.142
NP_439937.1_9 Reverse -48 -65 -6.64833 0.157
NP_439937.1_9 Forward -118 -101 -13.0398 0.279
NP_439937.1_9 Forward -332 -315 -13.2365 0.283
NP_440926.1_1 Forward -336 -317 5.99764 0.261
NP_440439.1_1 Forward -61 -48 17.5222 0.0105
NP_440439.1_1 Reverse -46 -59 9.2624 0.0465
NP_440439.1_1 Forward -342 -329 -0.767364 0.236
NP_439943.1_1 Forward -235 -216 -10.522 0.29
NP_439943.1_7 Reverse -154 -173 2.94938 0.29
NP_440372.1_2 Forward -57 -50 16.3621 0.0124
NP_440372.1_2 Reverse -50 -57 16.3621 0.0124
NP_440372.1_2 Forward -338 -331 4.07068 0.262
NP_440574.1_7 Reverse -255 -274 16.2241 0.112
NP_441789.1_7 Forward -348 -329 3.53858 0.196
NP_441293.1_3 Forward -274 -256 12.1295 0.291
NP_440316.1_10 Reverse -107 -117 6.8632 0.251
NP_441803.1_2 Reverse -44 -63 3.04771 0.197
NP_439977.1_5 Forward -304 -285 1.67108 0.19
NP_440139.1_1 Forward -64 -45 9.93006 0.0938
NP_441572.1_7 Reverse -43 -62 -3.83545 0.22
NP_441572.1_7 Forward -64 -45 -4.91709 0.245
NP_442384.1_10 Reverse -49 -62 16.3422 0.00854
NP_442384.1_10 Forward -58 -45 13.589 0.0195
NP_442384.1_10 Reverse -330 -343 2.2809 0.23
NP_441018.1_7 Reverse -45 -64 10.0292 0.218
NP_442262.1_10 Forward -57 -50 14.1988 0.0123
NP_442262.1_10 Reverse -50 -57 14.1988 0.0123
NP_442262.1_10 Forward -330 -323 8.8889 0.219
NP_442262.1_10 Forward -297 -290 8.8889 0.219
NP_441689.1_5 Forward -60 -50 8.53436 0.132
NP_441689.1_5 Reverse -47 -57 8.3377 0.132
NP_440344.1_10 Reverse -42 -59 -5.46769 0.106
NP_440344.1_10 Forward -65 -48 -7.23765 0.116
NP_440282.1_10 Reverse -39 -58 -7.37537 0.251
NP_440531.1_6 Reverse -41 -60 1.17943 0.179
NP_441965.1_3 Forward -68 -49 -0.000545616 0.244
NP_441965.1_10 Forward -61 -45 21.1014 0.0148
NP_440297.1_9 Reverse -50 -60 9.32148 0.0917
NP_440297.1_9 Forward -57 -47 -0.216628 0.282
NP_442280.1_10 Reverse -192 -210 6.33103 0.279
NP_441103.1_9 Forward -232 -222 12.7825 0.284
NP_440999.1_9 Forward -62 -48 0.0979218 0.193
NP_440888.1_2 Reverse -49 -63 18.7801 0.00187
NP_440888.1_2 Forward -298 -284 8.84875 0.145
NP_440888.1_2 Forward -331 -317 8.75042 0.149
NP_442277.1_4 Forward -67 -48 18.3865 0.0247
NP_441949.1_2 Reverse -320 -339 1.27776 0.284
NP_440575.1_1 Reverse -303 -322 -1.18128 0.29
NP_440575.1_1 Reverse -306 -325 -1.27961 0.29
NP_441543.1_2 Reverse -50 -59 18.486 0.00236
NP_441543.1_2 Forward -57 -48 15.9293 0.00518
NP_442845.1_2 Reverse -49 -63 4.91614 0.249
NP_442845.1_2 Reverse -43 -57 4.12949 0.267
NP_441551.1_5 Forward -62 -46 13.3325 0.126
NP_441319.1_8 Forward -64 -46 4.83737 0.285
NP_442701.1_2 Forward -274 -256 2.57575 0.282
NP_441469.1_8 Forward -59 -50 16.126 0.00797
NP_441469.1_8 Reverse -228 -237 7.07956 0.227
