Your browser is old and dusty. Try Google Chrome!

Details for ssr0657

ORF ssr0657
Accession NP_441857.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -378 -359 0.392778 0.265
NP_440795.1_7 Forward -378 -371 14.6904 0.0123
NP_440795.1_7 Reverse -371 -378 14.6904 0.0123
NP_442291.1_5 Forward -380 -364 2.32015 0.128
NP_440897.1_6 Reverse -34 -53 -3.63955 0.252
NP_441453.1_4 Forward -379 -371 16.6374 0.00633
NP_441453.1_4 Reverse -370 -378 16.539 0.00633
NP_441453.1_4 Forward -253 -245 9.75419 0.0493
NP_441453.1_8 Reverse -355 -372 12.8219 0.205
NP_442151.1_6 Reverse -370 -384 8.16106 0.182
NP_440561.1_8 Forward -281 -262 12.6841 0.24
NP_441818.1_1 Reverse -371 -382 13.5295 0.0731
NP_441818.1_1 Forward -378 -367 9.20294 0.25
NP_441818.1_9 Forward -284 -265 0.491109 0.191
NP_441818.1_9 Reverse -299 -318 -2.26216 0.203
NP_441818.1_9 Reverse -305 -324 -7.08038 0.268
NP_440226.1_1 Reverse -370 -389 16.1257 0.022
NP_440226.1_1 Forward -379 -360 11.4058 0.0542
NP_441630.1_3 Forward -373 -354 2.16274 0.232
NP_441630.1_3 Reverse -83 -102 -0.4922 0.288
NP_440637.1_7 Forward -129 -110 11.1109 0.259
NP_443002.1_2 Forward -99 -80 8.45592 0.279
NP_442173.1_1 Reverse -371 -379 17.3257 0.00633
NP_442173.1_1 Forward -378 -370 15.4574 0.00633
NP_442173.1_1 Forward -263 -255 4.93597 0.241
NP_442752.1_4 Reverse -370 -377 13.8055 0.0199
NP_442752.1_4 Reverse -317 -324 7.90559 0.144
NP_443027.1_4 Forward -381 -371 14.6313 0.0452
NP_443027.1_4 Reverse -368 -378 13.2547 0.0521
NP_442975.1_10 Reverse -366 -380 2.8506 0.269
NP_442975.1_10 Forward -383 -369 2.75226 0.269
NP_442975.1_10 Reverse -116 -130 2.06395 0.284
NP_440784.1_7 Forward -378 -371 15.9687 0.0123
NP_440784.1_7 Reverse -371 -378 15.9687 0.0123
NP_440061.1_9 Reverse -253 -267 9.6354 0.143
NP_440061.1_9 Reverse -368 -382 8.16044 0.18
NP_440061.1_9 Reverse -95 -109 8.16044 0.18
NP_440878.1_4 Forward -219 -201 9.65558 0.294
NP_442062.1_8 Reverse -370 -380 17.0896 0.0025
NP_442062.1_8 Forward -379 -369 7.84651 0.0871
NP_442062.1_8 Forward -365 -355 3.71661 0.256
NP_442062.1_10 Forward -25 -6 14.0608 0.236
NP_440761.1_4 Forward -384 -365 -2.95047 0.132
NP_441859.1_3 Reverse -369 -388 14.2566 0.0715
NP_441859.1_3 Reverse -254 -273 4.03023 0.228
NP_440304.1_4 Forward -102 -92 12.5664 0.051
NP_440304.1_4 Reverse -368 -378 10.8948 0.051
NP_442242.1_4 Forward -378 -371 14.3954 0.0124
NP_442242.1_4 Reverse -371 -378 14.3954 0.0124
NP_440044.1_8 Reverse -371 -390 10.6192 0.0551
NP_440044.1_9 Reverse -364 -383 6.88182 0.268
NP_441781.1_7 Reverse -322 -341 8.45592 0.154
NP_442478.1_6 Reverse -150 -169 19.0072 0.172
NP_442602.1_3 Forward -109 -90 1.37609 0.191
NP_441620.1_3 Forward -386 -367 11.0125 0.297
NP_441208.1_1 Reverse -243 -262 -3.93378 0.262
NP_442742.1_9 Reverse -156 -175 -14.1602 0.293
NP_442110.1_7 Forward -379 -365 3.34284 0.21
NP_441925.1_4 Reverse -262 -281 -14.9476 0.263
NP_440856.1_4 Reverse -252 -271 -3.14714 0.226
NP_441083.1_5 Reverse -370 -380 10.5014 0.0197
NP_441083.1_5 Forward -379 -369 2.04498 0.195
NP_441083.1_5 Forward -253 -243 -0.511621 0.269
NP_441434.1_7 Forward -377 -363 1.96621 0.288
NP_441738.1_2 Forward -377 -370 15.28 0.0102
NP_441738.1_2 Reverse -372 -379 11.5435 0.084
NP_441738.1_2 Reverse -137 -144 6.72528 0.236
NP_441738.1_2 Reverse -211 -218 6.23363 0.264
NP_441558.1_5 Forward -381 -362 7.66927 0.174
NP_441558.1_5 Reverse -32 -51 7.37428 0.182
NP_440209.1_1 Reverse -370 -378 18.1123 0.00295
NP_440209.1_1 Forward -379 -371 8.57422 0.0425
NP_442889.1_8 Reverse -367 -381 8.65209 0.114
NP_440447.1_5 Reverse -213 -223 15.9097 0.277
NP_441713.1_1 Reverse -316 -335 -11.2103 0.221
NP_441713.1_1 Forward -35 -16 -15.0452 0.26
NP_441713.1_1 Forward -385 -366 -15.3402 0.261
NP_441713.1_1 Forward -270 -251 -16.6185 0.285
NP_440178.1_7 Reverse -322 -341 -13.4719 0.136
NP_440178.1_7 Forward -380 -361 -23.1083 0.294
NP_440178.1_7 Reverse -369 -388 -23.1083 0.294
NP_441716.1_1 Reverse -311 -325 6.58777 0.195
NP_441327.1_1 Reverse -167 -186 9.49938 0.203
NP_440644.1_3 Forward -281 -262 1.27776 0.275
NP_442111.1_4 Forward -380 -366 2.94952 0.259
NP_440906.1_5 Forward -378 -371 15.8704 0.0124
NP_440906.1_5 Reverse -371 -378 15.8704 0.0124
NP_440012.1_6 Reverse -50 -69 10.4225 0.247
NP_440747.1_10 Forward -382 -370 -2.22263 0.026
NP_440747.1_10 Reverse -367 -379 -2.4193 0.0434
NP_440747.1_10 Forward -256 -244 -4.68091 0.115
NP_441130.1_10 Forward -381 -367 7.07942 0.171
NP_441486.1_1 Reverse -367 -381 -2.16369 0.175
NP_441486.1_1 Forward -382 -368 -3.63866 0.18
NP_442634.1_4 Reverse -368 -382 6.48943 0.0498
NP_440842.1_5 Reverse -195 -214 12.9656 0.283
NP_442848.1_1 Forward -385 -371 4.81781 0.095
NP_442848.1_4 Forward -153 -139 8.45605 0.282
NP_442848.1_4 Forward -199 -185 6.98109 0.282
NP_443018.1_3 Forward -378 -371 14.8871 0.0123
NP_443018.1_3 Reverse -371 -378 14.8871 0.0123
