Your browser is old and dusty. Try Google Chrome!

Details for ssr0349

ORF ssr0349
Accession NP_442145.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -303 -317 10.7177 0.267
NP_441453.1_4 Reverse -199 -207 6.80426 0.121
NP_442151.1_6 Forward -208 -194 8.16106 0.182
NP_442169.1_1 Forward -185 -166 -0.295539 0.261
NP_441098.1_3 Forward -81 -62 -5.35341 0.28
NP_441816.1_6 Reverse -43 -55 14.887 0.256
NP_443002.1_5 Forward -396 -378 8.6715 0.297
NP_442173.1_1 Forward -207 -199 5.72262 0.203
NP_442173.1_1 Reverse -200 -208 4.54265 0.27
NP_442752.1_4 Reverse -199 -206 13.8055 0.0199
NP_443027.1_4 Reverse -197 -207 12.3697 0.079
NP_440784.1_7 Reverse -200 -207 6.23397 0.241
NP_440784.1_7 Forward -207 -200 6.13563 0.241
NP_442062.1_8 Reverse -199 -209 14.533 0.0128
NP_440304.1_4 Reverse -197 -207 10.2065 0.051
NP_440304.1_4 Reverse -313 -323 4.20827 0.272
NP_442242.1_4 Forward -207 -200 10.8555 0.127
NP_442048.1_9 Forward -350 -331 8.45592 0.297
NP_441594.1_6 Reverse -312 -331 2.65439 0.247
NP_442742.1_10 Reverse -351 -370 23.9913 0.0185
NP_441083.1_5 Reverse -199 -209 0.0783647 0.245
NP_441434.1_3 Reverse -156 -175 -1.57384 0.251
NP_441738.1_2 Forward -206 -199 15.28 0.0102
NP_440209.1_1 Reverse -199 -207 8.57422 0.0425
NP_440209.1_1 Forward -208 -200 5.23096 0.145
NP_442889.1_8 Reverse -196 -210 8.25877 0.126
NP_441713.1_1 Forward -214 -195 -13.6686 0.257
NP_440178.1_7 Forward -209 -190 -22.8133 0.279
NP_439953.1_2 Reverse -308 -326 7.88563 0.266
NP_440331.1_4 Forward -260 -241 -7.37537 0.275
NP_442111.1_4 Reverse -198 -212 12.3893 0.0437
NP_441624.1_7 Reverse -168 -182 8.16106 0.24
NP_440481.1_6 Forward -261 -243 12.5072 0.293
NP_440906.1_5 Reverse -200 -207 6.23397 0.234
NP_440906.1_5 Forward -207 -200 6.13563 0.241
NP_440747.1_10 Forward -211 -199 -4.38592 0.0974
NP_441486.1_1 Reverse -196 -210 -2.85201 0.175
NP_442145.1_3 Forward -84 -65 18.1907 0.0406
NP_442145.1_4 Forward -20 -1 23.2519 0.0122
NP_440944.1_2 Forward -259 -240 -0.4922 0.259
NP_441265.1_3 Forward -214 -200 15.4376 0.059
NP_441014.1_8 Forward -318 -299 0.294447 0.218
NP_441014.1_10 Forward -63 -44 2.75194 0.216
NP_442848.1_5 Reverse -257 -275 10.7372 0.232
NP_443018.1_3 Reverse -200 -207 12.6255 0.0471
NP_443018.1_3 Forward -207 -200 5.25066 0.214
NP_441634.1_8 Reverse -282 -296 -4.7203 0.295
NP_440376.1_1 Reverse -199 -208 0.0980582 0.285
NP_440376.1_1 Forward -208 -199 -0.196935 0.285
NP_441588.1_4 Forward -206 -196 6.66654 0.185
NP_442191.1_4 Reverse -111 -125 12.3505 0.215
NP_442485.1_3 Forward -188 -169 1.0811 0.233
NP_441950.1_7 Reverse -303 -322 -9.53865 0.297
NP_441763.1_10 Reverse -188 -207 10.52 0.153
