Your browser is old and dusty. Try Google Chrome!

Details for ssr0482

ORF ssr0482
Accession NP_441830.1
Symbol rps16
Category Ribosomal proteins: synthesis and modification
Definition 30S ribosomal protein S16
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -368 -382 -1.37704 0.258
NP_441418.1_6 Forward -107 -88 -30.5815 0.286
NP_443032.1_6 Reverse -125 -144 17.0107 0.115
NP_441453.1_4 Reverse -114 -122 4.34598 0.257
NP_440259.1_4 Forward -19 -5 13.167 0.226
NP_443027.1_4 Reverse -112 -122 8.04317 0.219
NP_441812.1_1 Forward -363 -349 17.0102 0.188
NP_442975.1_10 Forward -386 -372 4.71887 0.241
NP_440878.1_4 Forward -146 -128 15.0638 0.191
NP_442062.1_8 Forward -107 -97 5.28991 0.176
NP_440304.1_4 Forward -378 -368 4.50326 0.261
NP_440916.1_1 Reverse -247 -261 11.996 0.206
NP_441619.1_9 Forward -172 -153 2.16274 0.294
NP_441208.1_9 Reverse -217 -231 7.17775 0.226
NP_441208.1_9 Reverse -198 -212 5.99778 0.254
NP_442742.1_9 Forward -99 -80 -8.55534 0.265
NP_440132.1_1 Reverse -258 -276 8.7706 0.263
NP_441083.1_5 Reverse -108 -118 6.46988 0.0838
NP_441434.1_6 Reverse -348 -358 13.8447 0.295
NP_441738.1_2 Reverse -100 -107 13.8051 0.0221
NP_441558.1_5 Reverse -112 -131 13.8641 0.0544
NP_440209.1_1 Reverse -98 -106 2.1827 0.254
NP_442889.1_8 Forward -126 -112 4.12889 0.27
NP_442570.1_3 Reverse -125 -144 -8.94866 0.294
NP_440747.1_10 Forward -120 -108 -12.1541 0.227
NP_441130.1_7 Reverse -221 -235 14.6503 0.287
NP_440403.1_10 Forward -126 -107 1.0811 0.291
NP_441014.1_10 Reverse -321 -340 6.09517 0.175
NP_441014.1_10 Reverse -270 -289 -2.16459 0.274
NP_442848.1_1 Reverse -146 -160 0.0979218 0.263
NP_442848.1_5 Reverse -226 -244 6.01734 0.232
NP_443018.1_3 Forward -122 -115 12.5271 0.0523
NP_443018.1_3 Reverse -115 -122 12.5271 0.0523
NP_443018.1_3 Forward -106 -99 9.77388 0.118
NP_440376.1_1 Reverse -227 -236 3.63797 0.2
NP_440376.1_1 Forward -243 -234 0.491382 0.273
NP_442687.1_7 Reverse -97 -107 6.07655 0.179
NP_440642.1_10 Reverse -293 -307 4.62054 0.25
NP_441013.1_2 Reverse -103 -121 -0.964162 0.276
NP_441013.1_2 Forward -112 -94 -4.99573 0.299
NP_442766.1_9 Reverse -319 -338 14.1591 0.249
NP_441029.1_8 Forward -340 -321 19.5664 0.242
NP_442658.1_1 Forward -125 -115 5.58445 0.262
NP_440141.1_8 Forward -151 -132 4.22769 0.292
NP_440617.1_10 Forward -377 -358 5.30933 0.264
NP_441855.2_4 Reverse -90 -109 10.1015 0.261
NP_440669.1_3 Reverse -211 -230 19.5047 0.225
NP_442544.1_2 Forward -144 -130 -0.983719 0.254
NP_439919.1_1 Forward -358 -341 21.0809 0.0545
NP_441317.1_4 Forward -15 -1 10.5144 0.289
NP_439990.1_5 Forward -112 -99 8.86907 0.158
NP_440153.1_5 Forward -160 -146 1.86788 0.245
NP_440153.1_8 Reverse -114 -127 1.78924 0.22
NP_441099.1_5 Forward -386 -367 -12.0953 0.294