NP_443018.1_3 Reverse -35 -42 10.2655 0.107
NP_443018.1_3 Forward -364 -357 8.49558 0.141
NP_441634.1_8 Reverse -368 -382 -2.65535 0.295
NP_440376.1_1 Forward -379 -370 9.73449 0.0365
NP_440376.1_1 Reverse -370 -379 9.63616 0.0385
NP_440376.1_1 Forward -331 -322 5.21127 0.144
NP_440376.1_1 Forward -86 -77 4.22796 0.166
NP_440376.1_1 Reverse -244 -253 2.65466 0.216
NP_441857.1_5 Forward -386 -368 20.767 0.0671
NP_441588.1_4 Reverse -372 -382 9.32148 0.14
NP_441588.1_4 Forward -377 -367 6.76487 0.185
NP_442687.1_7 Reverse -369 -379 8.04317 0.116
NP_442687.1_7 Reverse -48 -58 4.79825 0.234
NP_442191.1_4 Reverse -35 -49 11.187 0.268
NP_440642.1_10 Reverse -96 -110 11.7987 0.144
NP_441422.1_7 Reverse -368 -385 -9.3026 0.297
NP_441950.1_8 Forward -33 -19 5.40779 0.281
NP_440360.1_10 Reverse -257 -271 12.291 0.137
NP_442658.1_1 Reverse -368 -378 14.2375 0.0237
NP_442658.1_1 Forward -381 -371 8.73102 0.181
NP_442658.1_1 Forward -108 -98 4.99446 0.288
NP_442782.1_2 Forward -163 -149 2.16287 0.277
NP_442782.1_2 Forward -29 -15 1.76955 0.281
NP_442205.1_9 Forward -337 -321 -1.71142 0.264
NP_442205.1_9 Forward -270 -254 -2.49807 0.271
NP_440656.1_8 Reverse -359 -378 -8.16202 0.273
NP_441487.1_9 Forward -380 -361 3.73603 0.154
NP_442937.1_5 Forward -275 -256 7.07928 0.263
NP_442448.1_10 Reverse -352 -371 20.649 0.0924
NP_441958.1_5 Reverse -369 -379 19.9412 0.00158
NP_441958.1_5 Forward -380 -370 2.53664 0.0409
NP_441958.1_5 Forward -87 -77 -0.118297 0.182
NP_441127.1_1 Forward -391 -377 7.86607 0.3
NP_442486.1_6 Forward -317 -298 -6.1954 0.28
NP_442836.1_5 Forward -385 -366 21.0423 0.0181
NP_439905.1_2 Reverse -100 -114 8.45605 0.262
NP_440984.1_7 Reverse -365 -379 14.7492 0.0687
NP_439990.1_5 Forward -384 -371 16.0472 0.0427
NP_442911.1_2 Forward -389 -370 -9.34199 0.254
NP_441580.1_6 Forward -390 -371 -5.9004 0.235
NP_440153.1_5 Forward -378 -364 4.91614 0.193
NP_442064.1_1 Forward -384 -365 -10.817 0.259
NP_443055.1_6 Forward -379 -361 9.6548 0.133
NP_440993.1_2 Reverse -365 -381 1.82849 0.276
NP_441913.1_3 Forward -195 -182 15.5315 0.218
NP_441913.1_3 Forward -184 -171 14.0036 0.299
NP_441129.1_3 Reverse -30 -49 -17.5035 0.281
NP_441099.1_5 Forward -263 -244 -9.73531 0.231
NP_442002.1_1 Reverse -5 -23 -9.42063 0.281
NP_442002.1_9 Forward -101 -94 11.3472 0.185
NP_442002.1_9 Forward -265 -258 10.5605 0.214
NP_441654.1_7 Forward -188 -169 18.3419 0.145
NP_441654.1_7 Reverse -177 -196 16.5993 0.155
NP_440475.1_1 Forward -388 -369 17.4901 0.0906
NP_442438.1_10 Forward -364 -350 9.43936 0.0637
NP_442438.1_10 Forward -384 -370 -0.0987402 0.248
NP_441000.1_6 Forward -380 -366 -2.16369 0.216
NP_441110.1_1 Reverse -23 -42 2.85105 0.297
NP_441110.1_10 Reverse -326 -345 13.2741 0.219
NP_440147.1_4 Reverse -368 -381 17.6205 0.00602
NP_440147.1_4 Forward -381 -368 7.09911 0.0755
NP_440147.1_4 Reverse -253 -266 3.5592 0.186
NP_441550.1_8 Reverse -368 -378 15.8108 0.0132
NP_441550.1_8 Forward -381 -371 11.9759 0.0397
NP_441916.1_7 Forward -379 -369 19.6462 0.00144
NP_441916.1_7 Reverse -370 -380 8.23984 0.0476
NP_441916.1_7 Forward -43 -33 1.06167 0.294
NP_440345.1_3 Reverse -180 -194 15.3858 0.209
NP_440345.1_3 Reverse -181 -195 11.9481 0.247
NP_441041.1_4 Reverse -244 -263 -4.03212 0.128
NP_441041.1_7 Reverse -367 -379 13.3454 0.0485
NP_441041.1_7 Forward -382 -370 11.5962 0.0757
NP_441041.1_7 Forward -267 -255 5.27969 0.265
NP_440569.1_7 Forward -329 -310 10.9142 0.286
NP_442004.1_6 Reverse -255 -269 9.04604 0.14
NP_441725.1_5 Forward -378 -368 1.94665 0.115
NP_441725.1_5 Reverse -92 -102 0.176696 0.206
NP_441725.1_5 Reverse -371 -381 -0.0199663 0.223
NP_439966.1_7 Reverse -368 -378 14.3359 0.0203
NP_439966.1_7 Forward -381 -371 6.56775 0.177
NP_439966.1_9 Forward -381 -372 0.884706 0.253
NP_442941.1_3 Forward -378 -368 19.2529 0.00262
NP_442941.1_3 Reverse -371 -381 8.4365 0.0356
NP_440289.1_2 Reverse -367 -380 3.36254 0.0799
NP_440289.1_2 Forward -111 -98 -2.93064 0.262
NP_440289.1_2 Forward -382 -369 -4.11062 0.28
NP_440983.1_5 Reverse -350 -369 -3.54046 0.239
NP_440983.1_5 Forward -328 -309 -7.37537 0.288
NP_442281.1_1 Reverse -365 -379 12.9786 0.0319
NP_442281.1_1 Reverse -29 -43 7.76712 0.0927
NP_442281.1_1 Forward -384 -370 6.78381 0.115
NP_442281.1_1 Forward -105 -91 4.91554 0.176
NP_441334.1_7 Forward -381 -362 -4.42544 0.12
NP_442256.1_2 Forward -381 -363 -0.472507 0.14
NP_440437.1_1 Reverse -364 -383 3.73603 0.116
NP_440437.1_4 Forward -263 -244 12.4875 0.209
NP_441087.1_6 Reverse -97 -115 13.4897 0.181
NP_441556.1_7 Reverse -19 -38 2.26028 0.269
NP_440498.1_1 Reverse -361 -379 -2.73412 0.245
NP_442982.1_5 Forward -111 -92 3.73603 0.202
NP_442982.1_5 Reverse -360 -379 3.34271 0.21
NP_441644.1_6 Forward -379 -369 16.6958 0.00284
NP_441644.1_6 Reverse -370 -380 7.94438 0.113
NP_441644.1_6 Reverse -77 -87 6.66608 0.152
