Your browser is old and dusty. Try Google Chrome!

Details for ssl3769

ORF ssl3769
Accession NP_441305.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -167 -148 23.5383 0.0345
NP_441418.1_6 Forward -362 -343 -12.8819 0.0712
NP_441418.1_6 Reverse -54 -73 -18.0934 0.0826
NP_441453.1_4 Reverse -337 -345 14.7691 0.0119
NP_441453.1_4 Reverse -54 -62 6.80426 0.121
NP_441453.1_4 Forward -346 -338 6.80426 0.121
NP_441453.1_4 Forward -63 -55 6.11594 0.121
NP_441623.1_1 Forward -90 -72 -2.14413 0.241
NP_442151.1_6 Reverse -54 -68 10.1277 0.13
NP_442151.1_6 Reverse -337 -351 9.04604 0.159
NP_442182.1_3 Forward -296 -277 1.96607 0.264
NP_441818.1_9 Reverse -54 -73 -10.227 0.292
NP_440226.1_1 Forward -63 -44 11.4058 0.0542
NP_440226.1_1 Reverse -337 -356 3.6377 0.218
NP_440226.1_1 Forward -346 -327 3.04771 0.241
NP_440259.1_4 Forward -244 -230 18.8549 0.0912
NP_442173.1_1 Forward -345 -337 12.0158 0.0316
NP_442173.1_1 Forward -62 -54 12.0158 0.0316
NP_442173.1_1 Reverse -338 -346 12.0158 0.0316
NP_442173.1_1 Reverse -55 -63 10.7375 0.0611
NP_442752.1_4 Forward -346 -339 13.8055 0.0199
NP_442752.1_4 Reverse -54 -61 13.8055 0.0199
NP_443027.1_4 Forward -65 -55 7.35486 0.24
NP_442975.1_10 Forward -350 -336 8.65209 0.0902
NP_442975.1_10 Forward -398 -384 2.26061 0.28
NP_440784.1_7 Forward -345 -338 6.23397 0.241
NP_440784.1_7 Reverse -55 -62 6.23397 0.241
NP_440784.1_7 Reverse -338 -345 6.13563 0.241
NP_440784.1_7 Forward -62 -55 6.13563 0.241
NP_440110.1_8 Forward -101 -82 1.0811 0.211
NP_442062.1_8 Forward -189 -179 7.74818 0.0897
NP_440761.1_4 Reverse -332 -351 -13.6686 0.257
NP_439918.1_2 Reverse -55 -74 -2.75381 0.249
NP_441619.1_8 Reverse -48 -62 10.422 0.185
NP_441208.1_9 Forward -265 -251 5.70279 0.262
NP_441594.1_6 Reverse -215 -234 2.3594 0.252
NP_440370.1_10 Forward -72 -53 9.14423 0.232
NP_442110.1_7 Reverse -54 -68 18.9775 0.0138
NP_441083.1_5 Reverse -337 -347 10.0098 0.0214
NP_441083.1_5 Forward -346 -336 8.73149 0.0307
NP_441083.1_5 Forward -63 -53 0.668351 0.22
NP_441083.1_5 Reverse -54 -64 -1.00328 0.289
NP_442827.1_8 Forward -354 -335 2.6536 0.156
NP_441434.1_7 Reverse -355 -369 3.53951 0.236
NP_441738.1_2 Reverse -339 -346 15.28 0.0102
NP_441738.1_2 Forward -61 -54 15.28 0.0102
NP_441738.1_2 Reverse -182 -189 6.52862 0.261
NP_441558.1_5 Forward -348 -329 10.8159 0.0912
NP_440209.1_1 Forward -346 -338 8.57422 0.0425
NP_440209.1_1 Reverse -54 -62 8.57422 0.0425
NP_440209.1_1 Reverse -337 -345 8.47588 0.0457
NP_442889.1_8 Reverse -334 -348 4.22722 0.27
NP_442889.1_10 Reverse -233 -252 20.1198 0.0964
