Your browser is old and dusty. Try Google Chrome!

Details for ssr0692

ORF ssr0692
Accession NP_442317.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -208 -201 5.74231 0.279
NP_442272.1_1 Forward -400 -382 14.4213 0.255
NP_441453.1_4 Reverse -200 -208 6.90259 0.121
NP_441623.1_1 Forward -196 -178 8.37728 0.108
NP_441623.1_6 Forward -251 -232 14.1591 0.209
NP_442169.1_1 Forward -355 -336 -2.75381 0.28
NP_442173.1_1 Forward -208 -200 7.49257 0.171
NP_442173.1_1 Reverse -201 -209 4.54265 0.27
NP_443027.1_4 Forward -211 -201 7.74818 0.235
NP_443027.1_4 Reverse -198 -208 6.17489 0.289
NP_442975.1_10 Forward -213 -199 9.14375 0.0771
NP_440784.1_7 Reverse -201 -208 6.43063 0.218
NP_440784.1_7 Forward -208 -201 6.23397 0.241
NP_440110.1_4 Reverse -248 -267 11.5042 0.104
NP_442242.1_4 Reverse -201 -208 13.3138 0.027
NP_440044.1_8 Forward -208 -189 2.94938 0.142
NP_439902.1_3 Forward -125 -106 16.7501 0.282
NP_440916.1_1 Reverse -214 -228 9.63603 0.235
NP_441083.1_5 Reverse -336 -346 1.84832 0.198
NP_441083.1_5 Forward -209 -199 -0.118297 0.256
NP_440209.1_1 Forward -209 -201 5.32929 0.139
NP_442445.1_1 Reverse -142 -161 11.3075 0.271
NP_440906.1_5 Reverse -201 -208 6.52896 0.199
NP_440906.1_5 Forward -208 -201 6.0373 0.262
NP_440747.1_10 Forward -154 -142 -11.9574 0.178
NP_441854.1_10 Reverse -140 -159 7.66927 0.186
NP_441486.1_1 Forward -212 -198 1.96621 0.0939
NP_441486.1_1 Reverse -197 -211 0.687908 0.129
NP_442848.1_1 Reverse -194 -208 18.1908 0.0143
NP_442848.1_1 Forward -221 -207 -1.96703 0.263
NP_443018.1_3 Reverse -201 -208 5.15232 0.226
NP_443018.1_3 Forward -208 -201 5.05399 0.238
NP_440376.1_1 Reverse -142 -151 5.99792 0.111
NP_440266.1_6 Forward -280 -261 8.55343 0.27
NP_441846.1_10 Forward -362 -343 -23.6 0.294
NP_440642.1_10 Forward -389 -375 3.73557 0.265
NP_442782.1_2 Forward -224 -210 0.0979218 0.296
NP_442876.1_6 Reverse -101 -119 10.0286 0.298
NP_442690.1_1 Reverse -26 -45 -14.2585 0.271
NP_439975.1_3 Forward -354 -341 16.5389 0.201
NP_441294.1_7 Reverse -41 -55 8.57871 0.294
NP_442438.1_10 Reverse -195 -209 7.17775 0.0987
NP_441000.1_6 Forward -210 -196 -4.4253 0.243
NP_441550.1_8 Forward -140 -130 4.89613 0.281
NP_441547.1_2 Forward -162 -144 2.77242 0.296
NP_442004.1_6 Forward -209 -195 1.76955 0.278
NP_441725.1_5 Reverse -201 -211 -0.41329 0.251
NP_439966.1_7 Forward -211 -201 9.51767 0.109
NP_442941.1_3 Forward -208 -198 7.84651 0.0564
NP_441514.1_6 Forward -226 -219 14.2971 0.248
NP_441079.1_7 Forward -80 -61 -1.67294 0.206
NP_440867.1_10 Forward -388 -369 1.37609 0.298
NP_442215.1_2 Forward -30 -14 -4.1697 0.228
NP_442215.1_2 Reverse -250 -266 -6.13632 0.264
NP_440253.1_2 Reverse -154 -172 8.7706 0.0526
NP_440253.1_2 Reverse -200 -218 1.39578 0.161
NP_442671.1_2 Reverse -51 -70 2.55736 0.211