NP_441644.1_6 Forward -253 -243 6.0761 0.167
NP_440867.1_10 Reverse -96 -115 1.76941 0.291
NP_440867.1_10 Forward -380 -361 0.982764 0.299
NP_442215.1_2 Reverse -89 -105 5.07341 0.0805
NP_442029.1_6 Reverse -29 -48 7.17762 0.225
NP_440253.1_2 Reverse -370 -388 5.23069 0.0955
NP_440253.1_2 Forward -379 -361 1.00246 0.173
NP_440929.1_8 Forward -379 -370 9.93116 0.0249
NP_440929.1_8 Reverse -370 -379 9.83282 0.0254
NP_442933.1_10 Forward -379 -370 17.601 0.00325
NP_442933.1_10 Reverse -370 -379 17.601 0.00325
NP_441751.2_8 Reverse -371 -385 -0.000409212 0.125
NP_441751.2_8 Forward -378 -364 -4.52363 0.174
NP_442554.1_8 Forward -378 -368 17.2863 0.00543
NP_442554.1_8 Reverse -371 -381 8.4365 0.0744
NP_442554.1_8 Reverse -245 -255 2.63497 0.265
NP_442554.1_8 Reverse -35 -45 2.53664 0.268
NP_442554.1_9 Forward -369 -350 12.9785 0.279
NP_441762.1_7 Reverse -369 -381 -4.68091 0.181
NP_441762.1_7 Forward -380 -368 -5.07423 0.187
NP_442142.1_4 Reverse -367 -380 10.0485 0.0806
NP_442142.1_4 Forward -323 -310 9.5568 0.0929
NP_442142.1_4 Forward -382 -369 5.91857 0.178
NP_442142.1_4 Reverse -31 -44 3.06699 0.268
NP_442292.1_1 Forward -378 -369 17.5026 0.00435
NP_442292.1_1 Reverse -371 -380 9.53783 0.0183
NP_442292.1_5 Reverse -87 -106 -0.983855 0.257
NP_442476.1_6 Reverse -371 -385 3.14618 0.161
NP_442476.1_6 Reverse -256 -270 1.47456 0.214
NP_442476.1_6 Forward -263 -249 -0.197071 0.29
NP_442381.1_8 Forward -382 -363 -2.36049 0.126
NP_443009.1_2 Reverse -372 -391 -1.47551 0.23
NP_443009.1_5 Forward -380 -369 10.4812 0.0792
NP_443009.1_5 Reverse -369 -380 9.10461 0.0965
NP_443009.1_5 Reverse -254 -265 9.10461 0.0965
NP_443009.1_5 Forward -265 -254 6.25303 0.169
NP_443009.1_5 Reverse -321 -332 3.5981 0.286
NP_441865.1_3 Reverse -382 -400 13.2938 0.252
NP_441741.1_6 Forward -165 -146 8.45592 0.249
NP_442092.1_4 Forward -303 -284 15.5349 0.227
NP_441715.1_4 Forward -378 -368 16.7946 0.0106
NP_441715.1_4 Reverse -371 -381 6.56821 0.138
NP_441715.1_4 Forward -263 -253 4.40493 0.281
NP_440620.1_4 Reverse -180 -194 14.0489 0.281
NP_440158.1_8 Reverse -47 -66 16.0274 0.139
NP_440183.1_9 Reverse -36 -55 -4.52377 0.194
NP_441198.1_8 Reverse -320 -330 13.662 0.108
NP_441198.1_8 Forward -266 -256 11.4158 0.207
NP_441198.1_8 Forward -333 -323 10.2438 0.289
NP_441468.1_1 Forward -378 -371 15.8704 0.0124
NP_441468.1_1 Reverse -371 -378 15.8704 0.0124
NP_441020.2_6 Forward -381 -364 9.47861 0.17
NP_441015.1_8 Forward -91 -72 7.17762 0.258
NP_441015.1_10 Reverse -35 -54 -8.16202 0.272
NP_441673.1_1 Forward -379 -370 11.1111 0.0121
NP_441673.1_1 Reverse -370 -379 11.0128 0.018
NP_441673.1_1 Reverse -77 -86 -7.86675 0.187
NP_441673.1_1 Forward -86 -77 -7.96508 0.206
NP_441426.1_3 Reverse -263 -282 8.06178 0.259
NP_441330.1_1 Reverse -29 -48 -13.8652 0.206
NP_441764.1_8 Forward -165 -155 10.7365 0.3
NP_442868.1_6 Reverse -368 -378 10.4031 0.038
NP_442868.1_6 Forward -381 -371 8.63316 0.0555
NP_442719.1_2 Reverse -200 -218 -11.2896 0.291
NP_442677.1_3 Reverse -95 -114 -6.1954 0.287
NP_441612.1_2 Reverse -14 -24 13.2931 0.21
NP_442808.1_1 Forward -254 -244 5.09279 0.173
NP_442808.1_1 Forward -332 -322 2.04455 0.279
NP_442808.1_1 Forward -318 -308 1.45457 0.285
NP_441101.1_7 Reverse -297 -316 13.4708 0.29
NP_442775.1_3 Forward -171 -152 14.3558 0.225
NP_440145.1_3 Reverse -360 -379 -0.197208 0.14
NP_440145.1_3 Forward -389 -370 -1.47551 0.152
NP_440145.1_3 Reverse -196 -215 -4.42544 0.231
NP_442542.1_2 Forward -145 -132 6.1158 0.234
NP_442542.1_9 Reverse -363 -377 18.2885 0.036
NP_442542.1_9 Forward -50 -36 12.487 0.11
NP_442050.1_5 Reverse -368 -378 15.9091 0.0091
NP_442050.1_5 Forward -381 -371 14.7292 0.0195
NP_440346.1_6 Forward -343 -333 14.9247 0.231
NP_440558.1_2 Forward -32 -13 -5.9004 0.267
NP_442789.1_4 Reverse -345 -364 -1.67217 0.222
NP_441518.1_3 Reverse -360 -379 -10.1286 0.236
NP_441878.1_6 Forward -380 -370 0.668351 0.139
NP_441878.1_6 Reverse -369 -379 0.668351 0.139
NP_441878.1_6 Forward -101 -91 -7.00147 0.201
NP_441878.1_6 Reverse -243 -253 -7.59145 0.245
NP_441036.1_8 Reverse -369 -379 11.7798 0.106
NP_441036.1_8 Forward -380 -370 8.04317 0.177
NP_441557.1_5 Reverse -370 -379 18.6826 0.0015
NP_441557.1_5 Forward -379 -370 10.5211 0.00695
NP_441445.1_1 Forward -388 -369 1.86774 0.247
NP_441445.1_1 Reverse -235 -254 1.37609 0.257
NP_441445.1_1 Reverse -40 -59 -0.4922 0.294
NP_441590.1_4 Reverse -251 -270 3.34192 0.29
NP_442066.2_9 Reverse -366 -379 8.18076 0.19
NP_442066.2_9 Forward -383 -370 8.18076 0.19
NP_441433.1_8 Reverse -77 -96 3.34271 0.208
NP_442962.1_1 Forward -154 -135 6.88262 0.24
NP_440738.1_5 Reverse -198 -217 1.76941 0.289
NP_441739.1_2 Reverse -207 -223 4.08943 0.247
NP_441308.1_8 Forward -333 -323 9.51814 0.226
NP_441308.1_8 Reverse -320 -330 8.4365 0.254
NP_442469.1_8 Forward -376 -362 13.2743 0.276