NP_440178.1_7 Reverse -89 -108 -21.24 0.215
NP_441716.1_1 Forward -199 -185 3.24451 0.272
NP_442111.1_4 Reverse -336 -350 15.6342 0.0204
NP_442111.1_4 Forward -64 -50 13.5693 0.0383
NP_442111.1_4 Reverse -53 -67 6.3911 0.127
NP_442111.1_4 Forward -347 -333 5.70279 0.154
NP_442111.1_4 Reverse -352 -366 3.63784 0.236
NP_440906.1_5 Reverse -354 -361 8.79057 0.149
NP_440906.1_5 Forward -345 -338 6.23397 0.234
NP_440906.1_5 Reverse -55 -62 6.23397 0.234
NP_440906.1_5 Reverse -338 -345 6.13563 0.241
NP_440906.1_5 Forward -62 -55 6.13563 0.241
NP_442596.1_10 Reverse -55 -74 13.5691 0.234
NP_442801.1_5 Forward -199 -182 14.886 0.18
NP_440747.1_10 Forward -349 -337 -4.28759 0.0903
NP_440747.1_10 Reverse -334 -346 -4.38592 0.0974
NP_440747.1_10 Forward -66 -54 -11.8591 0.161
NP_442634.1_4 Reverse -52 -66 6.88276 0.0489
NP_443018.1_3 Forward -62 -55 11.7405 0.0655
NP_443018.1_3 Reverse -338 -345 11.7405 0.0655
NP_443018.1_3 Forward -345 -338 5.44732 0.193
NP_443018.1_3 Reverse -55 -62 5.44732 0.193
NP_440376.1_1 Forward -346 -337 15.7327 0.00625
NP_440376.1_1 Reverse -337 -346 9.63616 0.0385
NP_440376.1_1 Reverse -54 -63 5.99792 0.111
NP_440376.1_1 Reverse -353 -362 5.21127 0.144
NP_440376.1_1 Reverse -66 -75 2.06468 0.236
NP_440376.1_1 Forward -63 -54 -0.196935 0.285
NP_441588.1_4 Forward -61 -51 13.943 0.0841
NP_441588.1_4 Reverse -339 -349 13.943 0.0841
NP_442687.1_7 Forward -347 -337 6.76487 0.154
NP_442687.1_7 Reverse -352 -362 3.71661 0.292
NP_441846.1_10 Reverse -11 -30 -21.9284 0.257
NP_442530.1_2 Forward -389 -379 13.7464 0.226
NP_441414.1_9 Forward -346 -327 0.58944 0.0807
NP_440184.1_1 Forward -163 -144 3.45038 0.237
NP_440184.1_10 Forward -168 -149 16.7149 0.171
NP_441317.1_4 Forward -250 -236 10.3234 0.29
NP_441958.1_5 Forward -347 -337 18.9579 0.00183
NP_441958.1_5 Reverse -336 -346 11.3864 0.0074
NP_441958.1_5 Reverse -53 -63 9.81313 0.0174
NP_441958.1_5 Forward -64 -54 1.55333 0.095
NP_442836.1_10 Reverse -60 -70 9.7148 0.269
NP_442690.1_1 Reverse -148 -167 -3.83545 0.142
NP_442911.1_1 Reverse -147 -160 14.0991 0.298
NP_443055.1_6 Reverse -337 -355 -2.63651 0.298
NP_440993.1_2 Forward -68 -52 9.7933 0.114
NP_440602.1_2 Forward -52 -33 1.37609 0.263
NP_441099.1_5 Reverse -343 -362 -9.14533 0.214
NP_442438.1_10 Forward -68 -54 -0.000409212 0.244
NP_441292.1_3 Forward -40 -21 12.9791 0.182
NP_440147.1_4 Forward -348 -335 10.639 0.0355
NP_440147.1_4 Reverse -335 -348 2.57589 0.207
NP_440147.1_4 Forward -364 -351 1.9859 0.213
NP_440147.1_4 Reverse -52 -65 1.19926 0.235
NP_441175.1_7 Forward -346 -327 14.8474 0.0948