NP_442002.1_9 Forward -108 -101 9.67555 0.27
NP_442598.1_2 Reverse -48 -57 14.2577 0.252
NP_441294.1_7 Forward -236 -222 9.34661 0.249
NP_442440.1_7 Forward -111 -92 9.43923 0.23
NP_441646.1_1 Forward -130 -111 2.0644 0.221
NP_442566.1_7 Reverse -322 -341 19.174 0.104
NP_440147.1_4 Forward -119 -106 2.08423 0.21
NP_441175.1_10 Reverse -323 -341 7.59063 0.3
NP_441041.1_4 Reverse -108 -127 -8.94866 0.209
NP_441041.1_7 Reverse -364 -376 7.12607 0.176
NP_441725.1_4 Reverse -244 -258 6.39049 0.277
NP_441725.1_5 Forward -106 -96 7.74818 0.0843
NP_441725.1_5 Reverse -115 -125 5.68323 0.115
NP_439966.1_9 Forward -109 -100 7.86621 0.253
NP_440289.1_2 Reverse -105 -118 -4.30728 0.286
NP_440260.1_8 Forward -110 -92 -4.79907 0.273
NP_442281.1_1 Reverse -109 -123 1.86729 0.285
NP_440437.1_1 Reverse -92 -111 -1.37718 0.201
NP_440647.1_10 Reverse -368 -387 6.78429 0.296
NP_441556.1_4 Forward -343 -324 10.9692 0.261
NP_441644.1_6 Reverse -114 -124 7.45273 0.124
NP_440652.1_1 Forward -238 -219 2.65439 0.298
NP_442215.1_2 Forward -109 -93 2.12349 0.122
NP_442215.1_2 Reverse -365 -381 -5.84132 0.26
NP_440253.1_2 Reverse -367 -385 -2.14413 0.261
NP_440253.1_2 Reverse -108 -126 -3.71743 0.3
NP_442671.1_2 Forward -55 -36 6.17969 0.141
NP_442554.1_4 Forward -220 -201 6.98095 0.291
NP_442554.1_8 Reverse -115 -125 11.4848 0.0355
NP_442554.1_8 Forward -122 -112 4.10993 0.198
NP_442554.1_9 Reverse -327 -346 15.2663 0.217
NP_441762.1_7 Reverse -97 -109 -6.05754 0.268
NP_442142.1_4 Reverse -119 -132 3.26365 0.262
NP_442142.1_4 Reverse -95 -108 2.96866 0.269
NP_443009.1_5 Forward -377 -366 3.99143 0.268
NP_441726.1_4 Forward -221 -207 16.3225 0.249
NP_442406.1_9 Reverse -126 -145 -0.4922 0.291
NP_440730.1_4 Forward -376 -357 9.3409 0.165
NP_440183.1_9 Forward -121 -102 -4.42544 0.194
NP_441198.1_8 Forward -125 -115 10.8298 0.239
NP_441468.1_1 Reverse -115 -122 3.97235 0.277
NP_441468.1_1 Forward -122 -115 3.97235 0.277
NP_439939.1_4 Forward -362 -343 0.0977854 0.218
NP_441020.2_6 Forward -109 -92 7.61033 0.225
NP_440265.1_8 Forward -379 -361 13.1955 0.282
NP_441876.1_9 Reverse -251 -261 11.8776 0.269
NP_441876.1_9 Forward -147 -137 11.2876 0.278
NP_441826.1_2 Reverse -92 -106 3.8345 0.105
NP_441826.1_2 Reverse -108 -122 -4.81863 0.3
NP_441637.1_9 Reverse -248 -266 -3.52077 0.296
NP_441764.1_8 Forward -212 -202 11.8849 0.284
NP_442808.1_1 Reverse -107 -117 7.94438 0.0634
NP_442775.1_6 Forward -112 -93 9.73422 0.292
NP_442542.1_2 Forward -109 -96 8.9674 0.142
NP_442113.1_9 Forward -201 -182 10.7175 0.0801
NP_442050.1_5 Reverse -96 -106 8.3377 0.234
NP_440346.1_6 Forward -60 -50 16.5767 0.142
NP_440558.1_2 Reverse -119 -138 1.27776 0.182
NP_440558.1_2 Forward -126 -107 -6.39206 0.274
NP_441048.1_6 Forward -359 -345 15.4813 0.296