NP_442183.1_1 Reverse -322 -336 8.45605 0.115
NP_441574.1_1 Forward -391 -372 -6.29373 0.276
NP_442444.1_6 Reverse -12 -30 14.3715 0.215
NP_441549.1_9 Forward -33 -15 6.50899 0.0925
NP_441549.1_9 Reverse -313 -331 -9.91228 0.265
NP_442632.1_1 Reverse -136 -155 11.7983 0.251
NP_442347.1_2 Forward -378 -369 3.34298 0.284
NP_442347.1_2 Reverse -371 -380 2.94966 0.292
NP_441037.1_4 Reverse -368 -378 7.22024 0.237
NP_442594.1_8 Forward -284 -265 6.09597 0.236
NP_442047.1_2 Reverse -202 -216 13.8643 0.203
NP_441633.1_3 Reverse -368 -381 -3.81562 0.177
NP_440136.1_2 Forward -378 -371 15.9687 0.0123
NP_440136.1_2 Reverse -371 -378 15.9687 0.0123
NP_440136.1_2 Reverse -256 -263 3.97235 0.288
NP_442590.1_10 Forward -50 -31 4.03102 0.282
NP_442998.1_5 Forward -191 -181 13.353 0.158
NP_442998.1_5 Forward -190 -180 11.3864 0.187
NP_442998.1_5 Reverse -175 -185 9.81313 0.233
NP_442998.1_10 Forward -377 -370 15.5754 0.0102
NP_442998.1_10 Reverse -372 -379 5.74231 0.255
NP_442998.1_10 Reverse -22 -29 4.16902 0.259
NP_440899.1_2 Reverse -359 -378 6.68515 0.261
NP_440299.1_1 Forward -257 -244 8.57349 0.09
NP_441799.1_1 Forward -383 -369 12.6836 0.0415
NP_441799.1_1 Reverse -366 -380 11.7003 0.054
NP_440977.1_5 Reverse -169 -182 18.3082 0.103
NP_441007.1_10 Forward -384 -371 3.95252 0.182
NP_441007.1_10 Reverse -365 -378 2.67422 0.183
NP_441449.1_8 Reverse -112 -131 13.2109 0.29
NP_440256.1_1 Reverse -31 -50 7.17762 0.027
NP_440256.1_1 Forward -382 -363 3.93269 0.0488
NP_440256.1_1 Reverse -367 -386 -8.752 0.266
NP_441090.1_6 Reverse -244 -258 13.7659 0.125
NP_442283.1_4 Forward -89 -70 18.879 0.2
NP_441559.1_8 Reverse -161 -175 -4.03198 0.215
NP_441270.1_5 Reverse -238 -257 12.5063 0.236
NP_440915.1_6 Forward -383 -369 11.6026 0.0254
NP_440915.1_6 Reverse -318 -332 4.03116 0.1
NP_440915.1_6 Forward -147 -133 0.0979218 0.176
NP_442785.1_7 Forward -88 -74 8.45605 0.297
NP_442866.1_1 Forward -49 -30 -4.03212 0.224
NP_440306.1_8 Reverse -174 -193 -3.83621 0.299
NP_441939.1_3 Forward -378 -359 13.4708 0.0913
NP_441199.1_6 Forward -335 -316 -1.37718 0.292
NP_441494.1_6 Forward -269 -256 12.0157 0.225
NP_441494.1_6 Reverse -44 -57 11.524 0.225
NP_442993.1_1 Reverse -370 -386 -8.39793 0.166
NP_442993.1_1 Forward -379 -363 -9.47957 0.186
NP_442386.1_9 Forward -380 -371 14.8472 0.0287
NP_442386.1_9 Reverse -369 -378 6.39082 0.219
NP_440570.1_4 Forward -44 -26 8.27895 0.223
NP_441750.1_1 Forward -282 -263 -6.09707 0.224
NP_441750.1_4 Forward -50 -31 4.81767 0.208
NP_441340.1_5 Forward -378 -371 15.6737 0.0124
NP_441340.1_5 Reverse -371 -378 15.6737 0.0124
NP_441271.1_1 Forward -385 -367 11.3264 0.247
NP_442484.1_2 Forward -28 -9 0.884433 0.242
NP_440639.1_3 Forward -300 -281 20.944 0.0927
NP_440168.1_9 Reverse -345 -364 -0.787193 0.273
NP_441132.1_5 Reverse -32 -51 13.7658 0.287
NP_442240.1_2 Forward -378 -359 -20.65 0.295
NP_442714.1_7 Reverse -371 -390 1.0811 0.226
NP_441160.1_1 Reverse -41 -60 -2.55715 0.236
NP_441160.1_5 Forward -390 -371 -3.14714 0.288
NP_440586.1_8 Forward -378 -371 13.2151 0.026
NP_440586.1_8 Reverse -371 -378 13.2151 0.026
NP_440586.1_8 Reverse -35 -42 9.08521 0.178
NP_442251.1_6 Forward -378 -371 15.2804 0.0124
NP_442251.1_6 Reverse -371 -378 15.2804 0.0124
NP_440192.1_5 Forward -366 -347 17.109 0.116
NP_441262.1_3 Reverse -370 -377 14.7888 0.0223
NP_441262.1_3 Forward -379 -372 13.9038 0.0336
NP_443051.1_1 Reverse -369 -378 19.5676 0.00335
NP_443051.1_1 Forward -380 -371 1.08137 0.123
NP_439996.1_6 Forward -366 -347 7.33023 0.267
NP_439937.1_9 Reverse -104 -121 -9.49991 0.192
NP_439937.1_9 Reverse -378 -395 -10.9749 0.237
NP_441595.1_5 Reverse -252 -270 6.01734 0.231
NP_440926.1_9 Forward -163 -144 10.7175 0.275
NP_440439.1_1 Reverse -252 -265 4.54251 0.101
NP_440439.1_1 Reverse -367 -380 4.44418 0.103
NP_440439.1_1 Forward -334 -321 -0.37404 0.215
NP_440372.1_2 Forward -378 -371 16.3621 0.0124
NP_440372.1_2 Reverse -371 -378 16.3621 0.0124
NP_440819.1_5 Reverse -13 -21 7.98423 0.228
NP_440819.1_5 Forward -166 -158 7.98423 0.228
NP_440819.1_5 Forward -80 -72 7.59091 0.272
NP_440139.1_1 Reverse -364 -383 4.81688 0.17
NP_440267.1_2 Reverse -365 -379 10.8154 0.13
NP_440267.1_2 Reverse -29 -43 10.1271 0.15
NP_442384.1_10 Forward -379 -366 2.08423 0.237
NP_442114.1_4 Forward -379 -368 7.23683 0.291
NP_440364.1_10 Forward -387 -368 16.3224 0.244
NP_441877.1_5 Reverse -206 -225 2.65439 0.249
NP_441018.1_7 Reverse -87 -106 12.6841 0.154
NP_441018.1_7 Forward -369 -350 8.75091 0.241
NP_441018.1_7 Forward -33 -14 6.29264 0.294
NP_442262.1_10 Forward -378 -371 14.1988 0.0123
NP_442262.1_10 Reverse -371 -378 14.1988 0.0123
NP_442262.1_10 Reverse -35 -42 9.18389 0.211
NP_442262.1_10 Forward -364 -357 8.59391 0.22
NP_441689.1_5 Reverse -368 -378 8.3377 0.132
NP_441689.1_5 Forward -381 -371 8.14104 0.151