NP_441550.1_8 Reverse -335 -345 14.3359 0.0162
NP_441550.1_8 Reverse -52 -62 14.0409 0.0194
NP_441550.1_8 Forward -348 -338 14.0409 0.0194
NP_441550.1_8 Forward -65 -55 8.82935 0.112
NP_441916.1_7 Reverse -337 -347 9.32148 0.037
NP_441916.1_7 Forward -346 -336 9.22315 0.0383
NP_441916.1_7 Forward -63 -53 1.06167 0.294
NP_440345.1_5 Forward -162 -148 16.8168 0.263
NP_441041.1_4 Reverse -337 -356 -1.47551 0.1
NP_441041.1_4 Reverse -54 -73 -10.6203 0.235
NP_441725.1_5 Reverse -55 -65 0.176696 0.206
NP_439966.1_7 Forward -65 -55 11.2876 0.0688
NP_439966.1_7 Reverse -335 -345 5.28945 0.232
NP_442941.1_3 Forward -345 -335 1.35667 0.15
NP_442941.1_3 Reverse -338 -348 1.25834 0.15
NP_442941.1_3 Forward -62 -52 1.25834 0.15
NP_442941.1_3 Reverse -55 -65 0.766681 0.171
NP_442941.1_5 Forward -246 -232 16.4348 0.237
NP_440260.1_7 Forward -90 -71 -5.99873 0.279
NP_442281.1_1 Forward -68 -54 6.88214 0.113
NP_441334.1_7 Reverse -335 -354 -11.5053 0.122
NP_441079.1_7 Reverse -138 -157 -1.67294 0.206
NP_440647.1_9 Reverse -335 -353 8.37728 0.219
NP_440647.1_9 Forward -348 -330 5.62401 0.23
NP_440647.1_9 Reverse -52 -70 4.05072 0.257
NP_440498.1_1 Forward -72 -54 1.10079 0.208
NP_440453.1_2 Forward -327 -313 15.9292 0.174
NP_441644.1_6 Reverse -337 -347 18.7607 0.00127
NP_441644.1_6 Forward -346 -336 9.41933 0.0767
NP_441644.1_6 Forward -63 -53 9.41933 0.0767
NP_441644.1_6 Reverse -54 -64 6.96107 0.141
NP_442177.1_5 Reverse -57 -71 11.6026 0.22
NP_442029.1_6 Reverse -49 -68 3.04771 0.286
NP_442247.1_8 Reverse -335 -349 8.94771 0.263
NP_440929.1_8 Reverse -337 -346 16.5193 0.00413
NP_440929.1_8 Forward -63 -54 14.651 0.0105
NP_440929.1_8 Forward -346 -337 9.53783 0.0296
NP_440929.1_8 Reverse -54 -63 7.66954 0.0624
NP_442933.1_10 Reverse -337 -346 8.06287 0.0885
NP_442933.1_10 Forward -346 -337 7.96454 0.0937
NP_442554.1_8 Forward -345 -335 14.0414 0.0145
NP_442554.1_8 Reverse -55 -65 11.2881 0.0377
NP_442554.1_8 Forward -62 -52 6.56821 0.112
NP_442554.1_8 Reverse -338 -348 6.56821 0.112
NP_442970.1_3 Forward -253 -235 13.0544 0.213
NP_441762.1_7 Forward -363 -351 -5.86088 0.246
NP_442292.1_1 Forward -345 -336 7.76787 0.0615
NP_442292.1_1 Forward -62 -53 7.66954 0.0634
NP_442292.1_1 Reverse -338 -347 7.66954 0.0634
NP_442292.1_1 Reverse -55 -64 7.17789 0.0777
NP_441711.1_4 Forward -355 -336 7.66927 0.144
NP_443009.1_5 Reverse -336 -347 6.1547 0.173
NP_443009.1_5 Forward -347 -336 6.05637 0.177
NP_443009.1_5 Reverse -179 -190 4.97473 0.222
NP_443009.1_5 Reverse -53 -64 4.97473 0.222
NP_442408.2_1 Reverse -337 -356 0.786102 0.201
NP_440357.1_3 Forward -207 -188 -0.0988766 0.287