NP_441469.1_8 Reverse -48 -57 6.5879 0.227
NP_443064.1_6 Forward -339 -329 16.5422 0.0796
NP_443064.1_6 Forward -58 -48 10.8217 0.13
NP_442337.1_8 Reverse -195 -214 5.80098 0.21
NP_441223.1_3 Reverse -257 -276 21.1406 0.0851
NP_442578.1_7 Forward -57 -50 14.5921 0.026
NP_442578.1_7 Reverse -50 -57 14.5921 0.026
NP_441462.1_2 Forward -58 -48 20.2362 0.000805
NP_441462.1_2 Reverse -49 -59 11.5831 0.00406
NP_441462.1_2 Forward -339 -329 8.63316 0.0339
NP_441462.1_2 Reverse -330 -340 0.57002 0.144
NP_441621.1_7 Forward -60 -46 4.32615 0.0934
NP_443062.1_1 Reverse -330 -348 10.8861 0.108
NP_443062.1_1 Forward -58 -40 6.8883 0.19
NP_443062.1_6 Reverse -41 -60 5.89931 0.193
NP_442204.1_1 Reverse -45 -56 8.4168 0.0945
NP_442204.1_5 Forward -68 -49 14.3558 0.0486
NP_440544.1_5 Reverse -314 -321 14.5681 0.264
NP_440516.1_2 Reverse -43 -61 -2.73412 0.299
NP_440516.1_6 Forward -116 -102 10.0287 0.233
NP_440516.1_8 Forward -58 -49 16.9127 0.00442
NP_440516.1_8 Reverse -49 -58 16.9127 0.00442
NP_440516.1_8 Forward -339 -330 7.17789 0.0754
NP_440516.1_8 Reverse -330 -339 5.01461 0.118
NP_442428.1_5 Forward -57 -50 15.8704 0.0124
NP_442428.1_5 Reverse -50 -57 15.8704 0.0124
NP_441867.1_2 Reverse -340 -359 -11.7019 0.231
NP_440673.1_3 Forward -56 -49 12.4288 0.0426
NP_440673.1_3 Reverse -51 -58 12.4288 0.0426
NP_440673.1_3 Forward -329 -322 10.5605 0.123
NP_440673.1_3 Reverse -332 -339 10.1672 0.149
NP_441052.1_2 Reverse -49 -59 10.5014 0.0285
NP_441052.1_2 Forward -58 -48 10.4031 0.0285
NP_442219.1_9 Reverse -50 -59 8.35786 0.0681
NP_442219.1_9 Forward -57 -48 8.25953 0.0681
NP_440436.1_4 Reverse -50 -59 18.1905 0.00233
NP_440436.1_4 Forward -57 -48 9.24241 0.0871
NP_440436.1_4 Forward -297 -288 4.22755 0.277
NP_441884.1_8 Forward -59 -40 -9.83364 0.268
NP_441884.1_9 Forward -61 -42 -15.5368 0.138
NP_441884.1_9 Forward -241 -222 -22.125 0.275
NP_442086.1_6 Forward -298 -279 6.4893 0.289
NP_440314.1_9 Forward -297 -278 5.99764 0.0639
NP_440648.1_1 Reverse -330 -349 10.0292 0.183
NP_441719.1_4 Forward -57 -50 16.3621 0.0124
NP_441719.1_4 Reverse -50 -57 16.3621 0.0124
NP_441733.1_10 Reverse -286 -299 6.90245 0.166
NP_441733.1_10 Reverse -46 -59 5.82081 0.203
NP_441004.1_1 Forward -227 -208 -16.5201 0.286
NP_442366.1_3 Forward -59 -41 6.70565 0.0773
NP_442366.1_3 Reverse -48 -66 -2.14413 0.221
NP_442366.1_5 Reverse -46 -56 14.0409 0.0497
NP_442366.1_5 Forward -342 -332 13.1559 0.0899
NP_440296.1_10 Forward -61 -42 -6.58872 0.228
NP_441115.1_4 Reverse -48 -66 16.7346 0.0252
NP_442694.1_4 Reverse -263 -272 13.8644 0.217
NP_442206.1_10 Forward -58 -43 16.0078 0.0799
NP_440328.1_4 Forward -64 -45 9.0459 0.105