NP_441689.1_5 Reverse -253 -263 5.48612 0.251
NP_440282.1_10 Reverse -10 -29 -6.68705 0.25
NP_440826.1_5 Reverse -14 -32 15.8671 0.231
NP_440562.1_3 Reverse -371 -388 8.00365 0.15
NP_440562.1_3 Forward -378 -361 7.80699 0.15
NP_440297.1_9 Forward -378 -368 -0.216628 0.282
NP_440100.1_3 Reverse -363 -382 -1.96717 0.166
NP_440350.1_1 Reverse -305 -324 -4.03212 0.24
NP_440350.1_5 Forward -212 -193 3.83436 0.158
NP_442280.1_10 Forward -263 -245 13.9283 0.13
NP_441896.1_5 Forward -38 -31 12.2322 0.273
NP_441894.1_1 Reverse -140 -159 5.70265 0.0709
NP_440999.1_9 Forward -383 -369 8.55439 0.074
NP_440888.1_2 Forward -379 -365 13.6669 0.026
NP_440888.1_2 Reverse -370 -384 12.0937 0.0516
NP_440888.1_2 Forward -264 -250 5.1122 0.293
NP_440491.1_1 Forward -382 -363 8.37887 0.243
NP_442277.1_2 Reverse -104 -118 16.8142 0.167
NP_442277.1_4 Forward -52 -33 10.1267 0.0959
NP_442033.1_10 Forward -391 -372 -9.44032 0.215
NP_441543.1_2 Forward -378 -369 15.9293 0.00518
NP_441543.1_2 Reverse -371 -380 13.8644 0.021
NP_441543.1_2 Reverse -35 -44 4.81794 0.219
NP_442845.1_2 Forward -385 -371 5.60446 0.228
NP_442845.1_2 Reverse -238 -252 4.32615 0.261
NP_441304.1_10 Forward -103 -94 15.4377 0.164
NP_441551.1_5 Forward -383 -367 7.13767 0.249
NP_441319.1_8 Forward -35 -17 5.32902 0.28
NP_441469.1_8 Reverse -369 -378 6.5879 0.227
NP_442315.1_2 Reverse -239 -251 8.29878 0.297
NP_443064.1_6 Reverse -370 -380 8.97947 0.254
NP_443064.1_6 Reverse -218 -228 8.39772 0.292
NP_442578.1_7 Forward -378 -371 14.5921 0.026
NP_442578.1_7 Reverse -371 -378 14.5921 0.026
NP_441462.1_2 Reverse -370 -380 10.5998 0.0068
NP_441462.1_2 Forward -379 -369 10.5014 0.00824
NP_441462.1_2 Forward -86 -76 -1.19994 0.291
NP_443062.1_1 Reverse -370 -388 11.6662 0.0955
NP_443062.1_1 Forward -379 -361 3.37804 0.3
NP_440349.1_3 Reverse -371 -390 20.8447 0.06
NP_442204.1_1 Reverse -366 -377 2.02529 0.266
NP_442487.1_5 Reverse -90 -109 4.62021 0.242
NP_440516.1_6 Reverse -105 -119 7.47213 0.273
NP_440516.1_8 Reverse -370 -379 9.4395 0.0183
NP_440516.1_8 Forward -379 -370 7.17789 0.0754
NP_442428.1_5 Forward -378 -371 15.8704 0.0124
NP_442428.1_5 Reverse -371 -378 15.8704 0.0124
NP_442120.1_10 Forward -106 -87 -14.0619 0.288
NP_440673.1_3 Reverse -372 -379 14.0021 0.0426
NP_440673.1_3 Forward -377 -370 12.4288 0.0426
NP_440673.1_3 Reverse -309 -316 5.54565 0.288
NP_441052.1_2 Reverse -370 -380 10.1081 0.0295
NP_441052.1_2 Reverse -244 -254 4.0116 0.168
NP_441052.1_2 Forward -379 -369 1.94665 0.221
NP_442219.1_9 Reverse -371 -380 18.486 0.00718
NP_442219.1_9 Forward -378 -369 8.25953 0.0681
NP_440436.1_4 Reverse -371 -380 15.9289 0.00508
NP_440436.1_4 Forward -378 -369 9.24241 0.0871
NP_440436.1_4 Reverse -98 -107 5.80084 0.182
NP_441884.1_9 Forward -103 -84 -15.2418 0.138
NP_440314.1_9 Reverse -371 -390 -5.80207 0.225
NP_440314.1_9 Reverse -127 -146 -9.93197 0.281
NP_441719.1_4 Forward -378 -371 16.3621 0.0124
NP_441719.1_4 Reverse -371 -378 16.3621 0.0124
NP_441733.1_10 Forward -382 -369 8.37742 0.14
NP_441004.1_1 Forward -282 -263 1.96607 0.111
NP_441004.1_1 Forward -222 -203 -17.8968 0.295
NP_441004.1_4 Forward -146 -136 10.5998 0.254
NP_442813.1_4 Reverse -326 -345 -4.52377 0.299
NP_442873.1_9 Forward -389 -370 4.12856 0.287
NP_441115.1_4 Reverse -369 -387 7.29487 0.291
NP_442694.1_9 Forward -225 -206 12.0942 0.207
NP_442206.1_10 Reverse -370 -385 2.63483 0.201
NP_440328.1_4 Reverse -364 -383 2.45773 0.201
NP_440328.1_4 Forward -49 -30 2.0644 0.211
NP_443054.1_2 Reverse -368 -382 0.491246 0.262
NP_442430.1_10 Reverse -360 -379 10.9134 0.262
NP_441851.1_10 Reverse -369 -379 9.7148 0.114
NP_441851.1_10 Forward -380 -370 6.56821 0.161
NP_441851.1_10 Forward -265 -255 5.87989 0.196
NP_441542.1_4 Forward -193 -179 3.73617 0.264
NP_442856.1_7 Reverse -361 -380 -5.9004 0.289
NP_442515.1_1 Reverse -125 -139 1.37622 0.161
NP_442515.1_1 Reverse -369 -383 -4.7203 0.298
NP_441982.1_6 Forward -248 -239 12.2944 0.286
NP_441982.1_6 Reverse -186 -195 11.1485 0.288
NP_440165.1_5 Reverse -369 -388 -8.26035 0.297
NP_441349.1_10 Forward -96 -77 -7.86702 0.261
NP_441349.1_10 Reverse -251 -270 -8.752 0.278
NP_441409.1_6 Forward -385 -366 -5.60541 0.108
NP_441394.1_1 Reverse -327 -341 16.9125 0.271
NP_440432.1_9 Forward -378 -363 14.8279 0.0135
NP_440474.1_8 Forward -315 -301 6.58715 0.222
NP_440474.1_8 Forward -378 -364 6.29216 0.228
NP_440396.1_2 Reverse -41 -59 17.4237 0.193
NP_442168.1_5 Forward -330 -311 -1.08219 0.264
NP_440195.1_4 Forward -391 -372 4.42435 0.295
NP_442006.1_2 Forward -115 -98 -9.10594 0.197
NP_442006.1_2 Forward -344 -327 -16.2841 0.247
NP_443047.1_7 Forward -378 -359 5.60432 0.235
NP_441570.1_1 Forward -270 -252 -10.9939 0.184
NP_441078.1_4 Forward -379 -370 9.93116 0.0203
NP_441078.1_4 Reverse -370 -379 9.83282 0.0226
NP_441078.1_4 Reverse -244 -253 6.09625 0.0863