NP_442658.1_1 Forward -184 -174 9.616 0.147
NP_442658.1_1 Reverse -313 -323 5.38779 0.269
NP_442496.1_5 Reverse -381 -399 7.88563 0.256
NP_441958.1_5 Reverse -198 -208 2.63497 0.0388
NP_441958.1_5 Forward -209 -199 0.865012 0.12
NP_440203.1_5 Forward -59 -49 12.2709 0.16
NP_440203.1_5 Forward -321 -311 10.0093 0.242
NP_443001.1_7 Reverse -376 -395 3.24438 0.279
NP_439990.1_5 Reverse -194 -207 13.294 0.1
NP_442376.1_2 Forward -213 -194 -13.4719 0.296
NP_442690.1_1 Reverse -73 -92 -14.0619 0.268
NP_442690.1_1 Reverse -13 -32 -16.4218 0.289
NP_442911.1_2 Forward -218 -199 -0.197208 0.0727
NP_440153.1_8 Reverse -173 -186 -3.71729 0.299
NP_442064.1_1 Forward -213 -194 -12.5869 0.277
NP_442236.1_7 Reverse -296 -315 7.66927 0.3
NP_441099.1_5 Reverse -247 -266 -10.3253 0.25
NP_441646.1_1 Reverse -308 -327 -0.197208 0.259
NP_441550.1_8 Forward -210 -200 5.19112 0.26
NP_441916.1_7 Forward -208 -198 7.45319 0.0656
NP_441916.1_10 Reverse -313 -332 4.71934 0.223
NP_441041.1_4 Forward -208 -189 -1.47551 0.1
NP_441041.1_4 Reverse -303 -322 -7.4737 0.188
NP_441041.1_7 Forward -211 -199 6.44582 0.21
NP_441725.1_5 Forward -323 -313 4.89658 0.115
NP_441725.1_5 Forward -207 -197 1.35667 0.137
NP_441725.1_5 Reverse -200 -210 0.766681 0.149
NP_439966.1_7 Reverse -197 -207 5.09279 0.243
NP_442941.1_3 Forward -207 -197 10.1081 0.024
NP_440289.1_2 Reverse -196 -209 -2.73398 0.262
NP_440260.1_8 Forward -71 -53 4.05072 0.157
NP_441514.1_4 Reverse -362 -381 13.3767 0.269
NP_442281.1_1 Reverse -194 -208 2.65393 0.26
NP_442281.1_1 Forward -244 -230 2.06395 0.278
NP_442575.1_8 Reverse -303 -322 -4.91709 0.266
NP_442012.1_2 Reverse -197 -216 4.71934 0.216
NP_441644.1_6 Reverse -199 -209 3.61784 0.272
NP_443049.1_6 Reverse -198 -208 11.7385 0.24
NP_442215.1_2 Forward -64 -48 -0.138127 0.162
NP_440929.1_8 Forward -208 -199 7.76787 0.0533
NP_440929.1_8 Reverse -199 -208 7.66954 0.0624
NP_442933.1_10 Forward -208 -199 6.48957 0.119
NP_441751.2_8 Forward -207 -193 1.86788 0.0935
NP_442554.1_8 Forward -207 -197 7.15819 0.0975
NP_442292.1_1 Forward -207 -198 7.66954 0.0634
NP_442292.1_1 Reverse -200 -209 -0.786921 0.287
NP_443009.1_5 Reverse -198 -209 6.25303 0.169
NP_441715.1_4 Forward -207 -197 4.40493 0.281
NP_440881.1_3 Forward -396 -377 13.3716 0.281
NP_441448.1_1 Reverse -35 -54 4.32602 0.279
NP_442076.1_7 Reverse -132 -151 12.5858 0.101
NP_440183.1_9 Reverse -39 -58 -21.0434 0.296
NP_441468.1_1 Reverse -200 -207 6.13563 0.209
NP_441468.1_1 Forward -207 -200 6.0373 0.223
NP_441673.1_1 Reverse -199 -208 1.37636 0.114
NP_441673.1_1 Forward -208 -199 1.1797 0.163