NP_441228.1_7 Forward -361 -343 17.3823 0.296
NP_443054.1_2 Forward -60 -46 1.76955 0.245
NP_441851.1_10 Forward -59 -49 16.008 0.00552
NP_441851.1_10 Reverse -48 -58 8.53483 0.114
NP_441851.1_10 Reverse -158 -168 4.3066 0.277
NP_441542.1_4 Reverse -143 -157 5.1128 0.264
NP_442515.1_1 Forward -340 -326 5.1128 0.107
NP_441982.1_6 Forward -276 -267 11.1485 0.288
NP_440165.1_3 Reverse -288 -302 18.7801 0.162
NP_441349.1_10 Forward -68 -49 12.9791 0.0194
NP_440389.1_2 Reverse -179 -198 11.3075 0.287
NP_440432.1_9 Forward -57 -42 -0.315096 0.164
NP_440432.1_9 Forward -338 -323 -0.413427 0.164
NP_442843.1_1 Reverse -221 -240 -8.55534 0.255
NP_440474.1_8 Reverse -50 -64 13.1753 0.0735
NP_440726.1_2 Reverse -222 -241 2.65439 0.246
NP_441124.1_5 Reverse -121 -131 11.7668 0.245
NP_440431.1_3 Forward -332 -313 -6.58872 0.195
NP_440431.1_3 Forward -283 -264 -11.5053 0.286
NP_442450.1_5 Forward -60 -50 9.32148 0.115
NP_442450.1_5 Reverse -47 -57 7.64985 0.13
NP_440588.1_2 Forward -67 -48 9.24257 0.0446
NP_440588.1_2 Reverse -40 -59 8.35759 0.0455
NP_440040.1_8 Reverse -9 -28 4.82192 0.246
NP_442006.1_2 Reverse -107 -124 -18.3491 0.29
NP_442006.1_2 Forward -58 -41 -18.4474 0.291
NP_441570.1_1 Forward -58 -40 1.69077 0.029
NP_441570.1_1 Reverse -330 -348 -3.32411 0.0706
NP_441570.1_1 Reverse -49 -67 -7.35568 0.0887
NP_441078.1_4 Forward -58 -49 19.6659 0.0007
NP_441078.1_4 Reverse -49 -58 19.6659 0.0007
NP_441078.1_4 Forward -339 -330 0.393051 0.205
NP_441078.1_4 Reverse -330 -339 -0.000272808 0.205
NP_440707.1_9 Reverse -342 -361 2.3594 0.274
NP_442443.1_1 Reverse -342 -361 3.34271 0.173
NP_442443.1_4 Forward -269 -259 14.8275 0.202
NP_441432.1_8 Reverse -48 -57 16.8143 0.00595
NP_441432.1_8 Forward -340 -331 11.0128 0.0629
NP_441432.1_8 Forward -59 -50 8.25953 0.0755
NP_441432.1_8 Reverse -288 -297 8.1612 0.0815
NP_441432.1_9 Reverse -304 -317 9.27706 0.28
NP_442320.1_8 Reverse -283 -297 2.85119 0.0736
NP_442320.1_8 Forward -64 -50 -3.73699 0.131
NP_441732.1_2 Reverse -45 -61 1.92682 0.0254
NP_441732.1_2 Forward -62 -46 -17.2477 0.247
NP_441732.1_2 Forward -343 -327 -17.4444 0.258
NP_440629.1_4 Forward -161 -142 13.3725 0.217
NP_440629.1_6 Reverse -43 -62 16.7018 0.0925
NP_440760.1_1 Forward -58 -39 -4.91709 0.0475
NP_440199.1_10 Forward -61 -51 13.2547 0.108
NP_442624.1_3 Forward -302 -288 12.8809 0.288
NP_440578.1_10 Reverse -308 -327 12.7825 0.246
NP_440461.1_3 Forward -66 -47 15.6341 0.212
NP_442489.1_7 Forward -58 -49 20.1576 0.000695
NP_442489.1_7 Reverse -49 -58 20.1576 0.000695
NP_442489.1_7 Forward -339 -330 0.688044 0.152
NP_442489.1_7 Reverse -330 -339 0.688044 0.152