NP_441078.1_4 Reverse -322 -331 5.80125 0.104
NP_441078.1_4 Forward -331 -322 4.81794 0.126
NP_441078.1_4 Forward -253 -244 -2.06522 0.295
NP_442729.1_8 Forward -383 -370 7.00078 0.168
NP_440539.1_9 Reverse -354 -373 -6.49039 0.286
NP_442443.1_4 Reverse -146 -156 15.1225 0.179
NP_440526.1_3 Reverse -371 -382 10.6779 0.0646
NP_440526.1_3 Forward -378 -367 1.92649 0.267
NP_441432.1_8 Reverse -369 -378 16.8143 0.00595
NP_441432.1_8 Reverse -243 -252 10.0295 0.0681
NP_441432.1_8 Forward -380 -371 7.07956 0.105
NP_442320.1_8 Forward -385 -371 -2.85201 0.1
NP_442320.1_8 Reverse -364 -378 -3.93365 0.136
NP_441732.1_2 Reverse -366 -382 -15.6744 0.155
NP_441732.1_2 Reverse -16 -32 -16.7561 0.195
NP_441732.1_2 Forward -335 -319 -16.8544 0.207
NP_440497.1_6 Reverse -29 -48 -5.99873 0.264
NP_442797.1_6 Forward -377 -358 10.8429 0.238
NP_440199.1_10 Reverse -359 -369 7.05986 0.242
NP_440578.1_8 Reverse -61 -80 11.6025 0.257
NP_440913.1_1 Forward -381 -363 4.54237 0.265
NP_442400.1_10 Forward -185 -172 9.32449 0.271
NP_442400.1_10 Reverse -181 -194 8.46506 0.278
NP_442489.1_7 Forward -379 -370 10.4228 0.0151
NP_442489.1_7 Reverse -370 -379 10.3245 0.0193
NP_442489.1_7 Reverse -244 -253 -1.6719 0.235
NP_442489.1_7 Reverse -91 -100 -1.86856 0.259
NP_442489.1_7 Forward -100 -91 -1.96689 0.28
NP_442079.1_7 Reverse -371 -390 11.7008 0.097
NP_440559.1_1 Reverse -371 -380 17.5026 0.00658
NP_440559.1_1 Forward -378 -369 8.65285 0.0586
NP_440559.1_1 Reverse -256 -265 4.42462 0.277
NP_441659.2_8 Forward -379 -369 18.6629 0.00133
NP_441659.2_8 Reverse -370 -380 8.53483 0.0412
NP_441659.2_8 Forward -253 -243 3.22496 0.169
NP_440426.1_7 Reverse -24 -43 19.2723 0.0433
NP_440426.1_7 Reverse -360 -379 7.47261 0.207
NP_440860.1_8 Forward -37 -18 16.4207 0.209
NP_441022.1_1 Reverse -151 -160 13.081 0.216
NP_441022.1_1 Reverse -152 -161 12.4095 0.232
NP_440363.1_8 Forward -272 -253 13.3725 0.288
NP_442913.1_10 Reverse -361 -380 8.25926 0.0487
NP_442913.1_10 Forward -388 -369 2.45773 0.125
NP_442913.1_10 Forward -95 -76 -6.1954 0.296
NP_441040.1_2 Reverse -312 -331 -15.3402 0.286
NP_440315.1_6 Forward -85 -69 1.43517 0.289
NP_440779.1_5 Forward -379 -362 -5.07437 0.127
NP_442346.1_5 Reverse -369 -379 15.8113 0.0045
NP_442346.1_5 Forward -380 -370 14.533 0.0127
NP_442346.1_5 Forward -30 -20 4.60159 0.281
NP_442346.1_10 Reverse -95 -114 5.01433 0.168
NP_441629.1_3 Reverse -265 -284 -1.18128 0.259
NP_441653.1_2 Reverse -27 -46 5.94546 0.235
NP_440010.1_10 Forward -368 -349 14.0608 0.18
NP_442311.1_5 Reverse -377 -396 4.32602 0.245
NP_442603.1_7 Reverse -370 -384 7.07881 0.216
NP_441585.1_5 Reverse -199 -218 2.6536 0.262
NP_441585.1_5 Reverse -10 -29 0.883656 0.291
NP_441888.1_7 Forward -48 -34 1.96621 0.232
NP_441050.1_5 Reverse -247 -265 -3.12744 0.286
NP_441833.1_4 Forward -378 -371 15.9687 0.0124
NP_441833.1_4 Reverse -371 -378 15.9687 0.0124
NP_441329.1_6 Reverse -177 -196 -0.239153 0.27
NP_441329.1_6 Reverse -5 -24 -1.48055 0.293
NP_441112.1_6 Reverse -360 -379 -3.54046 0.296
NP_442162.1_9 Forward -378 -371 16.2637 0.0124
NP_442162.1_9 Reverse -371 -378 16.2637 0.0124
NP_443015.1_4 Reverse -35 -54 17.404 0.248
NP_440224.1_1 Reverse -359 -378 0.786102 0.132
NP_442199.1_5 Reverse -362 -381 -3.24547 0.201
NP_442140.1_3 Reverse -371 -381 13.2547 0.0609
NP_442140.1_3 Forward -378 -368 4.69992 0.238
NP_440875.1_9 Forward -377 -367 15.867 0.0233
NP_440875.1_9 Forward -41 -31 9.05339 0.233
NP_441813.1_5 Reverse -368 -378 18.1713 0.00743
NP_441813.1_5 Forward -381 -371 7.94484 0.0517
NP_441813.1_7 Forward -323 -309 9.6354 0.241
NP_442089.1_6 Forward -215 -196 3.24438 0.275
NP_442089.1_9 Forward -209 -190 12.2908 0.277
NP_440590.1_4 Reverse -371 -384 3.46087 0.0735
NP_440590.1_4 Forward -378 -365 2.87088 0.0788
NP_440567.1_1 Reverse -371 -385 0.687908 0.236
NP_440567.1_1 Forward -378 -364 0.0979218 0.256
NP_442497.1_4 Reverse -166 -185 11.0289 0.271
NP_442497.1_10 Forward -378 -369 17.601 0.00813
NP_442497.1_10 Reverse -371 -380 8.55452 0.0294
NP_440821.1_4 Forward -381 -371 9.22315 0.0334
NP_440821.1_4 Reverse -368 -378 2.24165 0.131
NP_441239.1_9 Reverse -368 -380 8.88877 0.12
NP_441239.1_9 Forward -381 -369 5.54551 0.217
NP_441239.1_9 Reverse -253 -265 5.15219 0.227
NP_441239.1_9 Reverse -32 -44 4.36554 0.253
NP_440156.1_4 Forward -186 -176 13.2542 0.176
NP_442568.1_8 Forward -76 -62 9.73436 0.257
NP_441727.1_5 Forward -199 -180 18.1156 0.233
NP_441892.1_1 Reverse -276 -293 -6.05768 0.296
NP_442044.1_1 Reverse -250 -269 -7.08038 0.22
NP_442044.1_1 Forward -331 -312 -8.16202 0.244
NP_440219.1_4 Forward -190 -177 15.732 0.223
NP_442643.1_3 Forward -49 -30 -8.55534 0.295
NP_440833.1_6 Reverse -266 -280 11.7987 0.215
NP_440833.1_6 Reverse -206 -220 6.98048 0.292
NP_442138.1_10 Forward -379 -360 -7.57203 0.29
NP_442052.1_8 Forward -108 -98 12.1731 0.285