NP_442253.1_5 Reverse -311 -328 -0.452814 0.225
NP_441826.1_5 Forward -188 -169 6.88262 0.222
NP_442719.1_2 Reverse -87 -105 -5.29143 0.218
NP_442677.1_3 Reverse -36 -55 -4.72043 0.287
NP_442227.1_2 Reverse -240 -259 3.04771 0.219
NP_442227.1_2 Forward -322 -303 -3.93378 0.3
NP_442361.1_3 Reverse -193 -206 10.639 0.272
NP_441911.1_7 Forward -299 -280 -18.9791 0.261
NP_442808.1_1 Forward -158 -148 2.73286 0.256
NP_442050.1_5 Reverse -197 -207 8.3377 0.234
NP_442342.1_9 Forward -210 -194 7.2367 0.209
NP_442342.1_9 Forward -268 -252 2.61514 0.285
NP_441114.1_3 Forward -238 -229 13.2744 0.231
NP_441114.1_3 Reverse -97 -106 8.65285 0.231
NP_441114.1_3 Forward -322 -313 7.57121 0.231
NP_440558.1_2 Forward -327 -308 6.29264 0.136
NP_440558.1_2 Reverse -43 -62 3.14605 0.161
NP_440558.1_2 Reverse -92 -111 -5.50708 0.26
NP_440923.1_1 Forward -20 -2 12.1131 0.242
NP_441878.1_6 Forward -209 -199 0.57002 0.14
NP_441878.1_6 Reverse -314 -324 -7.49312 0.231
NP_442721.1_3 Forward -319 -300 17.404 0.16
NP_441557.1_5 Forward -208 -199 7.57121 0.049
NP_441557.1_5 Reverse -199 -208 1.08137 0.0794
NP_441590.1_4 Forward -316 -297 5.11187 0.279
NP_441458.1_10 Reverse -44 -63 4.03102 0.236
NP_442469.1_8 Forward -350 -336 16.0275 0.23
NP_441407.1_6 Reverse -108 -127 2.65439 0.285
NP_441116.1_9 Forward -79 -65 11.8976 0.268
NP_442347.1_2 Forward -61 -52 4.71961 0.266
NP_442347.1_2 Forward -207 -198 3.14632 0.286
NP_442888.1_9 Reverse -303 -322 15.2408 0.197
NP_441037.1_4 Reverse -313 -323 6.92787 0.237
NP_441037.1_4 Forward -210 -200 6.53804 0.255
NP_440136.1_2 Reverse -200 -207 6.23397 0.171
NP_440136.1_2 Forward -207 -200 6.13563 0.193
NP_442998.1_5 Forward -120 -110 9.12481 0.252
NP_442998.1_10 Forward -206 -199 15.5754 0.0102
NP_440299.1_1 Forward -212 -199 4.24695 0.213
NP_440709.1_1 Forward -21 -2 15.7316 0.0302
NP_440709.1_2 Forward -16 -2 21.8284 0.0075
NP_441559.1_8 Reverse -335 -349 -6.19526 0.275
NP_441559.1_8 Forward -134 -120 -7.08024 0.283
NP_441270.1_5 Forward -368 -349 11.2376 0.294
NP_441704.1_8 Reverse -42 -61 8.16011 0.211
NP_440749.1_6 Reverse -330 -349 7.07928 0.286
NP_440748.1_5 Forward -228 -209 2.94938 0.213
NP_440748.1_5 Reverse -218 -237 1.67108 0.228
NP_442386.1_9 Forward -57 -48 6.9808 0.219
NP_441404.1_7 Reverse -360 -379 9.93088 0.198
NP_441340.1_5 Reverse -200 -207 6.23397 0.132
NP_441340.1_5 Forward -207 -200 5.84064 0.208
NP_441340.1_9 Forward -285 -275 13.3648 0.204
NP_440586.1_8 Reverse -200 -207 14.69 0.026
NP_442251.1_6 Forward -207 -200 12.0355 0.0627
NP_440192.1_5 Forward -365 -346 3.93269 0.268
NP_442959.1_5 Forward -78 -59 5.30933 0.287
NP_441262.1_3 Reverse -199 -206 14.7888 0.0223