NP_440357.1_6 Forward -24 -5 2.0644 0.296
NP_440158.1_1 Forward -162 -143 21.342 0.0154
NP_441198.1_5 Reverse -339 -352 12.1134 0.236
NP_441198.1_5 Forward -61 -48 12.1134 0.236
NP_440379.1_5 Reverse -93 -112 -7.27704 0.242
NP_441468.1_1 Forward -345 -338 6.13563 0.209
NP_441468.1_1 Reverse -55 -62 6.13563 0.209
NP_441468.1_1 Reverse -338 -345 6.0373 0.223
NP_441468.1_1 Forward -62 -55 6.0373 0.223
NP_441020.2_6 Reverse -52 -69 8.00365 0.212
NP_441673.1_1 Forward -346 -337 11.1111 0.0121
NP_441673.1_1 Reverse -337 -346 11.0128 0.018
NP_441673.1_1 Reverse -54 -63 1.37636 0.114
NP_441673.1_1 Forward -63 -54 1.1797 0.163
NP_442868.1_6 Reverse -178 -188 2.53664 0.205
NP_441305.1_4 Forward -112 -95 21.1792 0.116
NP_441305.1_7 Forward -173 -154 19.9124 0.274
NP_442361.1_3 Forward -352 -339 9.36073 0.276
NP_442361.1_3 Forward -69 -56 7.49244 0.3
NP_442808.1_1 Reverse -336 -346 9.321 0.0481
NP_442808.1_1 Reverse -352 -362 4.99446 0.178
NP_440145.1_3 Reverse -44 -63 3.93269 0.0945
NP_440145.1_3 Reverse -327 -346 -1.86883 0.156
NP_442050.1_5 Forward -65 -55 15.3192 0.0127
NP_442050.1_5 Reverse -335 -345 7.0594 0.27
NP_442789.1_4 Reverse -91 -110 -7.4737 0.297
NP_442792.1_6 Reverse -49 -68 5.89931 0.251
NP_441878.1_6 Forward -347 -337 0.766681 0.134
NP_441878.1_6 Reverse -336 -346 0.668351 0.139
NP_441878.1_6 Reverse -352 -362 -7.49312 0.231
NP_441036.1_8 Forward -347 -337 14.4347 0.0234
NP_441036.1_8 Forward -370 -360 6.46988 0.229
NP_441036.1_8 Reverse -336 -346 6.37155 0.234
NP_441036.1_8 Forward -64 -54 5.38824 0.287
NP_442650.1_2 Reverse -54 -68 4.62115 0.165
NP_441557.1_5 Forward -346 -337 10.2261 0.0144
NP_441557.1_5 Reverse -337 -346 10.1278 0.0188
NP_441557.1_5 Forward -63 -54 7.57121 0.049
NP_441557.1_5 Reverse -54 -63 1.08137 0.0794
NP_441557.1_8 Forward -224 -214 13.0576 0.225
NP_441308.1_8 Forward -65 -55 8.4365 0.254
NP_441564.1_10 Reverse -225 -244 4.62101 0.241
NP_442183.1_1 Forward -362 -348 9.43936 0.098
NP_442183.1_1 Reverse -54 -68 5.89945 0.198
NP_440276.1_8 Reverse -193 -212 6.68596 0.277
NP_442645.1_2 Reverse -329 -348 -12.9802 0.144
NP_442645.1_2 Forward -190 -171 -16.2252 0.227
NP_441037.1_4 Reverse -335 -345 11.0211 0.17
NP_441037.1_4 Forward -364 -354 8.19481 0.237
NP_441037.1_4 Reverse -358 -368 6.73295 0.245
NP_441037.1_4 Forward -348 -338 5.95329 0.289
NP_441037.1_4 Reverse -52 -62 5.95329 0.289
NP_442594.1_8 Reverse -12 -31 8.25926 0.206
NP_441633.1_3 Forward -232 -219 -1.849 0.165
NP_441633.1_3 Forward -364 -351 -5.78224 0.236
NP_440136.1_2 Forward -345 -338 6.23397 0.171