NP_441878.1_6 Forward -124 -114 0.57002 0.14
NP_441557.1_8 Reverse -157 -167 13.2542 0.224
NP_440084.1_8 Forward -295 -281 9.27434 0.29
NP_440084.1_8 Reverse -282 -296 8.98786 0.297
NP_441914.1_2 Forward -145 -127 22.6353 0.0209
NP_442183.1_1 Reverse -367 -381 3.8345 0.295
NP_442494.1_7 Forward -121 -102 1.67108 0.246
NP_442347.1_2 Reverse -250 -259 6.5879 0.163
NP_442645.1_2 Forward -384 -365 -9.63698 0.143
NP_441037.1_4 Forward -125 -115 6.83041 0.239
NP_442594.1_9 Reverse -344 -363 5.99684 0.291
NP_442590.1_10 Forward -201 -182 3.83436 0.283
NP_442998.1_5 Reverse -19 -29 12.7631 0.159
NP_442998.1_5 Reverse -18 -28 11.8781 0.176
NP_442998.1_5 Forward -257 -247 10.7964 0.204
NP_442998.1_5 Reverse -58 -68 9.32148 0.243
NP_442998.1_10 Reverse -110 -117 9.28223 0.117
NP_442998.1_10 Reverse -100 -107 6.23397 0.157
NP_440299.1_1 Forward -127 -114 6.80355 0.13
NP_442802.1_6 Forward -239 -220 -4.32711 0.249
NP_442333.2_5 Reverse -103 -122 -15.1435 0.289
NP_441559.1_8 Reverse -122 -136 -5.01529 0.245
NP_441559.1_8 Reverse -103 -117 -5.60527 0.267
NP_442302.1_6 Reverse -188 -207 11.3075 0.27
NP_441395.1_8 Reverse -2 -21 2.45773 0.296
NP_440915.1_6 Forward -111 -97 3.24451 0.104
NP_442158.1_4 Reverse -82 -92 13.0581 0.239
NP_441179.1_6 Reverse -319 -338 16.7157 0.295
NP_440717.1_3 Reverse -157 -171 8.06211 0.27
NP_442866.1_1 Forward -112 -93 0.196116 0.183
NP_440677.1_6 Forward -175 -156 9.43923 0.27
NP_442386.1_9 Reverse -113 -122 11.3073 0.0971
NP_441750.1_1 Reverse -128 -147 -11.0136 0.3
NP_441340.1_5 Reverse -115 -122 4.07068 0.239
NP_441340.1_5 Forward -122 -115 4.07068 0.239
NP_441340.1_9 Reverse -18 -28 8.25522 0.256
NP_441340.1_9 Forward -362 -352 7.48397 0.256
NP_441947.1_2 Forward -123 -105 12.3105 0.261
NP_440327.1_6 Reverse -325 -344 6.98095 0.228
NP_442240.1_2 Forward -116 -97 -14.6519 0.185
NP_440586.1_8 Forward -122 -115 7.61025 0.227
NP_440586.1_8 Reverse -115 -122 7.61025 0.227
NP_441262.1_3 Forward -107 -100 11.5438 0.0584
NP_439937.1_9 Reverse -97 -114 -9.20492 0.183
NP_441657.1_5 Reverse -123 -142 10.1275 0.105
NP_441665.1_2 Reverse -148 -167 8.35759 0.248
NP_439943.1_7 Forward -381 -362 8.65258 0.181
NP_440819.1_5 Reverse -18 -26 7.59091 0.272
NP_440316.1_10 Reverse -191 -201 7.84651 0.245
NP_439977.1_7 Forward -387 -368 10.815 0.268
NP_440530.1_6 Reverse -48 -62 14.6205 0.293
NP_442262.1_10 Forward -106 -99 11.1505 0.115
NP_442262.1_10 Forward -122 -115 10.4622 0.145
NP_442262.1_10 Reverse -115 -122 10.4622 0.145
NP_441689.1_5 Forward -276 -266 7.0594 0.197
NP_440282.1_10 Forward -141 -122 -3.04881 0.235
NP_440282.1_10 Reverse -104 -123 -6.78538 0.25
NP_440282.1_10 Forward -78 -59 -10.3253 0.297
NP_440531.1_6 Reverse -106 -125 0.982764 0.183