NP_443051.1_1 Reverse -198 -207 10.0295 0.0139
NP_443051.1_1 Forward -209 -200 6.19458 0.0849
NP_439937.1_9 Reverse -338 -355 -13.4331 0.286
NP_439937.1_9 Reverse -198 -215 -15.3014 0.287
NP_440408.1_6 Forward -187 -169 20.767 0.14
NP_440408.1_7 Forward -183 -164 6.88262 0.298
NP_439943.1_7 Reverse -27 -46 2.55606 0.292
NP_440372.1_2 Reverse -200 -207 6.82395 0.0854
NP_440372.1_2 Forward -207 -200 6.52896 0.188
NP_442783.1_7 Forward -74 -55 19.2723 0.13
NP_439977.1_8 Reverse -74 -93 19.5258 0.176
NP_441572.1_7 Reverse -193 -212 -5.11376 0.25
NP_441155.1_3 Reverse -152 -166 20.9441 0.117
NP_441877.1_5 Reverse -107 -126 6.4893 0.195
NP_441018.1_10 Reverse -169 -188 14.8466 0.236
NP_442262.1_10 Reverse -200 -207 12.9205 0.0422
NP_441689.1_5 Reverse -197 -207 8.3377 0.132
NP_441965.1_10 Forward -142 -126 10.1866 0.107
NP_442529.1_6 Forward -272 -253 18.1907 0.232
NP_440297.1_9 Forward -109 -99 0.471689 0.282
NP_440297.1_9 Reverse -200 -210 0.176696 0.282
NP_440297.1_9 Reverse -48 -58 0.0783647 0.282
NP_440297.1_9 Forward -207 -197 -0.609952 0.292
NP_440298.1_10 Forward -346 -328 4.14905 0.209
NP_440888.1_2 Reverse -177 -191 6.78381 0.22
NP_440888.1_2 Forward -397 -383 6.29216 0.241
NP_440179.1_6 Forward -323 -304 6.88262 0.209
NP_440575.1_8 Reverse -158 -177 -5.11376 0.27
NP_441543.1_2 Forward -207 -198 6.09625 0.153
NP_440257.1_6 Forward -133 -114 14.3549 0.274
NP_442578.1_7 Reverse -200 -207 14.6904 0.026
NP_440220.1_4 Reverse -209 -228 -2.65624 0.279
NP_441462.1_2 Reverse -199 -209 1.94665 0.0807
NP_441462.1_2 Forward -208 -198 0.57002 0.144
NP_443062.1_1 Forward -208 -190 17.0291 0.027
NP_442204.1_1 Reverse -195 -206 9.89177 0.0736
NP_441560.1_8 Reverse -256 -275 13.6552 0.205
NP_442780.1_1 Reverse -4 -23 12.0942 0.169
NP_440516.1_8 Reverse -199 -208 1.08137 0.129
NP_442428.1_5 Reverse -200 -207 6.13563 0.209
NP_442428.1_5 Forward -207 -200 6.0373 0.212
NP_440673.1_3 Forward -206 -199 12.4288 0.0426
NP_440673.1_3 Forward -322 -315 8.98723 0.203
NP_440673.1_3 Forward -60 -53 7.51227 0.252
NP_440436.1_4 Forward -323 -314 6.48915 0.157
NP_441884.1_9 Forward -270 -251 -28.5165 0.296
NP_441321.1_5 Forward -119 -100 6.29264 0.265
NP_442864.1_2 Forward -61 -42 12.1925 0.246
NP_441719.1_4 Reverse -200 -207 13.5105 0.026
NP_441719.1_4 Forward -207 -200 6.52896 0.188
NP_441004.1_2 Reverse -304 -323 6.98095 0.175
NP_441004.1_4 Reverse -312 -322 10.2065 0.254
NP_441004.1_5 Reverse -144 -158 10.0294 0.248
NP_442366.1_3 Forward -209 -191 14.7688 0.0216
NP_442694.1_4 Forward -68 -59 12.2911 0.253
NP_441851.1_10 Forward -209 -199 6.07655 0.187
NP_441851.1_10 Reverse -198 -208 4.40493 0.271