NP_440136.1_2 Reverse -55 -62 6.23397 0.171
NP_440136.1_2 Reverse -338 -345 6.13563 0.193
NP_440136.1_2 Forward -62 -55 6.13563 0.193
NP_440136.1_2 Reverse -354 -361 4.26735 0.218
NP_442998.1_10 Reverse -339 -346 15.5754 0.0102
NP_442998.1_10 Forward -61 -54 15.5754 0.0102
NP_442998.1_10 Forward -344 -337 5.84064 0.235
NP_440299.1_1 Forward -350 -337 4.05029 0.221
NP_440299.1_1 Forward -67 -54 2.08368 0.299
NP_441799.1_1 Reverse -333 -347 13.1753 0.0348
NP_441799.1_1 Reverse -50 -64 5.21053 0.218
NP_442504.1_4 Reverse -242 -261 7.8665 0.114
NP_442333.2_5 Forward -74 -55 -14.0619 0.271
NP_440256.1_1 Forward -66 -47 -4.81876 0.166
NP_440256.1_1 Reverse -334 -353 -10.3253 0.299
NP_441362.1_5 Reverse -108 -126 14.012 0.154
NP_442007.1_8 Forward -229 -211 18.0129 0.153
NP_440915.1_6 Forward -350 -336 12.4876 0.0208
NP_440915.1_6 Reverse -50 -64 0.392915 0.165
NP_440915.1_6 Reverse -333 -347 -0.0987402 0.182
NP_442069.1_6 Forward -221 -202 6.19431 0.224
NP_442866.1_1 Reverse -49 -68 -0.39387 0.193
NP_441464.1_8 Forward -362 -348 3.63784 0.291
NP_442386.1_9 Forward -206 -197 7.2758 0.219
NP_441340.1_5 Forward -345 -338 13.5105 0.0314
NP_441340.1_5 Reverse -55 -62 13.5105 0.0314
NP_441340.1_5 Reverse -338 -345 5.84064 0.208
NP_441340.1_5 Forward -62 -55 5.84064 0.208
NP_441027.1_1 Forward -85 -71 13.6669 0.27
NP_440586.1_8 Forward -62 -55 9.47853 0.146
NP_440586.1_8 Reverse -338 -345 9.47853 0.146
NP_440586.1_8 Forward -345 -338 5.74197 0.283
NP_440586.1_8 Reverse -55 -62 5.74197 0.283
NP_441262.1_3 Reverse -54 -61 14.7888 0.0223
NP_441262.1_3 Forward -346 -339 14.7888 0.0223
NP_443051.1_1 Reverse -53 -62 16.6177 0.00754
NP_443051.1_1 Forward -347 -338 16.6177 0.00754
NP_443051.1_1 Reverse -336 -345 9.73449 0.0265
NP_443051.1_1 Forward -64 -55 7.66954 0.0571
NP_441232.1_10 Forward -373 -354 3.73603 0.219
NP_440439.1_1 Forward -66 -53 3.85419 0.109
NP_440439.1_1 Forward -349 -336 -0.570702 0.226
NP_440439.1_1 Reverse -334 -347 -0.570702 0.226
NP_440372.1_2 Forward -345 -338 13.8055 0.0214
NP_440372.1_2 Reverse -55 -62 13.8055 0.0214
NP_440372.1_2 Reverse -338 -345 6.52896 0.188
NP_440372.1_2 Forward -62 -55 6.52896 0.188
NP_441138.1_5 Forward -248 -235 8.84703 0.238
NP_442488.1_7 Reverse -231 -250 8.75091 0.284
NP_442384.1_10 Reverse -337 -350 12.6056 0.0267
NP_442384.1_10 Forward -346 -333 5.03416 0.139
NP_442384.1_10 Forward -63 -50 2.67422 0.216
NP_441018.1_7 Reverse -212 -231 6.29264 0.294
NP_442790.1_4 Forward -355 -336 -14.0619 0.271
NP_442790.1_4 Reverse -45 -64 -14.6519 0.278
NP_442262.1_10 Reverse -338 -345 13.2155 0.0213