NP_441640.1_8 Forward -112 -93 5.60432 0.111
NP_442750.1_3 Reverse -56 -75 -11.6036 0.256
NP_441898.1_8 Forward -339 -320 11.1109 0.134
NP_440297.1_9 Reverse -115 -125 9.81313 0.0917
NP_440297.1_9 Forward -122 -112 0.766681 0.282
NP_440350.1_5 Reverse -317 -336 1.96607 0.158
NP_440894.1_10 Reverse -103 -122 9.3409 0.163
NP_441894.1_1 Reverse -159 -178 -1.86883 0.155
NP_442845.1_2 Reverse -108 -122 15.1426 0.0752
NP_442845.1_2 Forward -137 -123 3.63784 0.282
NP_441178.1_6 Reverse -151 -170 7.57013 0.26
NP_441829.1_1 Reverse -72 -91 20.1573 0.0402
NP_441829.1_3 Reverse -232 -250 21.3561 0.106
NP_441829.1_5 Reverse -47 -65 19.4887 0.169
NP_441469.1_8 Forward -124 -115 11.3078 0.173
NP_442315.1_2 Forward -285 -273 10.8554 0.291
NP_442315.1_2 Reverse -52 -64 9.77374 0.291
NP_441462.1_2 Forward -107 -97 -1.29827 0.299
NP_441929.1_3 Forward -360 -341 5.89931 0.266
NP_443062.1_1 Reverse -98 -116 5.42569 0.229
NP_443062.1_6 Reverse -212 -231 2.65439 0.252
NP_440544.1_5 Reverse -205 -212 13.8024 0.28
NP_440516.1_8 Forward -107 -98 0.688044 0.136
NP_442080.1_7 Forward -121 -102 -2.95047 0.287
NP_442428.1_5 Forward -122 -115 4.36568 0.271
NP_442428.1_5 Reverse -115 -122 4.36568 0.271
NP_442120.1_10 Forward -382 -363 -14.4552 0.288
NP_441733.1_10 Forward -110 -97 5.03416 0.231
NP_441004.1_1 Reverse -92 -111 -17.7985 0.294
NP_442813.1_4 Reverse -322 -341 -8.55534 0.299
NP_442873.1_2 Forward -121 -102 12.9783 0.224
NP_443054.1_2 Forward -378 -364 0.88457 0.252
NP_441851.1_9 Reverse -130 -149 14.6508 0.166
NP_441851.1_10 Forward -124 -114 5.78156 0.2
NP_442515.1_1 Forward -233 -219 -3.147 0.287
NP_440593.1_3 Reverse -109 -128 -7.08038 0.285
NP_441661.1_3 Reverse -15 -32 1.71047 0.226
NP_441477.1_5 Forward -149 -130 6.88262 0.277
NP_441124.1_5 Reverse -18 -28 12.7217 0.215
NP_442450.1_5 Reverse -96 -106 7.84651 0.13
NP_441078.1_4 Forward -117 -108 -1.27858 0.246
NP_442443.1_1 Forward -109 -90 -5.9004 0.287
NP_441094.1_6 Forward -136 -119 7.80625 0.276
NP_440526.1_3 Reverse -115 -126 0.156538 0.297
NP_441432.1_8 Forward -118 -109 3.14632 0.259
NP_441432.1_8 Forward -383 -374 3.04799 0.268
NP_441732.1_2 Reverse -104 -120 -17.0511 0.231
NP_442797.1_7 Forward -144 -126 9.65558 0.169
NP_442353.1_4 Reverse -158 -177 1.47364 0.243
NP_442510.1_9 Forward -111 -97 19.3708 0.158
NP_442489.1_7 Forward -107 -98 -1.86856 0.259
NP_442489.1_7 Reverse -367 -376 -1.86856 0.259
NP_442489.1_7 Forward -376 -367 -1.96689 0.28
NP_441830.1_5 Forward -330 -311 19.6656 0.0779
NP_442763.1_10 Reverse -93 -112 1.17943 0.282
NP_441659.2_8 Reverse -114 -124 1.94665 0.22
NP_440860.1_7 Reverse -320 -339 15.2408 0.282
NP_442776.1_1 Reverse -234 -253 3.6377 0.279
NP_440779.1_5 Reverse -114 -131 -14.4158 0.246