NP_441751.2_8 Forward -208 -194 -5.9986 0.249
NP_441762.1_7 Reverse -199 -211 -3.00928 0.0879
NP_442313.1_8 Reverse -174 -193 8.25926 0.292
NP_442292.1_1 Forward -208 -199 -0.295266 0.24
NP_442476.1_6 Forward -132 -118 0.294584 0.267
NP_441715.1_4 Forward -208 -198 10.9931 0.0955
NP_441715.1_4 Reverse -201 -211 5.87989 0.172
NP_440183.1_9 Reverse -223 -242 -20.8467 0.292
NP_441468.1_1 Reverse -201 -208 13.0188 0.0383
NP_441468.1_1 Forward -208 -201 6.0373 0.223
NP_441020.2_6 Forward -354 -337 8.88863 0.185
NP_441764.1_4 Reverse -52 -69 10.8411 0.237
NP_442227.1_2 Reverse -336 -355 -1.37718 0.262
NP_442361.1_3 Forward -98 -85 9.36073 0.276
NP_442808.1_1 Reverse -342 -352 4.7978 0.19
NP_442050.1_5 Reverse -198 -208 13.0576 0.0461
NP_442739.1_2 Reverse -262 -281 13.4409 0.246
NP_441048.1_6 Reverse -26 -40 17.0092 0.296
NP_441557.1_5 Forward -209 -200 -0.68859 0.229
NP_441557.1_8 Reverse -344 -354 13.9425 0.201
NP_441433.1_8 Reverse -142 -161 -2.75381 0.27
NP_441574.1_1 Forward -343 -324 -1.67217 0.221
NP_440276.1_8 Reverse -256 -275 7.07928 0.274
NP_442317.1_1 Forward -400 -381 17.3048 0.1
NP_442317.1_2 Forward -352 -333 19.9606 0.0386
NP_442317.1_3 Forward -197 -178 16.4207 0.214
NP_442317.1_6 Forward -156 -137 12.6841 0.158
NP_442317.1_7 Forward -293 -274 17.0099 0.298
NP_442317.1_8 Forward -56 -37 15.0441 0.286
NP_441633.1_3 Forward -248 -235 -6.56889 0.259
NP_441405.1_1 Reverse -141 -151 16.008 0.27
NP_440136.1_2 Reverse -201 -208 6.52896 0.116
NP_440136.1_2 Forward -208 -201 6.13563 0.193
NP_442998.1_2 Reverse -341 -360 5.50519 0.257
NP_442998.1_5 Reverse -176 -186 13.648 0.157
NP_442998.1_5 Reverse -177 -187 12.3697 0.174
NP_442998.1_5 Reverse -152 -162 10.1081 0.225
NP_442998.1_5 Forward -192 -182 7.84651 0.28
NP_442998.1_5 Reverse -22 -32 7.74818 0.284
NP_440899.1_1 Reverse -136 -155 8.50503 0.23
NP_441799.1_1 Reverse -196 -210 8.84875 0.105
NP_442334.1_2 Forward -353 -336 -12.2525 0.297
NP_440256.1_1 Reverse -197 -216 -9.24366 0.275
NP_441362.1_3 Forward -79 -60 24.7797 0.0178
NP_441559.1_8 Forward -156 -142 1.86788 0.153
NP_441559.1_8 Reverse -221 -235 -5.80194 0.27
NP_440915.1_6 Forward -356 -342 0.491246 0.162
NP_441296.1_9 Forward -149 -136 8.67183 0.294
NP_440717.1_3 Reverse -339 -353 11.2087 0.23
NP_441704.1_8 Forward -220 -201 7.07848 0.249
NP_442866.1_1 Reverse -254 -273 -8.65367 0.282
NP_442993.1_1 Forward -169 -153 -11.7412 0.257
NP_440677.1_6 Reverse -168 -187 10.4225 0.268
NP_442386.1_9 Forward -210 -201 8.06244 0.209
NP_442386.1_9 Reverse -199 -208 5.50585 0.25
NP_441750.1_7 Forward -304 -294 14.1397 0.254
NP_441340.1_5 Reverse -201 -208 5.93897 0.198
NP_441340.1_5 Forward -208 -201 5.84064 0.208
NP_442327.1_3 Forward -46 -27 15.326 0.158
NP_440168.1_8 Forward -193 -174 4.71934 0.217