NP_442262.1_10 Forward -62 -55 13.2155 0.0213
NP_441689.1_5 Forward -65 -55 8.53436 0.132
NP_441689.1_5 Reverse -335 -345 6.0761 0.197
NP_441689.1_5 Forward -348 -338 5.78111 0.197
NP_441689.1_5 Reverse -52 -62 5.78111 0.197
NP_440163.1_10 Forward -135 -125 8.63316 0.266
NP_440344.1_10 Reverse -346 -363 -7.13932 0.115
NP_440297.1_9 Reverse -55 -65 -0.216628 0.282
NP_440888.1_2 Reverse -337 -351 9.53707 0.123
NP_440888.1_2 Forward -102 -88 7.66879 0.186
NP_440600.1_4 Forward -354 -336 1.19912 0.128
NP_440600.1_4 Reverse -46 -64 -4.30741 0.257
NP_440052.1_7 Forward -283 -264 16.8141 0.157
NP_441543.1_2 Forward -345 -336 6.5879 0.143
NP_441543.1_2 Reverse -338 -347 6.09625 0.153
NP_441543.1_2 Forward -62 -53 6.09625 0.153
NP_441543.1_2 Reverse -354 -363 5.70292 0.181
NP_442845.1_2 Forward -352 -338 5.30946 0.237
NP_442845.1_2 Reverse -48 -62 4.62115 0.256
NP_442710.1_7 Reverse -140 -159 9.69258 0.0963
NP_441469.1_8 Forward -363 -354 6.78456 0.227
NP_443064.1_6 Forward -346 -336 9.65817 0.205
NP_443064.1_6 Reverse -337 -347 8.6886 0.276
NP_442578.1_7 Forward -345 -338 6.0373 0.18
NP_442578.1_7 Reverse -55 -62 6.0373 0.18
NP_440710.1_1 Forward -354 -336 -7.94566 0.249
NP_441462.1_2 Forward -346 -336 18.4663 0.00326
NP_441462.1_2 Reverse -337 -347 10.4031 0.011
NP_441462.1_2 Reverse -54 -64 9.61647 0.0154
NP_441462.1_2 Forward -63 -53 0.57002 0.144
NP_443062.1_1 Forward -63 -45 13.1288 0.0663
NP_442781.1_1 Reverse -268 -287 22.3206 0.0404
NP_442781.1_2 Reverse -309 -328 16.0265 0.045
NP_442204.1_1 Forward -350 -339 8.81013 0.0852
NP_442204.1_1 Forward -197 -186 4.5819 0.246
NP_442204.1_1 Forward -67 -56 -0.0396598 0.285
NP_441560.1_8 Forward -400 -381 12.9735 0.239
NP_440516.1_8 Forward -346 -337 16.9127 0.00442
NP_440516.1_8 Reverse -337 -346 14.8477 0.00685
NP_440516.1_8 Reverse -54 -63 9.53783 0.0136
NP_440516.1_8 Forward -63 -54 5.01461 0.118
NP_440516.1_8 Forward -362 -353 -0.68859 0.297
NP_442428.1_5 Forward -345 -338 6.13563 0.209
NP_442428.1_5 Reverse -55 -62 6.13563 0.209
NP_442428.1_5 Reverse -338 -345 6.0373 0.212
NP_442428.1_5 Forward -62 -55 6.0373 0.212
NP_441443.1_1 Reverse -20 -39 -5.60541 0.298
NP_442120.1_10 Reverse -90 -109 0.392778 0.157
NP_440673.1_3 Forward -61 -54 12.4288 0.0426
NP_440673.1_3 Reverse -339 -346 12.4288 0.0426
NP_440673.1_7 Forward -357 -338 4.32602 0.186
NP_441052.1_2 Forward -346 -336 0.865012 0.256
NP_441052.1_2 Reverse -337 -347 0.57002 0.256
NP_442086.1_3 Forward -345 -326 9.83255 0.224
NP_442907.1_9 Forward -68 -49 -5.9004 0.284
NP_441719.1_4 Forward -345 -338 6.82395 0.0855