NP_442208.1_5 Forward -352 -333 -4.6221 0.258
NP_442622.1_1 Forward -120 -101 -11.8986 0.257
NP_442622.1_3 Reverse -310 -329 2.16274 0.215
NP_441668.1_4 Forward -118 -99 -2.65548 0.293
NP_440593.1_3 Forward -322 -303 -5.80207 0.266
NP_440593.1_3 Forward -329 -310 -7.27704 0.291
NP_441982.1_6 Reverse -153 -162 11.6259 0.288
NP_441349.1_10 Forward -218 -199 -8.35868 0.274
NP_441409.1_6 Forward -214 -195 -13.6686 0.241
NP_442843.1_1 Reverse -102 -121 -2.45882 0.203
NP_440396.1_1 Reverse -299 -318 -5.21209 0.272
NP_442450.1_3 Forward -93 -75 16.4396 0.107
NP_442450.1_5 Forward -210 -200 6.66654 0.16
NP_442450.1_5 Reverse -197 -207 6.17489 0.197
NP_441570.1_1 Forward -62 -44 -13.1572 0.221
NP_440078.1_4 Reverse -292 -311 10.6192 0.25
NP_441078.1_4 Reverse -199 -208 0.196389 0.205
NP_441078.1_4 Forward -208 -199 -0.000272808 0.205
NP_440539.1_9 Forward -54 -35 1.27776 0.278
NP_440526.1_3 Forward -323 -312 5.76138 0.233
NP_440526.1_3 Reverse -316 -327 5.26972 0.252
NP_441432.1_8 Reverse -198 -207 7.27622 0.101
NP_441432.1_8 Reverse -52 -61 5.21127 0.185
NP_440199.1_10 Reverse -196 -206 14.238 0.0861
NP_442489.1_7 Forward -208 -199 7.47288 0.0613
NP_442489.1_7 Reverse -199 -208 0.688044 0.152
NP_440565.1_7 Reverse -298 -317 8.06259 0.246
NP_440559.1_1 Reverse -200 -209 13.3727 0.0401
NP_441659.2_8 Reverse -199 -209 6.46988 0.0744
NP_441659.2_8 Forward -208 -198 1.74999 0.227
NP_441800.1_3 Reverse -48 -66 3.16574 0.298
NP_442346.1_5 Reverse -314 -324 11.7798 0.0567
NP_442346.1_5 Reverse -198 -208 5.87989 0.225
NP_440545.1_3 Forward -212 -195 2.10379 0.106
NP_441126.1_6 Reverse -151 -165 14.6104 0.267
NP_440010.1_10 Forward -243 -224 1.37609 0.3
NP_441943.1_5 Reverse -148 -167 16.466 0.203
NP_442551.1_4 Forward -400 -385 -1.88839 0.25
NP_442311.1_5 Forward -58 -39 2.45773 0.251
NP_442603.1_9 Reverse -167 -185 -0.472507 0.3
NP_440449.1_6 Forward -358 -340 7.18594 0.229
NP_441948.1_9 Forward -259 -241 20.9636 0.14
NP_441833.1_4 Forward -207 -200 6.52896 0.0924
NP_441833.1_4 Reverse -200 -207 6.23397 0.163
NP_442162.1_9 Reverse -200 -207 6.62729 0.142
NP_442162.1_9 Forward -207 -200 6.52896 0.178
NP_441973.1_1 Reverse -114 -129 -0.413427 0.283
NP_440204.1_4 Reverse -371 -390 1.96607 0.238
NP_442140.1_3 Reverse -200 -210 5.28991 0.216
NP_442723.1_1 Reverse -240 -259 2.45694 0.289
NP_440875.1_9 Forward -206 -196 7.59334 0.255
NP_441813.1_5 Reverse -197 -207 6.17489 0.1
NP_441259.1_8 Forward -271 -252 12.9783 0.254
NP_440590.1_4 Forward -207 -194 -3.61896 0.255
NP_440567.1_1 Forward -207 -193 1.47456 0.204
NP_442497.1_10 Reverse -200 -209 8.25953 0.047
