Your browser is old and dusty. Try Google Chrome!

Details for ssr0390

ORF ssr0390
Accession NP_440039.1
Symbol psaK1
Category Photosystem I
Definition photosystem I reaction center subunit X
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -54 -35 -1.57384 0.276
NP_441418.1_6 Forward -250 -231 -27.7299 0.203
NP_441453.1_4 Reverse -32 -40 4.83764 0.237
NP_441453.1_7 Reverse -274 -281 12.9205 0.23
NP_441453.1_7 Reverse -90 -97 12.9205 0.23
NP_441623.1_1 Forward -97 -79 4.05072 0.184
NP_442151.1_6 Forward -105 -91 7.37441 0.2
NP_440561.1_1 Forward -369 -350 11.3067 0.249
NP_442182.1_3 Reverse -350 -369 4.916 0.262
NP_442182.1_3 Reverse -373 -392 1.96607 0.264
NP_441818.1_9 Forward -291 -272 -9.14533 0.287
NP_440226.1_1 Forward -384 -365 3.73603 0.215
NP_441630.1_3 Forward -49 -30 -0.688862 0.288
NP_443027.1_4 Reverse -30 -40 6.17489 0.289
NP_440110.1_8 Forward -252 -233 0.196116 0.216
NP_441476.1_5 Forward -399 -380 -7.57203 0.29
NP_440044.1_8 Forward -322 -303 -2.65548 0.265
NP_441781.1_7 Reverse -77 -96 -2.85214 0.289
NP_439918.1_2 Reverse -343 -362 4.52268 0.163
NP_441208.1_1 Reverse -354 -373 3.04771 0.212
NP_442742.1_9 Reverse -227 -246 -14.3569 0.3
NP_442375.1_6 Forward -149 -130 16.2241 0.294
NP_442726.1_7 Forward -398 -380 1.29745 0.251
NP_441083.1_5 Forward -172 -162 1.84832 0.198
NP_441645.1_8 Forward -252 -233 14.6508 0.237
NP_442136.1_1 Reverse -103 -122 6.78429 0.27
NP_441770.1_1 Reverse -234 -253 13.3716 0.277
NP_441770.1_4 Forward -110 -91 -7.76869 0.234
NP_440178.1_7 Reverse -330 -349 -13.7669 0.143
NP_442111.1_4 Reverse -31 -45 3.53951 0.24
NP_440906.1_5 Reverse -33 -40 8.79057 0.149
NP_442634.1_4 Forward -43 -29 -4.81863 0.22
NP_440403.1_10 Reverse -232 -251 1.47442 0.291
NP_441014.1_8 Forward -97 -78 -8.85033 0.288
NP_441634.1_9 Reverse -344 -363 9.04509 0.291
NP_440376.1_1 Reverse -207 -216 7.66954 0.0706
NP_440376.1_1 Reverse -32 -41 5.3096 0.137
NP_441077.1_6 Forward -127 -111 2.60905 0.276
NP_441846.1_10 Forward -283 -264 -23.5016 0.289
NP_442658.1_1 Forward -325 -315 12.0743 0.0643
NP_440353.1_2 Forward -20 -1 10.1267 0.202
NP_442782.1_2 Reverse -349 -363 4.32615 0.256
NP_442782.1_2 Forward -250 -236 3.93283 0.257
NP_442782.1_2 Forward -248 -234 3.34284 0.265
NP_442300.1_9 Forward -333 -315 21.2586 0.0322
NP_442937.1_5 Reverse -309 -328 6.39097 0.28
NP_442321.1_4 Forward -159 -140 -1.7705 0.27
NP_441958.1_5 Forward -42 -32 -0.41329 0.205
NP_441127.1_1 Forward -326 -312 11.6026 0.217