NP_442346.1_5 Reverse -113 -123 11.2881 0.0706
NP_442346.1_5 Forward -124 -114 6.07655 0.216
NP_440352.1_5 Forward -267 -248 14.6025 0.14
NP_440352.1_5 Reverse -10 -29 13.3371 0.193
NP_440831.1_3 Reverse -89 -108 4.73683 0.298
NP_440010.1_10 Reverse -130 -149 4.42435 0.244
NP_442900.1_1 Forward -177 -158 -4.72043 0.233
NP_441888.1_7 Reverse -121 -135 1.08123 0.267
NP_441329.1_6 Reverse -9 -28 2.05265 0.231
NP_441329.1_6 Reverse -5 -24 1.76618 0.231
NP_442699.1_8 Forward -264 -245 -11.9969 0.238
NP_440224.1_4 Reverse -127 -146 2.0644 0.237
NP_442140.1_3 Reverse -115 -125 10.9931 0.0874
NP_440590.1_4 Forward -116 -103 3.95252 0.0658
NP_440590.1_4 Reverse -99 -112 2.77255 0.0813
NP_440821.1_4 Forward -125 -115 -0.609952 0.279
NP_440821.1_4 Forward -109 -99 -0.806614 0.296
NP_441239.1_9 Forward -125 -113 10.4621 0.0783
NP_442568.1_8 Forward -334 -320 10.3243 0.257
NP_441892.1_1 Reverse -105 -122 8.98696 0.0757
NP_442044.1_1 Forward -243 -224 -7.37537 0.224
NP_441017.1_6 Reverse -110 -124 12.2903 0.221
NP_442809.1_3 Reverse -180 -199 17.8948 0.186
NP_440546.1_4 Forward -131 -121 6.45857 0.296
NP_441230.1_5 Forward -134 -115 2.45773 0.214
NP_441230.1_5 Reverse -87 -106 1.47442 0.24
NP_440462.1_4 Forward -108 -94 5.30946 0.29
NP_440462.1_6 Forward -109 -99 4.89658 0.18
NP_441249.1_3 Forward -145 -126 0.491109 0.285
NP_442402.1_10 Forward -27 -17 13.4509 0.202
NP_442402.1_10 Reverse -157 -167 13.4509 0.202
NP_441848.1_4 Forward -331 -315 14.0441 0.179
NP_441848.1_4 Reverse -13 -29 8.60108 0.288
NP_441084.1_6 Forward -336 -322 9.8289 0.263
NP_440653.1_10 Reverse -115 -134 4.42435 0.252
NP_440653.1_10 Reverse -128 -147 3.83436 0.261
NP_442829.1_2 Reverse -12 -28 8.14109 0.287
NP_440160.1_2 Forward -136 -117 -2.45882 0.245
NP_442053.1_1 Reverse -98 -107 4.42462 0.249
NP_442255.1_5 Forward -237 -218 9.53756 0.255
NP_442533.1_6 Forward -123 -114 4.62128 0.179
NP_442541.1_10 Forward -123 -109 2.26061 0.263
NP_441482.1_7 Reverse -122 -136 -11.6035 0.275
NP_439944.1_9 Forward -122 -112 5.28991 0.262
NP_441028.1_6 Reverse -250 -260 10.6976 0.197
NP_441028.1_6 Forward -26 -16 5.19112 0.265
NP_441028.1_6 Reverse -205 -215 4.20782 0.278
NP_441028.1_6 Reverse -158 -168 4.01116 0.278
NP_441527.1_4 Forward -336 -317 -3.29489 0.164
NP_441527.1_4 Forward -337 -318 -6.15965 0.215
NP_441527.1_4 Forward -334 -315 -8.54695 0.247
NP_441527.1_4 Forward -339 -320 -10.1703 0.266
NP_441527.1_4 Forward -225 -206 -12.3666 0.285
NP_440007.1_9 Reverse -124 -138 9.43936 0.171
NP_443045.1_2 Forward -129 -110 17.0107 0.181
NP_441106.1_1 Forward -383 -374 2.16301 0.297
NP_441286.1_1 Forward -108 -96 -5.86088 0.229
NP_441286.1_1 Forward -138 -126 -6.2542 0.254
NP_440670.1_8 Forward -117 -108 5.01461 0.175
NP_441021.1_1 Reverse -115 -134 -3.73712 0.16