NP_442489.1_7 Forward -298 -289 -1.86856 0.259
NP_440565.1_3 Forward -247 -228 18.8688 0.191
NP_441452.1_1 Forward -118 -99 13.0775 0.292
NP_440559.1_1 Reverse -50 -59 8.75118 0.0586
NP_440559.1_1 Forward -57 -48 8.65285 0.0586
NP_440559.1_1 Forward -338 -329 4.81794 0.193
NP_441659.2_8 Forward -58 -48 20.9245 0.000805
NP_441659.2_8 Reverse -49 -59 11.9764 0.0147
NP_441659.2_8 Reverse -330 -340 7.94484 0.052
NP_441659.2_8 Forward -143 -133 0.963343 0.254
NP_441659.2_8 Forward -339 -329 0.0783647 0.277
NP_442913.1_10 Forward -67 -48 -3.73712 0.216
NP_441040.1_2 Forward -246 -227 -0.688862 0.128
NP_441040.1_2 Forward -67 -48 -14.6519 0.286
NP_439956.1_7 Reverse -153 -172 4.81767 0.257
NP_442008.1_2 Reverse -46 -65 14.9458 0.0806
NP_442008.1_2 Forward -225 -206 4.81767 0.232
NP_440708.1_6 Reverse -192 -211 -9.53865 0.269
NP_442346.1_5 Reverse -48 -58 16.303 0.00248
NP_442346.1_5 Forward -59 -49 9.02648 0.118
NP_442346.1_10 Forward -240 -221 8.55425 0.153
NP_440545.1_3 Reverse -45 -62 11.2486 0.0268
NP_440545.1_3 Forward -62 -45 0.530496 0.137
NP_440545.1_3 Reverse -225 -242 -3.50107 0.206
NP_441856.1_3 Forward -61 -42 8.55425 0.101
NP_440025.1_6 Forward -179 -160 12.5858 0.26
NP_440486.1_6 Forward -223 -204 8.16093 0.248
NP_441653.1_3 Forward -40 -26 18.2892 0.145
NP_440010.1_10 Reverse -318 -337 1.57275 0.297
NP_440847.1_3 Forward -236 -222 13.372 0.217
NP_442875.1_1 Forward -398 -379 19.469 0.292
NP_442875.1_2 Forward -217 -198 26.6471 0.0036
NP_442875.1_6 Forward -375 -356 23.893 0.031
NP_442875.1_7 Forward -193 -174 24.3846 0.00779
NP_442875.1_8 Forward -142 -123 20.649 0.0741
NP_441585.1_5 Reverse -351 -370 7.86512 0.211
NP_440449.1_6 Forward -151 -133 7.76952 0.212
NP_440449.1_6 Forward -66 -48 5.92152 0.266
NP_440449.1_6 Reverse -322 -340 4.75436 0.291
NP_441948.1_4 Forward -65 -47 6.70565 0.0633
NP_441779.1_5 Forward -74 -55 15.0432 0.278
NP_441833.1_4 Forward -57 -50 15.9687 0.0124
NP_441833.1_4 Reverse -50 -57 15.9687 0.0124
NP_442060.1_3 Forward -254 -235 12.4867 0.286
NP_442162.1_9 Forward -57 -50 16.2637 0.0124
NP_442162.1_9 Reverse -50 -57 16.2637 0.0124
NP_440671.1_5 Forward -122 -108 14.0603 0.293
NP_442199.1_5 Forward -66 -47 -4.72043 0.229
NP_442140.1_3 Reverse -50 -60 8.33817 0.119
NP_442140.1_3 Forward -57 -47 6.66654 0.159
NP_440875.1_9 Forward -56 -46 8.37203 0.233
NP_441813.1_3 Reverse -344 -363 14.3343 0.248
NP_441813.1_5 Forward -60 -50 17.188 0.00979
NP_441813.1_5 Reverse -47 -57 8.63316 0.0367
NP_440594.1_8 Reverse -290 -303 9.95012 0.173
NP_440590.1_4 Reverse -50 -63 3.5592 0.0719
NP_440567.1_1 Reverse -50 -64 18.6825 0.0136
NP_440567.1_1 Forward -57 -43 11.0127 0.0305