NP_439905.1_1 Reverse -315 -328 8.37742 0.234
NP_441097.1_2 Forward -281 -264 4.3654 0.28
NP_439975.1_4 Forward -29 -10 11.5042 0.172
NP_442002.1_9 Reverse -213 -220 11.3472 0.185
NP_442002.1_9 Forward -195 -188 11.1505 0.185
NP_440809.1_9 Reverse -23 -41 -7.65067 0.225
NP_440475.1_2 Forward -331 -312 20.7347 0.0593
NP_440475.1_4 Forward -372 -355 18.7217 0.156
NP_440484.1_3 Forward -252 -238 8.84938 0.281
NP_441674.1_6 Forward -291 -272 2.16274 0.291
NP_441916.1_7 Reverse -32 -42 4.79825 0.159
NP_440465.1_10 Forward -93 -74 7.7676 0.173
NP_441041.1_4 Forward -256 -237 -11.2103 0.242
NP_440569.1_10 Reverse -238 -257 2.43462 0.293
NP_441547.1_2 Reverse -332 -350 5.42735 0.223
NP_440703.1_9 Forward -174 -161 5.23026 0.293
NP_441725.1_5 Reverse -33 -43 -0.216628 0.241
NP_439966.1_7 Reverse -233 -243 5.19112 0.24
NP_440260.1_8 Reverse -80 -98 -7.35568 0.295
NP_441334.1_7 Reverse -340 -359 -15.5368 0.275
NP_440177.1_1 Forward -331 -313 4.73903 0.272
NP_440437.1_1 Reverse -235 -254 3.83436 0.115
NP_440437.1_1 Forward -225 -206 -3.63879 0.242
NP_442215.1_2 Forward -367 -351 -2.10475 0.192
NP_442215.1_2 Forward -107 -91 -2.89139 0.206
NP_442215.1_2 Reverse -138 -154 -4.66135 0.237
NP_442215.1_2 Forward -342 -326 -5.05468 0.244
NP_442215.1_2 Reverse -37 -53 -6.33298 0.268
NP_440039.1_2 Forward -122 -105 25.1665 0.00248
NP_440039.1_10 Forward -305 -286 21.5339 0.0553
NP_440421.1_1 Reverse -144 -158 15.0442 0.213
NP_441523.1_6 Forward -355 -336 10.1275 0.169
NP_443009.1_5 Forward -42 -31 5.36805 0.206
NP_442406.1_3 Reverse -105 -124 29.1901 0.000297
NP_441448.1_1 Forward -334 -315 23.1072 0.05
NP_440183.1_1 Reverse -78 -97 8.75091 0.244
NP_441198.1_8 Forward -43 -33 13.1737 0.108
NP_440379.1_5 Forward -292 -273 -4.91709 0.219
NP_441015.1_10 Forward -287 -268 -8.752 0.277
NP_441015.1_10 Forward -249 -230 -10.817 0.288
NP_441876.1_9 Reverse -231 -241 14.7292 0.267
NP_441826.1_2 Forward -47 -33 -4.4253 0.296
NP_442868.1_6 Forward -43 -33 4.20827 0.183
NP_442677.1_3 Reverse -263 -282 4.32602 0.223
NP_441612.1_2 Forward -156 -146 6.80666 0.277
NP_442559.1_3 Forward -159 -140 9.43923 0.279
NP_442808.1_1 Forward -359 -349 5.87944 0.137
NP_442808.1_1 Reverse -234 -244 5.78111 0.141
NP_440145.1_3 Forward -260 -241 -5.60541 0.273
NP_442113.1_5 Reverse -233 -252 6.78348 0.294
NP_442050.1_1 Reverse -360 -379 6.29264 0.292
NP_442050.1_5 Forward -43 -33 7.94438 0.243
NP_441114.1_3 Forward -287 -278 6.68623 0.254