NP_441021.1_1 Reverse -368 -387 -10.817 0.248
NP_441463.1_6 Reverse -112 -126 7.4789 0.261
NP_442794.1_1 Reverse -130 -142 3.2839 0.286
NP_440387.1_1 Reverse -367 -383 -4.56302 0.19
NP_440387.1_1 Reverse -373 -389 -6.03799 0.262
NP_442090.1_2 Reverse -268 -287 8.73709 0.281
NP_440766.1_4 Reverse -94 -108 5.21113 0.113
NP_440766.1_4 Forward -121 -107 0.392915 0.286
NP_441979.1_5 Reverse -92 -111 -12.5869 0.228
NP_442930.1_1 Forward -29 -19 10.4026 0.276
NP_442867.1_8 Forward -149 -130 3.83436 0.297
NP_440457.1_1 Forward -127 -115 -0.0593532 0.25
NP_442680.1_7 Forward -287 -268 -0.688862 0.253
NP_442680.1_7 Reverse -11 -30 -6.58872 0.265
NP_441436.1_8 Forward -118 -99 9.73422 0.262
NP_441885.1_5 Reverse -128 -138 -1.29827 0.259
NP_441885.1_5 Forward -117 -107 -1.59326 0.273
NP_442703.1_9 Forward -288 -270 6.70565 0.244
NP_442703.1_9 Forward -71 -53 3.26407 0.297
NP_442341.1_7 Reverse -97 -111 9.34103 0.0751
NP_442341.1_7 Forward -118 -104 4.62115 0.185
NP_442341.1_7 Reverse -107 -121 3.04785 0.237
NP_441173.1_9 Forward -25 -17 10.9338 0.242
NP_442451.1_2 Forward -109 -90 -2.16383 0.179
NP_439962.1_4 Reverse -90 -109 -5.31042 0.278
NP_442495.1_3 Forward -177 -159 9.75391 0.282
NP_442495.1_5 Forward -134 -115 10.0292 0.266
NP_442495.1_5 Reverse -111 -130 6.4893 0.291
NP_440149.1_8 Reverse -367 -386 -5.70374 0.231
NP_441875.1_10 Reverse -162 -176 11.5043 0.299
NP_440172.1_1 Forward -107 -97 4.50326 0.184
NP_442371.1_1 Reverse -17 -27 15.4175 0.146
NP_442371.1_1 Forward -362 -352 11.8776 0.273
NP_442015.1_10 Forward -141 -128 6.80412 0.106
NP_442015.1_10 Reverse -104 -117 0.510939 0.224
NP_440416.1_9 Forward -124 -105 -7.96535 0.109
NP_440416.1_9 Forward -144 -125 -16.7168 0.22
NP_441135.1_4 Reverse -101 -120 1.76941 0.284
NP_440591.1_9 Forward -118 -100 4.6407 0.273
NP_442154.1_6 Forward -108 -89 9.0459 0.199
NP_442564.1_10 Reverse -161 -175 12.7826 0.244
NP_440261.1_5 Reverse -115 -128 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGAACTTTACGAGCTGAGACTATGGCAATTTCCGAGCCAGAAAAAATTCCATTTAACACCACCAAAACGAAGATGAAAAAAAGTTCCAGCTCAACAGAAGAGGAAAACATTCAATTTTTAGGGATAGAAATCCGGTAGGCCGGGGATAAATTTAGTGGGGAGTGGCTGACGACAAACATCAATCATAGAAGAAAACATCCCGACTGTCTGTGCTCCTGAGTCAGTTTGTGCCCGGGGGAGAGTTCGGAATCCTTGACCCCATTGGGAAAGCCCTGGTGCCATGGCTATCTGCGGCGATTGAGCTGGGCCCCTGAAAATTTACGACCCTAAAAATTCTGGCCCCAAAAAATAGGTTAGAATGATAAACGCGAAATTTTTCCCAGTCTATTTTTATTTAGT

CDS

ATGATTAAACTCCGTCTAAAACGCTTTGGTAAGAAACGTGAAGTTAGCTATCGGATCGTTGCCATGCACAGCACCACCCGCCGGGATGGTCGCCCCTTGGAAGAATTAGGATTCTATAATCCCCGCACCGATGAAACTCGCCTTGATGTACCGGCGATCGTCAAAAGATTAAAAGAAGGTGCCCAACCCACCGACACCGTCCGCTCCATTTTGACCAAAGCCCAGGTTTTCGAACAGCTAAAAGCTTAG

Protein

MIKLRLKRFGKKREVSYRIVAMHSTTRRDGRPLEELGFYNPRTDETRLDVPAIVKRLKEGAQPTDTVRSILTKAQVFEQLKA