NP_442497.1_10 Forward -207 -198 7.76787 0.0731
NP_440821.1_4 Reverse -197 -207 1.35667 0.137
NP_440821.1_4 Forward -210 -200 0.57002 0.169
NP_441892.1_1 Reverse -44 -61 -3.00942 0.231
NP_441892.1_1 Reverse -190 -207 -3.8944 0.251
NP_441017.1_6 Reverse -195 -209 17.6002 0.048
NP_443035.1_1 Forward -217 -198 17.7974 0.286
NP_440212.1_5 Forward -213 -194 14.1591 0.253
NP_441782.1_10 Reverse -166 -180 14.9792 0.271
NP_442041.1_10 Reverse -300 -319 9.43923 0.252
NP_440462.1_6 Reverse -197 -207 13.648 0.0266
NP_442479.1_9 Reverse -108 -127 -9.34199 0.266
NP_442479.1_9 Reverse -328 -347 -10.522 0.27
NP_442402.1_10 Forward -163 -153 12.6642 0.204
NP_440696.1_3 Forward -212 -194 10.7372 0.144
NP_440696.1_6 Reverse -187 -206 3.24438 0.288
NP_440506.1_6 Forward -340 -321 16.8141 0.116
NP_440843.1_3 Reverse -151 -170 8.55425 0.29
NP_442023.1_2 Forward -291 -272 6.88262 0.275
NP_442039.1_7 Reverse -49 -59 6.76487 0.299
NP_442679.1_1 Reverse -359 -378 -5.80207 0.298
NP_440008.1_8 Reverse -39 -58 21.3373 0.158
NP_440825.1_6 Forward -24 -5 17.5024 0.185
NP_440825.1_6 Reverse -365 -384 9.24257 0.285
NP_440825.1_7 Forward -61 -51 12.3241 0.168
NP_442837.1_3 Forward -207 -200 12.1338 0.0702
NP_442837.1_3 Reverse -200 -207 6.0373 0.25
NP_442053.1_1 Forward -208 -199 6.78456 0.115
NP_440505.1_3 Reverse -197 -207 6.27322 0.187
NP_441203.1_1 Forward -207 -188 -14.9469 0.208
NP_441408.2_7 Forward -127 -108 -4.72043 0.286
NP_441699.1_2 Forward -294 -275 7.47261 0.279
NP_441011.1_8 Forward -207 -198 6.78456 0.184
NP_442533.1_1 Reverse -298 -317 -16.0285 0.262
NP_442533.1_6 Reverse -43 -52 2.26134 0.266
NP_442541.1_10 Forward -324 -310 7.57046 0.228
NP_442232.1_3 Reverse -307 -326 -10.227 0.266
NP_441482.1_7 Reverse -193 -207 -10.9151 0.222
NP_439944.1_9 Forward -207 -197 7.84651 0.127
NP_441028.1_6 Reverse -178 -188 6.0761 0.232
NP_441028.1_6 Forward -394 -384 3.51951 0.292
NP_440115.1_6 Reverse -312 -322 7.45319 0.147
NP_440007.1_9 Reverse -195 -209 3.8345 0.267
NP_441106.1_1 Reverse -198 -207 8.75118 0.0469
NP_440429.1_2 Forward -272 -253 7.7676 0.28
NP_441286.1_1 Forward -209 -197 -6.15587 0.251
NP_441286.1_1 Forward -325 -313 -6.45087 0.265
NP_442674.1_2 Forward -81 -62 7.17762 0.285
NP_442674.1_3 Reverse -45 -64 4.03023 0.294
NP_440670.1_8 Reverse -199 -208 7.47288 0.0773
NP_440670.1_8 Forward -208 -199 5.89959 0.131
NP_441930.1_3 Reverse -56 -75 6.9054 0.263
NP_440886.1_7 Forward -313 -303 5.28945 0.188
NP_442614.1_2 Reverse -199 -213 10.0294 0.235
NP_442072.1_9 Forward -209 -191 -22.7936 0.259
NP_440513.1_2 Forward -351 -332 15.9291 0.295
NP_440907.2_8 Reverse -200 -210 11.091 0.0969