NP_442497.1_10 Forward -57 -48 17.601 0.00813
NP_442497.1_10 Reverse -50 -59 10.4228 0.0087
NP_442497.1_10 Forward -338 -329 0.393051 0.175
NP_440821.1_4 Forward -60 -50 19.0562 0.00399
NP_440821.1_4 Reverse -47 -57 2.24165 0.131
NP_440821.1_4 Reverse -328 -338 0.0783647 0.205
NP_441239.1_9 Reverse -47 -59 13.707 0.0355
NP_441239.1_9 Forward -60 -48 13.3137 0.037
NP_441239.1_9 Reverse -227 -239 6.1355 0.2
NP_441239.1_9 Forward -118 -106 5.44718 0.221
NP_441239.1_9 Reverse -328 -340 3.57889 0.283
NP_440156.1_4 Forward -237 -227 8.92768 0.242
NP_442568.1_8 Forward -272 -258 9.93102 0.257
NP_441727.1_3 Reverse -42 -61 2.75272 0.299
NP_441892.1_1 Reverse -40 -57 -0.649475 0.188
NP_440665.1_1 Forward -336 -317 -13.3736 0.257
NP_440665.1_1 Forward -55 -36 -16.6185 0.292
NP_440665.1_9 Forward -146 -127 15.2408 0.142
NP_440604.1_6 Reverse -49 -68 4.03102 0.131
NP_440604.1_6 Forward -58 -39 2.65439 0.137
NP_440604.1_6 Reverse -330 -349 -2.36049 0.221
NP_440796.1_4 Reverse -334 -353 18.9709 0.255
NP_441698.1_7 Forward -53 -35 22.6353 0.0252
NP_442643.1_1 Forward -64 -45 -11.4069 0.231
NP_442216.1_4 Reverse -364 -372 8.08217 0.255
NP_440354.1_7 Forward -337 -319 7.00065 0.278
NP_442138.1_10 Forward -58 -39 -6.98204 0.286
NP_440546.1_4 Forward -58 -48 13.5365 0.0459
NP_440546.1_4 Reverse -49 -59 11.8882 0.0679
NP_440546.1_4 Forward -158 -148 7.52511 0.235
NP_440024.1_8 Reverse -157 -176 20.4514 0.0869
NP_440675.1_3 Forward -339 -320 9.83255 0.186
NP_440462.1_4 Reverse -320 -334 13.5693 0.169
NP_440462.1_6 Forward -60 -50 15.418 0.0142
NP_440462.1_6 Reverse -47 -57 10.5014 0.0396
NP_442465.1_9 Forward -272 -258 12.1926 0.22
NP_440868.1_4 Forward -62 -50 18.3285 0.0124
NP_440868.1_4 Reverse -45 -57 15.1819 0.0164
NP_440868.1_4 Forward -343 -331 0.628964 0.206
NP_442479.1_9 Forward -309 -290 5.50599 0.177
NP_441474.1_1 Reverse -39 -58 -2.26292 0.273
NP_442402.1_4 Forward -362 -343 -1.67294 0.194
NP_442402.1_4 Reverse -194 -213 -6.09781 0.25
NP_442402.1_4 Reverse -304 -323 -8.45774 0.282
NP_442882.1_7 Forward -65 -51 12.0937 0.261
NP_440843.1_3 Reverse -142 -161 18.3873 0.187
NP_442039.1_4 Forward -57 -50 15.1821 0.0124
NP_442039.1_4 Reverse -50 -57 15.1821 0.0124
NP_442039.1_4 Forward -297 -290 10.5605 0.121
NP_442039.1_7 Reverse -231 -241 10.7964 0.257
NP_442837.1_3 Forward -57 -50 15.7721 0.0124
NP_442837.1_3 Reverse -50 -57 15.7721 0.0124
NP_442053.1_1 Forward -58 -49 18.3876 0.0007
NP_442053.1_1 Reverse -49 -58 18.3876 0.0007
NP_442053.1_1 Reverse -330 -339 6.8829 0.111
NP_440505.1_3 Forward -60 -50 13.8447 0.0247
NP_440505.1_3 Reverse -157 -167 12.8614 0.0427
NP_440505.1_3 Reverse -47 -57 8.04317 0.147