NP_442251.1_6 Reverse -201 -208 13.0188 0.0408
NP_439984.1_7 Reverse -338 -356 3.65739 0.256
NP_440836.1_6 Forward -190 -176 8.25939 0.263
NP_440371.1_10 Forward -103 -84 16.1257 0.179
NP_439943.1_1 Forward -337 -318 -8.752 0.28
NP_440372.1_2 Reverse -201 -208 6.62729 0.151
NP_440372.1_2 Forward -208 -201 6.52896 0.188
NP_440819.1_5 Reverse -152 -160 7.59091 0.272
NP_440139.1_1 Reverse -135 -154 7.66846 0.127
NP_442262.1_10 Reverse -201 -208 10.6589 0.14
NP_441689.1_5 Reverse -198 -208 15.0242 0.0617
NP_440344.1_10 Forward -216 -199 -6.746 0.114
NP_441965.1_7 Reverse -172 -191 13.3716 0.277
NP_442280.1_10 Reverse -256 -274 10.8114 0.217
NP_440888.1_2 Forward -209 -195 8.84875 0.145
NP_440888.1_2 Reverse -253 -267 5.30886 0.284
NP_441543.1_2 Forward -208 -199 4.22796 0.267
NP_440208.1_8 Forward -185 -166 15.8307 0.213
NP_441551.1_5 Forward -213 -197 6.05604 0.286
NP_440982.1_1 Reverse -336 -355 5.70185 0.294
NP_441469.1_8 Forward -210 -201 6.5879 0.227
NP_442578.1_7 Forward -208 -201 5.15232 0.291
NP_443062.1_1 Forward -209 -191 3.47554 0.297
NP_440516.1_8 Reverse -200 -209 -0.491928 0.262
NP_442428.1_5 Reverse -201 -208 6.3323 0.193
NP_442428.1_5 Forward -208 -201 6.13563 0.209
NP_441443.1_1 Forward -353 -334 3.44104 0.194
NP_442779.1_10 Reverse -341 -359 16.8329 0.265
NP_442120.1_10 Reverse -136 -155 2.26107 0.152
NP_440865.1_9 Reverse -136 -155 -5.80207 0.217
NP_441052.1_2 Forward -209 -199 1.35667 0.248
NP_442219.1_9 Forward -208 -199 8.84951 0.0681
NP_440436.1_4 Forward -208 -199 6.29249 0.164
NP_441884.1_9 Reverse -159 -178 -23.305 0.284
NP_441884.1_9 Forward -192 -173 -23.4033 0.284
NP_442412.1_5 Reverse -224 -243 3.14605 0.294
NP_440314.1_9 Reverse -335 -354 -10.227 0.291
NP_441719.1_4 Reverse -201 -208 6.62729 0.151
NP_441719.1_4 Forward -208 -201 6.52896 0.188
NP_441004.1_5 Forward -356 -342 11.6026 0.241
NP_442813.1_4 Reverse -257 -276 -7.57203 0.299
NP_442813.1_4 Forward -29 -10 -8.26035 0.299
NP_442366.1_3 Reverse -377 -395 -2.3408 0.226
NP_439949.1_7 Forward -192 -178 15.0442 0.215
NP_442695.1_3 Reverse -145 -159 19.7634 0.14
NP_440296.1_10 Forward -355 -336 -6.09707 0.225
NP_441668.1_10 Forward -202 -185 7.70792 0.288
NP_440593.1_3 Reverse -143 -162 -4.42544 0.248
NP_441409.1_6 Forward -157 -138 -10.4236 0.205
NP_440431.1_3 Reverse -214 -233 -10.3253 0.275
NP_440040.1_8 Reverse -97 -116 9.02356 0.203
NP_442006.1_2 Forward -352 -335 0.628827 0.124
NP_442006.1_2 Reverse -350 -367 -16.9724 0.267
NP_442006.1_2 Reverse -377 -394 -19.234 0.299
NP_441570.1_1 Forward -209 -191 -17.0904 0.264
NP_441078.1_4 Forward -151 -142 -0.68859 0.206
NP_441078.1_4 Reverse -142 -151 -1.6719 0.266
NP_442729.1_7 Reverse -176 -194 6.90232 0.277
NP_441539.1_10 Forward -360 -341 16.9124 0.00909
NP_441432.1_8 Reverse -141 -150 5.50626 0.151