NP_440546.1_4 Forward -379 -369 14.3121 0.0459
NP_440546.1_4 Reverse -370 -380 11.6943 0.0748
NP_440546.1_4 Forward -29 -19 8.6886 0.176
NP_440546.1_4 Reverse -244 -254 7.23423 0.252
NP_440462.1_6 Reverse -368 -378 18.7612 0.00454
NP_440462.1_6 Forward -381 -371 9.61647 0.0429
NP_440462.1_6 Reverse -253 -263 6.56821 0.109
NP_442340.1_3 Reverse -36 -55 -1.27885 0.187
NP_440868.1_4 Reverse -366 -378 7.80712 0.0637
NP_440868.1_4 Forward -383 -371 1.51394 0.181
NP_440270.1_6 Forward -264 -245 9.53756 0.254
NP_441474.1_1 Reverse -265 -284 -1.77127 0.264
NP_441672.1_6 Reverse -96 -115 13.8633 0.175
NP_440341.1_7 Reverse -209 -223 12.8809 0.2
NP_442402.1_1 Reverse -148 -167 9.0459 0.277
NP_442402.1_10 Forward -23 -13 10.8943 0.275
NP_442402.1_10 Reverse -156 -166 10.8943 0.275
NP_441848.1_7 Reverse -151 -170 -2.36125 0.264
NP_441084.1_6 Reverse -18 -32 13.1254 0.145
NP_441084.1_6 Reverse -32 -46 12.3498 0.164
NP_441084.1_6 Reverse -368 -382 11.962 0.179
NP_442039.1_4 Forward -378 -371 15.1821 0.0124
NP_442039.1_4 Reverse -371 -378 15.1821 0.0124
NP_442039.1_4 Forward -263 -256 10.8555 0.109
NP_441811.1_8 Forward -270 -256 19.4691 0.0457
NP_441811.1_8 Forward -385 -371 5.89945 0.289
NP_441926.1_3 Forward -379 -363 5.95839 0.17
NP_441926.1_3 Reverse -322 -338 4.0901 0.201
NP_440825.1_7 Reverse -371 -381 12.5193 0.155
NP_442837.1_3 Forward -378 -371 15.7721 0.0124
NP_442837.1_3 Reverse -371 -378 15.7721 0.0124
NP_442837.1_3 Reverse -260 -267 5.74231 0.275
NP_442053.1_1 Reverse -370 -379 9.24284 0.068
NP_442053.1_1 Forward -379 -370 8.94785 0.07
NP_442053.1_1 Reverse -77 -86 6.19458 0.139
NP_440505.1_3 Reverse -368 -378 17.188 0.00332
NP_440505.1_3 Forward -333 -323 9.51814 0.122
NP_440505.1_3 Forward -381 -371 6.8632 0.169
NP_440505.1_3 Reverse -253 -263 4.99491 0.252
NP_440505.1_3 Forward -31 -21 4.50326 0.284
NP_442360.1_5 Forward -150 -140 14.0414 0.242
NP_442360.1_5 Reverse -245 -255 12.9597 0.298
NP_441701.1_3 Forward -282 -265 7.11867 0.266
NP_441252.1_6 Forward -192 -185 14.3954 0.168
NP_440914.1_1 Forward -379 -369 15.0561 0.00832
NP_440914.1_1 Reverse -370 -380 8.51751 0.186
NP_441011.1_8 Forward -378 -369 16.6177 0.00602
NP_441011.1_8 Reverse -371 -380 9.53783 0.123
NP_442101.1_10 Reverse -83 -102 -13.2752 0.288
NP_442533.1_1 Forward -233 -214 -14.8485 0.247
NP_442533.1_6 Reverse -370 -379 15.1427 0.00675
NP_442533.1_6 Reverse -77 -86 8.94785 0.0695
NP_442533.1_6 Forward -379 -370 7.47288 0.0898
NP_442533.1_6 Forward -253 -244 5.40793 0.14
NP_442533.1_6 Forward -43 -34 4.81794 0.172
NP_442541.1_10 Reverse -97 -111 7.07881 0.247
NP_442541.1_10 Reverse -133 -147 5.01387 0.248
NP_442232.1_3 Forward -272 -253 -13.8652 0.283
NP_441482.1_7 Forward -106 -92 -9.73518 0.209
NP_441482.1_7 Reverse -364 -378 -12.1934 0.29
NP_439944.1_9 Reverse -371 -381 17.4829 0.00423
NP_439944.1_9 Forward -378 -368 9.12481 0.1
NP_439944.1_9 Forward -202 -192 4.99491 0.284
NP_441028.1_6 Reverse -137 -147 5.78111 0.243
NP_441028.1_6 Forward -22 -12 5.48612 0.255
NP_441028.1_6 Reverse -157 -167 3.51951 0.292
NP_440116.1_8 Reverse -371 -390 9.14423 0.0354
NP_440116.1_8 Forward -378 -359 -9.83364 0.29
NP_441527.1_4 Forward -76 -57 -1.19407 0.146
NP_440115.1_6 Forward -382 -372 8.53483 0.13
NP_440115.1_6 Forward -267 -257 5.5849 0.236
NP_440115.1_6 Reverse -367 -377 4.89658 0.28
NP_440007.1_9 Reverse -366 -380 1.08123 0.29
NP_441347.1_5 Reverse -249 -263 12.192 0.245
NP_441602.1_4 Reverse -359 -378 9.0459 0.279
NP_441106.1_1 Reverse -369 -378 18.486 0.0028
NP_441106.1_1 Forward -380 -371 8.75118 0.0469
NP_442588.1_5 Reverse -29 -48 14.8474 0.144
NP_442588.1_6 Forward -46 -27 3.14605 0.219
NP_441286.1_1 Reverse -369 -381 2.98891 0.051
NP_441286.1_1 Forward -380 -368 -3.20594 0.145
NP_441286.1_1 Reverse -90 -102 -5.36923 0.197
NP_442674.1_3 Forward -92 -73 4.03023 0.294
NP_440670.1_8 Reverse -370 -379 8.94785 0.0606
NP_440670.1_8 Forward -379 -370 8.84951 0.0606
NP_442908.1_1 Forward -134 -115 1.76941 0.277
NP_440828.1_4 Forward -327 -308 -4.72118 0.246
NP_440828.1_4 Reverse -19 -38 -5.1145 0.254
NP_442614.1_2 Reverse -370 -384 14.1593 0.104
NP_442072.1_9 Reverse -362 -380 -15.2222 0.174
NP_440513.1_6 Reverse -360 -379 9.93006 0.249
NP_442213.1_5 Reverse -306 -325 -0.295539 0.282
NP_441808.1_8 Reverse -299 -318 7.17762 0.283
NP_442022.1_4 Forward -282 -263 5.60432 0.279
NP_440907.2_8 Forward -378 -368 9.616 0.103
NP_440907.2_8 Reverse -371 -381 8.04271 0.117
NP_440907.2_8 Forward -330 -320 5.48612 0.198
NP_440907.2_8 Reverse -256 -266 4.10949 0.278
NP_441463.1_3 Reverse -87 -106 -7.37537 0.257
NP_441463.1_3 Reverse -297 -316 -9.047 0.276
NP_441626.1_2 Forward -378 -371 15.7721 0.0124
NP_441626.1_2 Reverse -371 -378 15.7721 0.0124
NP_442362.1_7 Reverse -31 -49 10.7372 0.277
NP_441460.1_2 Forward -153 -140 15.4566 0.172
NP_442615.1_1 Forward -388 -370 8.96727 0.0266