NP_440923.1_1 Reverse -103 -121 10.4414 0.294
NP_441557.1_5 Forward -41 -32 -0.983583 0.272
NP_441590.1_4 Forward -362 -343 12.4867 0.237
NP_441433.1_8 Forward -22 -3 2.65439 0.212
NP_440084.1_8 Forward -134 -120 10.6112 0.266
NP_442397.1_9 Reverse -77 -96 1.96607 0.283
NP_441116.1_9 Forward -317 -303 11.6026 0.276
NP_440440.1_10 Reverse -350 -364 13.9626 0.265
NP_441549.1_9 Forward -96 -78 -10.5023 0.279
NP_440547.1_1 Reverse -230 -249 8.16011 0.27
NP_442888.1_7 Reverse -306 -325 11.9958 0.281
NP_441037.1_4 Forward -43 -33 12.3855 0.103
NP_440136.1_2 Reverse -33 -40 4.26735 0.218
NP_442998.1_5 Forward -237 -227 13.7464 0.157
NP_442998.1_5 Reverse -152 -162 10.4031 0.214
NP_440731.1_2 Reverse -34 -53 6.4893 0.293
NP_440899.1_8 Reverse -123 -142 -10.7186 0.284
NP_441435.1_5 Forward -254 -235 6.29264 0.202
NP_440256.1_1 Reverse -276 -295 -8.06369 0.251
NP_440915.1_6 Forward -45 -31 -0.787057 0.209
NP_440717.1_3 Reverse -269 -283 8.3571 0.267
NP_440306.1_8 Reverse -259 -278 -0.0996487 0.211
NP_442993.1_1 Forward -111 -95 -10.5612 0.222
NP_442386.1_9 Reverse -234 -243 10.324 0.132
NP_440570.1_5 Forward -350 -331 7.07928 0.174
NP_443028.1_4 Forward -139 -120 12.672 0.252
NP_440168.1_10 Forward -254 -235 14.3558 0.298
NP_442240.1_2 Forward -247 -228 -20.2567 0.295
NP_440211.1_4 Forward -318 -308 14.9263 0.258
NP_440027.1_3 Reverse -273 -291 11.7197 0.159
NP_439937.1_9 Forward -91 -74 -7.72996 0.165
NP_441167.1_1 Forward -124 -105 6.58763 0.237
NP_441167.1_10 Forward -253 -234 14.6508 0.277
NP_440271.1_2 Forward -120 -101 8.35759 0.23
NP_440171.1_3 Forward -287 -268 1.17943 0.294
NP_440316.1_10 Reverse -348 -358 5.68323 0.29
NP_442493.1_6 Forward -247 -229 21.947 0.0678
NP_441572.1_7 Reverse -350 -369 -5.50708 0.263
NP_441689.1_5 Reverse -30 -40 8.14104 0.151
NP_440344.1_10 Reverse -27 -44 -11.3676 0.212
NP_440075.1_2 Reverse -276 -295 4.22769 0.292
NP_440350.1_2 Reverse -45 -64 6.09597 0.253
NP_441592.1_4 Forward -223 -204 -2.36049 0.262
NP_442078.1_3 Forward -351 -332 10.1267 0.119
NP_442067.1_4 Forward -334 -315 1.96607 0.299
NP_440663.1_6 Reverse -73 -92 7.47261 0.187
NP_442277.1_7 Forward -140 -124 -0.757133 0.228
NP_442845.1_2 Forward -250 -236 7.86607 0.195
NP_442845.1_2 Reverse -26 -40 4.91614 0.249
NP_442337.1_8 Reverse -190 -209 -1.67217 0.288
NP_440220.1_4 Reverse -301 -320 7.96345 0.176
NP_441462.1_2 Forward -41 -31 -0.41329 0.225
NP_441929.1_6 Reverse -141 -160 8.35759 0.269