NP_440505.1_3 Reverse -287 -297 5.19158 0.241
NP_440505.1_7 Reverse -323 -342 6.39097 0.168
NP_441252.1_6 Reverse -270 -277 14.3954 0.168
NP_441203.1_1 Reverse -50 -69 -10.1286 0.137
NP_441408.2_7 Forward -269 -250 -0.688862 0.234
NP_440914.1_1 Forward -58 -48 16.3248 0.00196
NP_440914.1_1 Reverse -49 -59 8.6151 0.186
NP_440914.1_1 Reverse -322 -332 7.73678 0.224
NP_440914.1_1 Reverse -134 -144 7.5416 0.232
NP_440914.1_1 Reverse -34 -44 7.24882 0.242
NP_441011.1_8 Reverse -50 -59 16.9127 0.00602
NP_441011.1_8 Forward -57 -48 16.6177 0.00602
NP_442101.1_6 Forward -33 -14 10.8159 0.294
NP_442101.1_10 Forward -347 -328 2.65439 0.0714
NP_442533.1_1 Reverse -100 -119 -14.0619 0.239
NP_442533.1_6 Forward -58 -49 17.2076 0.00137
NP_442533.1_6 Reverse -49 -58 17.2076 0.00137
NP_442533.1_6 Forward -339 -330 4.91628 0.165
NP_442533.1_6 Reverse -330 -339 4.42462 0.179
NP_442533.1_6 Forward -331 -322 3.24465 0.219
NP_442541.1_10 Forward -238 -224 5.99717 0.248
NP_442322.1_4 Forward -124 -107 -8.8116 0.286
NP_442322.1_4 Forward -118 -101 -9.7949 0.297
NP_441482.1_7 Reverse -43 -57 -3.24533 0.115
NP_439944.1_9 Reverse -50 -60 10.3048 0.0887
NP_439944.1_9 Forward -57 -47 9.12481 0.1
NP_440816.1_7 Reverse -45 -64 8.55425 0.289
NP_441028.1_6 Reverse -313 -323 12.0743 0.192
NP_441028.1_6 Reverse -92 -102 8.43603 0.216
NP_441028.1_6 Reverse -193 -203 8.14104 0.217
NP_442664.1_8 Forward -122 -103 11.5033 0.233
NP_441527.1_4 Forward -272 -253 -7.01908 0.229
NP_440115.1_6 Reverse -46 -56 7.35486 0.147
NP_439965.1_1 Forward -67 -48 -6.78538 0.218
NP_441106.1_1 Reverse -48 -57 18.486 0.0028
NP_441106.1_1 Forward -59 -50 18.191 0.0028
NP_439903.1_6 Forward -61 -42 1.47364 0.245
NP_441286.1_1 Reverse -48 -60 5.05386 0.0259
NP_441286.1_1 Forward -59 -47 -3.59927 0.145
NP_441286.1_1 Forward -340 -328 -4.38592 0.156
NP_442674.1_3 Forward -345 -326 4.03023 0.294
NP_440670.1_8 Forward -58 -49 18.3876 0.000699
NP_440670.1_8 Reverse -49 -58 18.3876 0.000699
NP_440670.1_8 Forward -339 -330 8.55452 0.066
NP_440670.1_8 Reverse -330 -339 5.99792 0.13
NP_440886.1_7 Forward -59 -49 17.7774 0.0011
NP_440886.1_7 Reverse -48 -58 8.04271 0.0805
NP_442614.1_2 Reverse -49 -63 6.48943 0.291
NP_442717.1_1 Forward -260 -241 -2.0655 0.285
NP_442072.1_9 Reverse -48 -66 -21.8103 0.212
NP_442072.1_9 Reverse -133 -151 -23.2853 0.288
NP_440907.2_8 Forward -57 -47 15.9091 0.0161
NP_440907.2_8 Reverse -50 -60 7.84605 0.117
NP_440907.2_8 Reverse -331 -341 4.50281 0.261
NP_442459.1_8 Forward -63 -44 21.6323 0.0225
NP_441463.1_3 Reverse -320 -339 -0.4922 0.133
NP_441463.1_3 Forward -68 -49 -8.26035 0.267
NP_442842.1_10 Reverse -255 -274 4.73683 0.214