NP_441719.1_4 Reverse -55 -62 6.82395 0.0855
NP_441719.1_4 Reverse -338 -345 6.52896 0.188
NP_441719.1_4 Forward -62 -55 6.52896 0.188
NP_442813.1_4 Reverse -200 -219 -9.14533 0.299
NP_442366.1_5 Reverse -51 -61 15.4175 0.0374
NP_442366.1_5 Forward -349 -339 15.4175 0.0374
NP_442366.1_5 Reverse -334 -344 12.0743 0.147
NP_442366.1_5 Forward -178 -168 11.5826 0.177
NP_441115.1_4 Reverse -336 -354 11.0314 0.154
NP_441115.1_4 Reverse -53 -71 9.55647 0.21
NP_442206.1_10 Reverse -54 -69 12.1729 0.0896
NP_440328.1_4 Forward -181 -162 3.73603 0.174
NP_441966.1_8 Reverse -201 -219 -5.97904 0.282
NP_441157.1_1 Forward -162 -148 5.60385 0.235
NP_440593.1_3 Forward -232 -213 -6.78538 0.28
NP_441982.1_6 Reverse -238 -247 13.2493 0.274
NP_440165.1_5 Reverse -336 -355 -4.91709 0.22
NP_440165.1_5 Forward -64 -45 -8.35868 0.298
NP_439960.1_10 Forward -355 -337 -2.43913 0.255
NP_441596.1_1 Forward -347 -328 14.0608 0.294
NP_440726.1_2 Forward -356 -337 1.27776 0.285
NP_440195.1_4 Forward -400 -381 11.8975 0.136
NP_441570.1_1 Reverse -337 -355 -8.92897 0.124
NP_441570.1_1 Reverse -54 -72 -11.0923 0.187
NP_441570.1_1 Forward -362 -344 -16.7954 0.254
NP_441570.1_1 Forward -63 -45 -17.2871 0.269
NP_441078.1_4 Forward -346 -337 9.93116 0.0203
NP_441078.1_4 Reverse -337 -346 9.83282 0.0226
NP_441078.1_4 Forward -362 -353 5.80125 0.104
NP_441078.1_4 Reverse -54 -63 0.196389 0.205
NP_441078.1_4 Forward -63 -54 -0.000272808 0.205
NP_442443.1_1 Reverse -214 -233 -0.885524 0.227
NP_441432.1_8 Reverse -53 -62 14.0611 0.0258
NP_441432.1_8 Forward -347 -338 14.0611 0.0258
NP_441432.1_8 Reverse -336 -345 6.98123 0.112
NP_441432.1_9 Forward -246 -233 19.4576 0.00893
NP_441732.1_2 Forward -350 -334 -16.5594 0.174
NP_441732.1_2 Forward -67 -51 -17.641 0.281
NP_441732.1_5 Forward -291 -277 11.111 0.213
NP_440760.1_1 Forward -346 -327 -20.4534 0.222
NP_442407.1_6 Reverse -351 -370 8.75091 0.296
NP_442407.1_8 Reverse -337 -356 22.0256 0.0784
NP_441023.1_1 Reverse -337 -355 16.6371 0.18
NP_442489.1_7 Reverse -337 -346 10.5211 0.0102
NP_442489.1_7 Forward -346 -337 10.4228 0.0151
NP_442489.1_7 Forward -63 -54 0.688044 0.152
NP_442489.1_7 Reverse -54 -63 0.688044 0.152
NP_440559.1_1 Forward -345 -336 5.89959 0.136
NP_440559.1_1 Reverse -55 -64 5.01461 0.161
NP_441659.2_8 Reverse -337 -347 17.7779 0.00179
NP_441659.2_8 Forward -346 -336 11.3864 0.0184
NP_441659.2_8 Forward -63 -53 8.23984 0.0462
NP_441659.2_8 Reverse -54 -64 8.04317 0.0508
NP_441022.1_1 Reverse -147 -156 10.6829 0.288
NP_442913.1_10 Forward -355 -336 -0.787193 0.165
NP_440708.1_6 Reverse -192 -211 -9.73531 0.273