NP_441560.1_6 Reverse -78 -97 11.7992 0.292
NP_440516.1_2 Forward -294 -276 -0.374176 0.251
NP_442080.1_7 Reverse -41 -60 1.47442 0.215
NP_440783.1_4 Reverse -310 -329 25.4482 0.00917
NP_442859.1_4 Forward -121 -103 15.9488 0.272
NP_442120.1_10 Forward -323 -304 -15.9302 0.296
NP_440673.1_3 Forward -374 -367 8.29892 0.221
NP_440436.1_4 Reverse -315 -324 7.47246 0.129
NP_441884.1_9 Reverse -78 -97 -11.5053 0.118
NP_442864.1_2 Reverse -230 -249 10.9142 0.255
NP_441004.1_4 Reverse -346 -356 8.73149 0.267
NP_442366.1_3 Reverse -139 -157 -4.01242 0.262
NP_442206.1_7 Forward -377 -358 9.3409 0.295
NP_440328.1_4 Forward -357 -338 0.0977854 0.263
NP_441851.1_9 Forward -285 -266 7.66927 0.279
NP_441851.1_10 Forward -42 -32 6.96153 0.151
NP_441542.1_4 Reverse -149 -163 4.81781 0.264
NP_440338.1_4 Reverse -111 -130 7.4718 0.28
NP_441994.1_1 Reverse -226 -240 17.3419 0.159
NP_439960.1_10 Reverse -273 -291 -2.83245 0.258
NP_440588.1_2 Forward -367 -348 -4.91709 0.233
NP_440483.1_1 Forward -249 -230 -0.787193 0.208
NP_441078.1_4 Forward -41 -32 5.70292 0.111
NP_442729.1_8 Reverse -28 -41 6.60746 0.188
NP_441539.1_1 Forward -121 -107 14.3553 0.284
NP_440707.1_9 Forward -252 -233 -0.39387 0.299
NP_442443.1_1 Forward -252 -233 -0.39387 0.222
NP_441432.1_9 Reverse -16 -29 9.85881 0.263
NP_441333.1_1 Reverse -123 -133 12.3526 0.237
NP_441732.1_2 Reverse -285 -301 -16.7561 0.195
NP_441732.1_2 Reverse -237 -253 -17.5427 0.27
NP_440760.1_7 Forward -71 -52 5.50519 0.211
NP_441057.1_3 Reverse -243 -262 -13.8652 0.299
NP_442400.1_10 Forward -232 -219 7.70113 0.282
NP_442400.1_10 Reverse -227 -240 7.22367 0.292
NP_440386.1_3 Forward -233 -214 -4.32711 0.221
NP_441659.2_6 Forward -119 -100 18.3865 0.0857
NP_440708.1_6 Forward -379 -360 -10.9153 0.294
NP_442346.1_5 Reverse -366 -376 4.60159 0.281
NP_441923.1_8 Reverse -81 -95 15.1426 0.272
NP_441126.1_8 Forward -247 -234 6.31247 0.291
NP_440250.1_1 Forward -344 -326 12.4089 0.273
NP_440459.1_2 Forward -349 -332 12.5269 0.146
NP_441943.1_8 Reverse -86 -105 -13.6686 0.294
NP_442828.1_7 Forward -251 -232 3.53937 0.207
NP_441585.1_5 Forward -232 -213 -1.08295 0.298
NP_441895.1_2 Forward -265 -246 -8.45701 0.166
NP_441895.1_10 Forward -278 -259 -18.0934 0.281
NP_442796.1_2 Forward -356 -337 16.0355 0.199
NP_442028.1_1 Reverse -121 -134 7.60564 0.292
NP_442497.1_10 Reverse -33 -42 0.393051 0.175
NP_440821.1_4 Forward -43 -33 -0.118297 0.229