NP_441626.1_2 Forward -57 -50 15.7721 0.0124
NP_441626.1_2 Reverse -50 -57 15.7721 0.0124
NP_442365.1_7 Reverse -45 -64 -2.45882 0.2
NP_442794.1_1 Reverse -45 -57 2.69391 0.286
NP_442615.1_1 Forward -67 -49 8.08229 0.0297
NP_442615.1_1 Reverse -40 -58 1.59244 0.0829
NP_440387.1_1 Forward -58 -42 13.4315 0.00865
NP_440387.1_1 Reverse -49 -65 6.64671 0.0282
NP_441431.1_2 Forward -61 -47 11.5037 0.136
NP_441488.1_7 Reverse -43 -62 0.491109 0.296
NP_441836.1_2 Reverse -95 -114 -5.60541 0.284
NP_441836.1_2 Forward -304 -285 -5.99873 0.29
NP_440114.1_10 Reverse -322 -336 13.9626 0.0464
NP_440114.1_10 Reverse -49 -63 12.8809 0.0698
NP_440114.1_10 Forward -58 -44 8.84938 0.192
NP_442698.1_10 Forward -328 -309 -1.47551 0.299
NP_442833.1_1 Reverse -302 -316 21.2108 0.0451
NP_439988.1_7 Reverse -51 -65 12.5853 0.292
NP_442743.1_4 Reverse -50 -69 18.6823 0.021
NP_441311.1_2 Reverse -43 -57 13.6669 0.229
NP_439910.1_2 Forward -306 -289 -22.479 0.25
NP_442867.1_8 Forward -113 -94 12.1925 0.197
NP_440457.1_1 Forward -62 -50 11.4454 0.092
NP_440987.1_4 Forward -309 -290 3.04771 0.288
NP_440798.1_6 Reverse -50 -63 14.8673 0.0423
NP_440798.1_6 Reverse -331 -344 8.86907 0.11
NP_440798.1_6 Forward -57 -44 1.39592 0.217
NP_440801.1_8 Forward -59 -40 -1.37718 0.276
NP_440801.1_8 Forward -176 -157 -1.86883 0.283
NP_441436.1_8 Reverse -288 -307 10.2259 0.262
NP_441436.1_8 Reverse -271 -290 8.65258 0.279
NP_442509.1_9 Reverse -49 -59 16.2041 0.00739
NP_442509.1_9 Forward -58 -48 8.04271 0.192
NP_440554.1_4 Reverse -50 -60 14.6313 0.02
NP_440554.1_4 Forward -57 -47 8.82982 0.0646
NP_440554.1_4 Forward -330 -320 2.83163 0.251
NP_441885.1_5 Reverse -49 -59 11.4848 0.00668
NP_441885.1_5 Forward -58 -48 11.3864 0.00668
NP_441885.1_5 Forward -339 -329 -0.314959 0.195
NP_440628.1_1 Forward -205 -195 13.1977 0.29
NP_441466.1_4 Forward -136 -117 8.35759 0.295
NP_442341.1_7 Forward -59 -45 4.81781 0.177
NP_442341.1_7 Reverse -288 -302 4.32615 0.194
NP_442341.1_7 Reverse -48 -62 1.17956 0.297
NP_442341.1_9 Forward -60 -46 14.0603 0.0713
NP_442341.1_9 Reverse -47 -61 8.65209 0.166
NP_442534.1_7 Reverse -212 -231 6.4893 0.272
NP_440423.1_10 Reverse -42 -61 10.0292 0.259
NP_443000.1_7 Reverse -47 -57 10.6981 0.0345
NP_443000.1_7 Forward -60 -50 8.73149 0.0437
NP_440076.1_9 Forward -125 -112 15.1616 0.292
NP_440727.1_8 Forward -314 -300 16.3407 0.211
NP_441842.1_10 Forward -65 -51 19.0758 0.0142
NP_441842.1_10 Reverse -42 -56 6.19444 0.297
NP_440275.1_3 Reverse -47 -57 9.02648 0.0563
NP_440275.1_3 Forward -60 -50 8.4365 0.0602
NP_442932.1_9 Reverse -344 -363 6.78429 0.249
NP_440091.1_1 Forward -62 -50 17.7386 0.013