NP_442615.1_1 Reverse -361 -379 1.19912 0.0894
NP_441962.1_4 Forward -278 -259 -4.52377 0.158
NP_440387.1_1 Forward -365 -349 -6.62797 0.298
NP_441431.1_2 Reverse -367 -381 10.1271 0.169
NP_441431.1_2 Forward -89 -75 6.0955 0.28
NP_441836.1_2 Forward -279 -260 -2.75381 0.231
NP_441836.1_2 Reverse -14 -33 -4.22878 0.255
NP_441836.1_2 Reverse -238 -257 -4.72043 0.262
NP_440114.1_10 Forward -379 -365 19.0758 0.00367
NP_440114.1_10 Reverse -255 -269 9.14437 0.183
NP_441817.1_7 Forward -281 -262 17.994 0.13
NP_442698.1_10 Forward -257 -238 0.58944 0.297
NP_442323.1_7 Reverse -115 -134 3.83357 0.232
NP_440287.1_6 Forward -388 -369 10.4225 0.134
NP_440293.1_10 Forward -279 -260 15.3391 0.0702
NP_440766.1_5 Forward -192 -180 10.3296 0.272
NP_439988.1_10 Forward -188 -169 5.9443 0.291
NP_442743.1_4 Reverse -35 -54 -7.37537 0.279
NP_439910.1_2 Forward -387 -370 -13.7275 0.162
NP_442867.1_8 Reverse -327 -346 4.32602 0.284
NP_440457.1_1 Forward -272 -260 2.59558 0.207
NP_440457.1_1 Forward -147 -135 2.59558 0.207
NP_440457.1_1 Reverse -366 -378 -0.551008 0.268
NP_440213.1_5 Forward -163 -144 12.1925 0.208
NP_440798.1_6 Forward -378 -365 3.26421 0.151
NP_441801.1_4 Reverse -211 -221 2.63497 0.29
NP_440801.1_9 Forward -211 -197 13.8049 0.262
NP_441436.1_8 Forward -144 -125 7.17762 0.293
NP_440473.1_1 Reverse -31 -50 13.9568 0.179
NP_440473.1_9 Forward -117 -98 4.62101 0.0931
NP_442514.1_5 Reverse -134 -153 -3.63955 0.231
NP_440554.1_4 Forward -378 -368 17.9746 0.0131
NP_440554.1_4 Reverse -371 -381 8.4365 0.0749
NP_441885.1_5 Reverse -370 -380 19.6462 0.00179
NP_441885.1_5 Reverse -244 -254 7.64985 0.0466
NP_441885.1_5 Forward -379 -369 1.65166 0.106
NP_441885.1_5 Forward -86 -76 -0.41329 0.197
NP_440478.1_10 Forward -45 -31 10.6193 0.193
NP_442341.1_7 Forward -254 -240 9.63603 0.0726
NP_441173.1_9 Reverse -183 -191 12.1137 0.21
NP_441173.1_9 Reverse -158 -166 9.75379 0.284
NP_441173.1_9 Forward -21 -13 9.75379 0.284
NP_442534.1_7 Reverse -362 -381 11.2092 0.192
NP_443000.1_3 Forward -115 -96 10.7468 0.267
NP_443000.1_7 Reverse -368 -378 20.3345 0.00223
NP_443000.1_7 Forward -381 -371 9.7148 0.0437
NP_440507.2_3 Reverse -37 -56 11.3067 0.19
NP_441842.1_1 Reverse -22 -35 12.2117 0.222
NP_441842.1_10 Reverse -363 -377 6.48943 0.286
NP_440275.1_3 Reverse -368 -378 16.1063 0.0155
NP_440275.1_3 Forward -381 -371 9.12481 0.055
NP_440275.1_3 Forward -88 -78 3.02829 0.237
NP_440091.1_1 Forward -383 -371 13.0187 0.0346
NP_440091.1_1 Reverse -366 -378 1.41561 0.197
NP_443010.1_10 Reverse -367 -384 10.6948 0.119
NP_441122.1_1 Reverse -240 -255 9.41967 0.28
NP_439962.1_4 Reverse -26 -45 -5.50708 0.28
NP_441875.1_7 Forward -219 -209 15.9097 0.227
NP_441105.1_3 Reverse -86 -105 3.93269 0.0851
NP_440216.1_1 Forward -379 -365 15.9292 0.00309
NP_440216.1_1 Reverse -77 -91 4.52282 0.0244
NP_440216.1_9 Reverse -202 -211 13.8644 0.184
NP_440172.1_1 Reverse -370 -380 17.2863 0.00544
NP_440172.1_1 Forward -379 -369 7.84651 0.0718
NP_440172.1_1 Forward -100 -90 6.8632 0.0991
NP_442371.1_1 Reverse -174 -184 14.3359 0.191
NP_440167.1_3 Forward -116 -97 9.73422 0.247
NP_441226.1_7 Forward -378 -371 14.4934 0.0123
NP_441226.1_7 Reverse -371 -378 14.4934 0.0123
NP_441111.1_7 Forward -378 -370 18.7023 0.00294
NP_441111.1_7 Reverse -371 -379 8.86921 0.0589
NP_441766.1_2 Reverse -370 -379 17.896 0.00297
NP_441766.1_2 Forward -379 -370 9.4395 0.0285
NP_441766.1_2 Reverse -77 -86 1.27803 0.296
NP_440416.1_1 Forward -379 -360 -11.4069 0.272
NP_440416.1_9 Forward -50 -31 -20.3551 0.284
NP_443052.1_9 Reverse -132 -151 -2.36049 0.238
NP_443052.1_9 Reverse -262 -281 -6.29373 0.281
NP_440072.1_5 Forward -279 -261 -1.65248 0.259
NP_442154.1_1 Forward -46 -28 -18.1721 0.278
NP_442564.1_10 Reverse -104 -118 8.06273 0.296
NP_440261.1_5 Forward -378 -365 -2.83231 0.0932
NP_440261.1_5 Reverse -371 -384 -3.32397 0.127
NP_440261.1_5 Reverse -21 -34 -6.76555 0.201
NP_440988.1_5 Reverse -204 -223 16.7593 0.177
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAACTTTGGGCGGTATTAGTAGCGATCGCCTGTTGGCCATTGAGGTGCTCTGGACGCCCCAAGAAGAAGGGGATACCCTCACCAGCAACGACATTATCAGCGAATATCCAGAACTCAGGCTGGTGTAGTGGTGGGAGCGATTCCTTGCCCATAGCCAAAAAATACATATTTGAGTGAGCCTGGGGAACTTTGCCTGGGCTTTCTTTTTTGGGCAAAATTTATCCAGAATATGCCGGGGAAAACTTTTTGCCTCTGGGGGAATGGGTCTAATGCCATAATTTTCGGGGCAAGGGAGCAAGGGCAATTTCCAACAGGCGCCCGGCAAAAAAGGTAATAATCAGAGCAGTTACCCCGCCGTCCATGGCTTGGTGGCCATAGTTTTCCCCGTAGCTTGTAACC

CDS

ATGATTCCCTTTGCTTCCCAAACCTCCTCCCTCGTCAGTCACCCCGAACTTTCTGCCCTAGAACTGGCCCAGGCCCTAGCGGAAAGATTGGCGATCGCCCCCCAGGATTGGCATCGTTTAAAGGGTAATCGTCAAGCCCAGGCCGGACAAGAATTGGCAGCGGCATTGGTGTATCTACTCAAAGATAATCCCCAGGAAGCCTTAACCCATGTGCAACAGGCAGAAGGTTGGTTAGACCGCAGTTTGAGTGCGCCTCCCTGTCCGACCCACGGCAATCGGTCTCAAAAAGCCTAG

Protein

MIPFASQTSSLVSHPELSALELAQALAERLAIAPQDWHRLKGNRQAQAGQELAAALVYLLKDNPQEALTHVQQAEGWLDRSLSAPPCPTHGNRSQKA