NP_441432.1_9 Forward -335 -322 9.47098 0.278
NP_441432.1_9 Reverse -275 -288 8.88924 0.284
NP_442320.1_8 Reverse -194 -208 -4.52363 0.171
NP_441732.1_2 Reverse -174 -190 -17.5427 0.27
NP_440321.1_1 Forward -352 -335 11.3469 0.28
NP_440713.1_4 Forward -143 -124 1.96607 0.273
NP_442489.1_2 Reverse -189 -208 1.17943 0.293
NP_442489.1_7 Forward -151 -142 -1.6719 0.235
NP_440386.1_6 Forward -163 -144 3.9319 0.223
NP_440559.1_1 Forward -208 -199 7.66954 0.0999
NP_441659.2_6 Forward -109 -90 19.6648 0.0648
NP_440545.1_3 Reverse -138 -155 -6.15601 0.27
NP_441786.1_10 Reverse -191 -210 13.0775 0.144
NP_440486.1_6 Reverse -164 -183 7.96426 0.253
NP_440250.1_4 Reverse -258 -277 5.70185 0.253
NP_441943.1_8 Reverse -299 -318 -13.5702 0.28
NP_442828.1_7 Forward -354 -335 -0.295539 0.276
NP_441833.1_4 Reverse -201 -208 12.9205 0.0393
NP_441833.1_4 Forward -208 -201 6.13563 0.198
NP_442162.1_9 Reverse -201 -208 6.52896 0.178
NP_442162.1_9 Forward -208 -201 6.43063 0.208
NP_440671.1_1 Forward -113 -94 8.90648 0.203
NP_440671.1_4 Reverse -194 -208 10.0294 0.165
NP_440875.1_9 Forward -385 -375 9.92942 0.233
NP_441813.1_5 Forward -211 -201 7.35486 0.0762
NP_441813.1_5 Reverse -198 -208 5.38824 0.13
NP_440567.1_1 Forward -208 -194 -0.0987402 0.264
NP_440821.1_4 Forward -211 -201 6.8632 0.0814
NP_440821.1_4 Reverse -198 -208 -0.0199663 0.217
NP_440227.1_6 Forward -288 -274 14.6219 0.263
NP_442193.1_3 Reverse -271 -290 20.2242 0.0901
NP_442193.1_8 Forward -212 -193 14.8466 0.211
NP_441541.1_1 Forward -66 -48 -0.952934 0.237
NP_440412.1_7 Reverse -152 -171 21.7306 0.0469
NP_441656.1_6 Reverse -253 -272 8.84924 0.209
NP_440462.1_6 Forward -211 -201 4.60159 0.194
NP_440868.1_4 Forward -213 -201 9.47875 0.0482
NP_441249.1_4 Forward -367 -348 12.3892 0.172
NP_442479.1_9 Forward -189 -170 -7.27704 0.266
NP_442402.1_2 Reverse -161 -175 12.3887 0.271
NP_442402.1_10 Reverse -74 -84 10.5993 0.287
NP_441848.1_4 Reverse -17 -33 11.9433 0.213
NP_441084.1_6 Forward -277 -263 13.5133 0.128
NP_441084.1_6 Reverse -320 -334 9.15021 0.292
NP_442039.1_4 Reverse -201 -208 11.3472 0.086
NP_442409.1_10 Reverse -339 -353 16.0269 0.266
NP_440825.1_6 Forward -353 -334 7.96426 0.285
NP_442817.1_1 Reverse -251 -270 13.4708 0.186
NP_442837.1_3 Reverse -201 -208 6.52896 0.2
NP_442837.1_3 Forward -208 -201 6.0373 0.25
NP_442532.1_4 Reverse -63 -81 9.41929 0.273
NP_441011.1_8 Reverse -201 -210 5.80125 0.227
NP_442232.1_3 Reverse -192 -211 -13.2752 0.282
NP_442322.1_9 Reverse -337 -355 12.6047 0.251
NP_439944.1_9 Forward -208 -198 13.5497 0.056
NP_441697.1_5 Forward -340 -321 -9.69285 0.273
NP_441028.1_6 Reverse -346 -356 13.5492 0.158
NP_441028.1_6 Reverse -166 -176 7.74772 0.218
NP_440116.1_8 Forward -208 -189 2.16274 0.0891
NP_441527.1_7 Reverse -249 -268 6.78348 0.299