NP_441463.1_3 Forward -229 -210 -5.99873 0.238
NP_441626.1_2 Reverse -200 -207 6.13563 0.177
NP_441626.1_2 Forward -207 -200 5.93897 0.231
NP_442615.1_1 Forward -217 -199 -4.01242 0.174
NP_442467.1_8 Reverse -342 -361 16.6174 0.289
NP_441962.1_4 Reverse -310 -329 -9.44032 0.218
NP_441836.1_2 Reverse -90 -109 -4.81876 0.264
NP_440358.1_8 Reverse -152 -171 1.67108 0.246
NP_440358.1_8 Forward -172 -153 -0.4922 0.271
NP_440293.1_3 Reverse -307 -326 -6.58872 0.291
NP_440766.1_4 Reverse -195 -209 0.294584 0.291
NP_440766.1_5 Forward -173 -161 7.75128 0.288
NP_441237.1_9 Reverse -200 -210 14.6313 0.0285
NP_441237.1_9 Forward -323 -313 9.81313 0.265
NP_442246.1_6 Forward -83 -64 3.04771 0.291
NP_440457.1_1 Reverse -195 -207 6.82381 0.11
NP_440457.1_1 Reverse -311 -323 -0.354346 0.262
NP_440457.1_1 Forward -212 -200 -0.74767 0.273
NP_440213.1_4 Forward -343 -324 14.9613 0.258
NP_440213.1_5 Forward -375 -356 10.6192 0.247
NP_440798.1_6 Reverse -200 -213 2.08423 0.186
NP_442509.1_9 Forward -266 -256 7.35439 0.225
NP_441871.1_6 Reverse -145 -164 11.3075 0.18
NP_442514.1_5 Forward -320 -301 -7.57277 0.276
NP_440554.1_4 Forward -207 -197 6.46988 0.123
NP_442862.1_3 Forward -345 -328 6.72535 0.263
NP_441845.1_6 Reverse -187 -205 1.00246 0.274
NP_443000.1_7 Reverse -197 -207 7.74818 0.0666
NP_440091.1_1 Reverse -206 -218 0.23564 0.259
NP_443010.1_10 Reverse -336 -353 2.28762 0.277
NP_439962.1_4 Forward -269 -250 -4.03212 0.265
NP_441105.1_3 Forward -230 -211 -6.68705 0.239
NP_440216.1_1 Reverse -199 -213 -12.3901 0.264
NP_442015.1_10 Reverse -253 -266 5.82081 0.132
NP_442015.1_10 Forward -212 -199 3.65753 0.178
NP_441111.1_7 Forward -207 -199 8.86921 0.0589
NP_441766.1_2 Forward -208 -199 6.48957 0.096
NP_440416.1_9 Forward -203 -184 -19.1751 0.27
NP_443052.1_9 Forward -322 -303 -3.73712 0.251
NP_443052.1_9 Reverse -247 -266 -6.39206 0.282
NP_442564.1_9 Reverse -315 -329 14.0253 0.256
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGCCCCTGTCCCACAGTCAAATTCCCAATTCTCTTTGTCCTTGTGTTGAGGTGGAATCCTGGCCGAATTTGGAGTTACCATTGCCCCGCCTACCGGCCAATCAAGTTTGCACCCTAAGAAAAGTTCAGGAGCGGCTGATCCGACAGGAGGAGGGAGACTGACCAATGTTCACATGGACAATGTGTTTGCTGTTCGATCGCCTTTGAGTAGACTGGGGGACACTGGCTGGGCTAGAAATTTTCCAGCATCGACAAAAGTGAATGGATGCCCGAGAATCACAGGCAAAATCTGCCTGGGCACTGCTTCAAAACCGTAGAAAAGGTTAAATTACCGGATTTTTGATTGCCAAGGCTGGCCAATAGATTAGAATGTAACGGAAAGGTTTACATTTTGTTACAT

CDS

ATGTTGGTGCCCATTCTCATTTTTGATGTGGCTTTGGTGGCCTGGTCCCTCCACCTTATGCAACAGGCGATCGAAGAGCAGGAATTTTCTTTGATGCTGGCCGGAACTCTCGTAGCAGCAGCGGCGGCCGCCACATTGGTGGTTTATTTTCTCATGGGCCATTGTTTATCTCAATTGAGCCAGACTCTTTGA

Protein

MLVPILIFDVALVAWSLHLMQQAIEEQEFSLMLAGTLVAAAAAATLVVYFLMGHCLSQLSQTL