NP_441397.1_8 Forward -322 -309 11.7118 0.295
NP_441902.1_3 Forward -322 -312 12.2043 0.259
NP_440175.1_7 Forward -38 -20 9.16793 0.28
NP_442591.1_5 Forward -61 -42 14.2574 0.234
NP_440149.1_8 Reverse -49 -68 2.26107 0.112
NP_441105.1_3 Forward -249 -230 -6.78538 0.241
NP_440216.1_1 Reverse -49 -63 17.6992 0.00155
NP_440216.1_1 Reverse -330 -344 3.14618 0.0284
NP_440216.1_1 Forward -58 -44 -2.45868 0.0513
NP_440216.1_6 Forward -65 -49 5.86006 0.189
NP_440172.1_1 Forward -58 -48 17.5813 0.00421
NP_440172.1_1 Reverse -49 -59 8.73149 0.0586
NP_440172.1_1 Reverse -289 -299 5.87989 0.127
NP_440172.1_1 Reverse -330 -340 4.79825 0.166
NP_440172.1_1 Reverse -159 -169 3.81494 0.216
NP_440172.1_1 Forward -339 -329 3.71661 0.219
NP_442015.1_10 Forward -62 -49 9.85238 0.0433
NP_442015.1_10 Reverse -45 -58 2.37923 0.193
NP_441226.1_7 Forward -57 -50 14.4934 0.0123
NP_441226.1_7 Reverse -50 -57 14.4934 0.0123
NP_441226.1_7 Reverse -56 -63 6.82361 0.246
NP_441485.1_9 Reverse -326 -345 15.0441 0.288
NP_442834.1_10 Forward -64 -45 15.9291 0.0749
NP_441111.1_7 Forward -57 -49 18.7023 0.00294
NP_441111.1_7 Reverse -50 -58 18.7023 0.00294
NP_442379.1_10 Forward -65 -48 4.6604 0.141
NP_441766.1_2 Forward -58 -49 17.5026 0.00297
NP_441766.1_2 Reverse -49 -58 17.5026 0.00297
NP_441766.1_2 Reverse -289 -298 4.32629 0.187
NP_441766.1_2 Reverse -330 -339 4.12963 0.194
NP_442417.1_5 Forward -58 -44 7.17775 0.195
NP_440416.1_9 Forward -65 -46 1.57275 0.0444
NP_440416.1_9 Reverse -42 -61 -14.8485 0.18
NP_443052.1_8 Forward -68 -49 -1.47551 0.0795
NP_442116.1_2 Forward -180 -161 12.0933 0.289
NP_440845.1_1 Reverse -132 -151 -2.65548 0.182
NP_442154.1_1 Reverse -98 -116 -17.1888 0.249
NP_442154.1_1 Forward -45 -27 -18.5654 0.282
NP_440261.1_5 Forward -57 -44 -1.06236 0.0655
NP_440261.1_5 Reverse -50 -63 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCGCTAGTAGGATGATCAGTAAACTAAGGGGAGTTAGTTGTCCCAGTTGTTCCACCACTAGGCGATCAGCCCATTGCTGGAGAAAAAAAAGCTGATTTTGCAGAGATTGCCACATTACACAGTTGCCCAAAAAGCCAAAAATAAGTCTGAAATTTGCCGGCTGCCATTTCGCCCCTGGTTTATTGGCGGGGTCAAACCAGAGGAAAGATTAACACTTCTCCGACAATGCTAAGCAATTCCCAGCCATCTTGCCAAAGCTCATCGTCCTAAAGTTAGACATTCCCCCCCTGCCCCTCAATGGAGAGCAGATAATAGAATTCTGTGAAAGTGGGTTTCCGGACGGCGATCGCCTAGATGGAGTTTGTTATGGTGGTATTGGTTTTGTTGTAAAGAGGAATA

CDS

ATGATGAGAGCTTTTGAGGTAATGGCCACAGTTAAAGATTCCAAACAATTGCTCTTGGATAGTGATTTGCATTGGAATACCAGCCGAGTCAAGGTGATTATTTTGGAATCAGATGAATTGGCATCAAAAGGAAGTGAGTTTGATCCTGATGACACGCCTGTCGAAGAAATTAAGGTGAGTTTGAGGAAGGCATTAGAGGAATATAAACAAGGAAAAAGAATTCCAGTAGAAAATATGTGGGAGGGAATTGATGTCGAATAA

Protein

MMRAFEVMATVKDSKQLLLDSDLHWNTSRVKVIILESDELASKGSEFDPDDTPVEEIKVSLRKALEEYKQGKRIPVENMWEGIDVE