NP_441106.1_3 Forward -114 -95 12.0942 0.217
NP_440797.1_8 Forward -189 -170 15.3503 0.268
NP_441186.1_4 Reverse -106 -116 15.6142 0.232
NP_441286.1_1 Reverse -199 -211 -5.36923 0.197
NP_440886.1_7 Forward -210 -200 6.56775 0.118
NP_440886.1_7 Reverse -342 -352 4.01116 0.255
NP_440828.1_1 Reverse -344 -363 -0.39464 0.269
NP_441905.1_2 Forward -87 -68 21.2523 0.104
NP_441463.1_6 Reverse -198 -212 6.3193 0.274
NP_441626.1_2 Reverse -201 -208 6.0373 0.212
NP_441626.1_2 Forward -208 -201 5.93897 0.231
NP_442238.1_3 Reverse -136 -155 10.3242 0.146
NP_442615.1_1 Reverse -191 -209 -6.4707 0.248
NP_441193.1_6 Reverse -379 -398 1.37609 0.285
NP_441993.1_1 Reverse -136 -155 4.67549 0.215
NP_442805.1_4 Reverse -105 -123 20.472 0.0953
NP_440114.1_10 Forward -151 -137 5.60446 0.3
NP_442323.1_7 Forward -156 -137 4.71854 0.215
NP_440766.1_4 Reverse -196 -210 1.08123 0.255
NP_440643.1_6 Forward -274 -255 3.73603 0.232
NP_439910.1_2 Forward -217 -200 -22.5773 0.267
NP_440457.1_1 Forward -356 -344 2.89058 0.205
NP_440457.1_1 Forward -308 -296 1.31728 0.241
NP_440457.1_1 Forward -349 -337 -0.256015 0.259
NP_441332.1_6 Reverse -342 -352 15.9065 0.0994
NP_440554.1_4 Reverse -201 -211 4.79825 0.175
NP_441885.1_5 Forward -209 -199 0.275027 0.174
NP_442341.1_7 Reverse -293 -307 5.70279 0.148
NP_441173.1_9 Forward -184 -176 12.1137 0.21
NP_441173.1_9 Forward -159 -151 10.9338 0.242
NP_441173.1_9 Reverse -347 -355 10.1471 0.261
NP_443000.1_7 Reverse -198 -208 6.8632 0.113
NP_440552.1_8 Reverse -96 -113 13.3255 0.207
NP_440091.1_1 Reverse -196 -208 10.8554 0.0429
NP_440091.1_1 Forward -213 -201 -0.649339 0.282
NP_440216.1_9 Reverse -149 -158 9.04618 0.286
NP_440172.1_1 Forward -209 -199 5.5849 0.14
NP_441226.1_7 Reverse -130 -137 6.82361 0.246
NP_441757.1_6 Reverse -144 -163 9.93088 0.138
NP_440244.1_1 Forward -353 -334 -8.94866 0.287
NP_441766.1_2 Forward -209 -200 14.8477 0.00766
NP_441766.1_9 Forward -359 -340 0.392778 0.246
NP_440416.1_9 Forward -241 -222 -19.4701 0.275
NP_440416.1_9 Reverse -341 -360 -21.535 0.295
NP_440072.1_5 Forward -360 -342 -0.0791831 0.236
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAATTTCTACTTAACCTTGGCCGCTTGAAAAGTACAATACCCTCTGGGGGGAAGGGGGATATGGATTTAACCATTATTTCTTGACAGTACAGCAGGGCAGTTGGACAAACCAAAAGTTATTTAAAACCAAGACCAATGGGGAAGCTCGAAACTTCTTATCGCACCGGACTTCCAGGGGAAGAGTTTAGACCGCGATCTCTATTCCTAAGGGTAGATTTTGCCCACGGTGGAAAAACCGCTTTTTCCCAGGCTAATGCCTCTTCCGTTCGGATTCCTGCCATACATTTTTGTTAACTTCAGTAACAATAGATACCGTTCTGGAAATTACCTATAATTTTATGTTATGTTGAATGTAAATCTAAATGTAAGTTTTTCACTGCCTTTCGGAGGGTAGAAGTA

CDS

ATGAATAATCGTAAACGTGTTTTGACTCAAACGGCGATCGCCCACAAAGAAACCCTGCGTCAAAACCTCCAGCACCGTTTAGAGCGGGCACGGGCCGCCGGCAATCAGTCCTTAGTTAGTCAATTGGAAGCAGAAGCTGCTTATCTCCACCTGTAA

Protein

MNNRKRVLTQTAIAHKETLRQNLQHRLERARAAGNQSLVSQLEAEAAYLHL