NP_441508.1_1 Forward -130 -111 12.2875 0.233
NP_442643.1_3 Forward -322 -303 -6.09707 0.261
NP_441617.1_6 Forward -162 -143 1.0811 0.213
NP_442138.1_1 Forward -378 -359 4.03023 0.24
NP_440546.1_4 Forward -399 -389 8.88251 0.166
NP_440546.1_4 Reverse -32 -42 7.52511 0.235
NP_441230.1_5 Forward -294 -275 0.687771 0.263
NP_440462.1_6 Reverse -30 -40 4.69992 0.187
NP_442479.1_9 Reverse -144 -163 -8.752 0.266
NP_442402.1_4 Reverse -311 -330 -8.85106 0.284
NP_442402.1_4 Reverse -244 -263 -10.326 0.299
NP_442402.1_10 Reverse -5 -15 11.8776 0.231
NP_440696.1_3 Reverse -79 -97 -2.3408 0.274
NP_442882.1_6 Forward -176 -159 12.9194 0.286
NP_442923.1_4 Reverse -147 -166 0.196116 0.196
NP_442039.1_7 Reverse -91 -101 11.3864 0.257
NP_442039.1_7 Reverse -149 -159 7.55152 0.275
NP_441811.1_1 Reverse -263 -282 5.60432 0.28
NP_441811.1_1 Forward -333 -314 4.32602 0.285
NP_442679.1_2 Forward -263 -244 8.55425 0.247
NP_440505.1_1 Reverse -142 -159 17.0493 0.273
NP_440914.1_1 Forward -323 -313 9.39583 0.186
NP_441011.1_8 Forward -40 -31 11.6028 0.0754
NP_440068.1_4 Reverse -27 -46 13.5691 0.194
NP_442533.1_1 Forward -254 -235 -10.9153 0.235
NP_442533.1_6 Forward -216 -207 11.2095 0.046
NP_442533.1_6 Forward -41 -32 5.80125 0.128
NP_441089.1_10 Reverse -364 -383 9.63589 0.205
NP_442322.1_4 Reverse -232 -249 -2.51845 0.234
NP_441697.1_5 Reverse -119 -138 -8.16498 0.256
NP_441028.1_6 Reverse -230 -240 8.04271 0.217
NP_441059.1_2 Forward -260 -241 5.40766 0.126
NP_441170.1_4 Forward -373 -355 2.47742 0.285
NP_441869.1_3 Reverse -328 -347 18.0924 0.178
NP_439903.1_6 Forward -153 -134 0.883656 0.256
NP_440670.1_8 Reverse -81 -90 3.44131 0.267
NP_442614.1_2 Reverse -356 -370 6.98109 0.276
NP_442382.1_9 Reverse -303 -322 8.84842 0.281
NP_441399.1_10 Forward -105 -86 14.2574 0.219
NP_442072.1_9 Reverse -31 -49 -22.302 0.229
NP_442295.1_6 Forward -290 -271 20.2556 0.12
NP_441808.1_8 Forward -250 -231 7.96426 0.273
NP_440907.2_8 Reverse -33 -43 6.76441 0.15
NP_441463.1_3 Reverse -304 -323 -1.08219 0.135
NP_441463.1_3 Forward -227 -208 -8.06369 0.264
NP_441463.1_6 Reverse -30 -44 6.99573 0.265
NP_441431.1_3 Reverse -349 -368 7.27595 0.242
NP_440114.1_10 Forward -223 -209 7.17775 0.243
NP_440293.1_10 Reverse -343 -362 -2.36049 0.273
NP_442835.1_1 Reverse -295 -314 14.1591 0.146
NP_441531.1_9 Forward -379 -360 18.3873 0.277
NP_442930.1_1 Reverse -118 -128 12.4676 0.239
NP_440142.1_3 Forward -240 -221 12.3892 0.276
NP_441332.1_6 Forward -359 -349 13.9702 0.172
NP_442582.1_3 Reverse -111 -125 15.8633 0.155
NP_442439.1_8 Forward -324 -305 6.88262 0.299
NP_442514.1_5 Reverse -81 -100 5.50519 0.138
NP_440185.1_9 Forward -100 -83 17.5418 0.189
NP_440554.1_4 Reverse -236 -246 2.14332 0.276
NP_441885.1_5 Forward -41 -31 6.56821 0.0591
NP_441885.1_5 Reverse -34 -44 -1.78992 0.284
NP_440628.1_2 Forward -271 -252 11.3075 0.259
NP_441756.1_5 Reverse -272 -291 -3.44213 0.29
NP_441173.1_9 Forward -159 -151 13.2937 0.17
NP_442534.1_6 Forward -238 -221 19.9017 0.249
NP_440552.1_8 Reverse -106 -123 18.3866 0.0428
NP_440275.1_3 Reverse -373 -383 3.91327 0.207
NP_442275.1_1 Reverse -314 -333 5.01433 0.269
NP_441122.1_1 Reverse -310 -325 4.40479 0.28
NP_439962.1_4 Reverse -271 -290 -4.91709 0.272
NP_441105.1_3 Forward -255 -236 -5.01543 0.211
NP_442373.1_2 Forward -256 -237 2.75272 0.162
NP_440216.1_9 Forward -345 -336 12.7828 0.223
NP_440216.1_9 Reverse -91 -100 11.9961 0.252
NP_440216.1_9 Forward -198 -189 8.25953 0.286
NP_440216.1_9 Forward -321 -312 7.17789 0.286
NP_441226.1_7 Reverse -236 -243 8.29857 0.205
NP_441226.1_7 Forward -215 -208 5.64364 0.286
NP_441485.1_4 Reverse -332 -351 16.0274 0.18
NP_440244.1_1 Forward -94 -75 -9.83364 0.294
NP_441766.1_9 Reverse -274 -293 -1.7705 0.272
NP_440416.1_9 Reverse -272 -291 -11.8003 0.154
NP_440416.1_9 Reverse -271 -290 -17.8968 0.248
NP_443052.1_9 Reverse -272 -291 2.26107 0.174
NP_443052.1_9 Reverse -234 -253 1.27776 0.186
NP_440261.1_5 Reverse -33 -46 -10.4038 0.201
NP_440261.1_5 Forward -364 -351 -12.3704 0.284
NP_440261.1_7 Reverse -145 -164 -2.75381 0.19
NP_440988.1_2 Reverse -264 -282 7.4923 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCCGCTGGGTTTACTTCCGACCGTATCATTGCTTTGCGCCCCCCCGTAGCCGAACCATTGGAAAAAGCCCTGTGGCAACAATGGCAAATTCAAGGGGTGGTAACTAAAGCCTCCGGTGCCCAGGGGGGAGAATTGGTTAAGCAAAAAGTGGCGGAAGCGTTGGGGGTAAATCTGATCAGAATTGCCCGTCCCCAGACTATTCCAGGGCAAATAACTGACGATTTAAGCCAGATCAACCAATTTTGCCAAAGACATTTGCCAAGCTAAAAACGAAAATTTGTTAAGTATTGCAACGGTGGTTTCCCAGGGGCAGAGCGTCCCCGTAAGATGAGATTTTTAAAGACCCCCATTAGCGTGGGGCTATCCCTTTAAAAACCGTCTTTATTCTGGAGAATCTCA

CDS

ATGCATAGCTTTTTGTTGGCCACCGCCGTTCCCGCCACCCTGTCCTGGAGCCCTAAAGTTGCTGGGGTGATGATTGCTTGCAACATTTTGGCGATCGCCTTTGGTAAATTGACCATCAAACAACAAAATGTGGGCACCCCCATGCCTTCCTCTAACTTCTTTGGCGGCTTTGGTTTAGGGGCTGTGCTGGGCACCGCTAGCTTTGGCCACATCCTCGGCGCTGGAGTAATTCTGGGGCTAGCCAATATGGGAGTACTTTAA

Protein

MHSFLLATAVPATLSWSPKVAGVMIACNILAIAFGKLTIKQQNVGTPMPSSNFFGGFGLGAVLGTASFGHILGAGVILGLANMGVL