NP_442346.1_5 Forward -347 -337 7.15819 0.178
NP_442346.1_5 Reverse -336 -346 6.46988 0.201
NP_442346.1_5 Reverse -53 -63 5.87989 0.225
NP_440545.1_3 Reverse -50 -67 4.07041 0.0751
NP_442875.1_7 Forward -122 -103 14.0599 0.226
NP_440449.1_6 Forward -354 -336 11.3683 0.131
NP_441948.1_4 Forward -369 -351 -1.45582 0.146
NP_441833.1_4 Reverse -338 -345 6.52896 0.0924
NP_441833.1_4 Forward -62 -55 6.52896 0.0924
NP_441833.1_4 Forward -345 -338 6.23397 0.163
NP_441833.1_4 Reverse -55 -62 6.23397 0.163
NP_440751.1_3 Reverse -274 -293 7.57013 0.287
NP_441329.1_6 Reverse -232 -251 13.2252 0.106
NP_441329.1_6 Reverse -230 -249 4.72643 0.2
NP_442162.1_9 Forward -345 -338 12.9205 0.0282
NP_442162.1_9 Reverse -338 -345 12.9205 0.0282
NP_442162.1_9 Forward -62 -55 12.9205 0.0282
NP_442162.1_9 Reverse -55 -62 12.9205 0.0282
NP_440671.1_1 Reverse -145 -164 6.9924 0.228
NP_440671.1_4 Forward -69 -55 6.09611 0.261
NP_440671.1_5 Forward -35 -21 15.6336 0.217
NP_442199.1_5 Forward -71 -52 -7.4737 0.296
NP_442140.1_3 Forward -62 -52 4.60159 0.242
NP_442140.1_3 Reverse -338 -348 4.60159 0.242
NP_441813.1_5 Forward -65 -55 11.9764 0.0208
NP_441813.1_5 Reverse -335 -345 5.48657 0.123
NP_440590.1_4 Forward -345 -332 1.00259 0.136
NP_440590.1_4 Reverse -338 -351 -0.37404 0.186
NP_440590.1_4 Reverse -354 -367 -2.53732 0.245
NP_440590.1_4 Forward -205 -192 -3.4223 0.255
NP_440567.1_1 Reverse -338 -352 2.16287 0.182
NP_442497.1_10 Forward -345 -336 7.86621 0.0695
NP_442497.1_10 Forward -62 -53 7.76787 0.0731
NP_442497.1_10 Reverse -338 -347 7.76787 0.0731
NP_442497.1_10 Reverse -55 -64 5.99792 0.095
NP_440821.1_4 Reverse -351 -361 4.3066 0.131
NP_440821.1_4 Forward -65 -55 0.668351 0.159
NP_441239.1_9 Forward -65 -53 10.8554 0.0714
NP_441239.1_9 Reverse -335 -347 9.87208 0.0941
NP_441239.1_9 Reverse -351 -363 3.97222 0.269
NP_442568.1_8 Reverse -234 -248 11.996 0.257
NP_441892.1_1 Forward -355 -338 -6.15601 0.298
NP_441017.1_8 Reverse -23 -38 10.7963 0.188
NP_440546.1_4 Forward -346 -336 14.5061 0.0459
NP_440546.1_4 Reverse -337 -347 10.9186 0.101
NP_440546.1_4 Reverse -54 -64 7.62206 0.23
NP_440462.1_6 Reverse -335 -345 7.55152 0.0741
NP_440462.1_6 Forward -65 -55 5.28991 0.161
NP_442611.1_1 Reverse -54 -73 2.0644 0.233
NP_442144.1_1 Reverse -51 -67 11.4649 0.296
NP_440868.1_4 Reverse -50 -62 3.57889 0.134
NP_441474.1_1 Forward -73 -54 5.30853 0.212
NP_442402.1_4 Forward -245 -226 -8.6544 0.284
NP_441848.1_7 Reverse -186 -205 0.392004 0.228
NP_442039.1_4 Forward -345 -338 11.6422 0.0747
NP_442039.1_4 Reverse -55 -62 11.6422 0.0747
NP_442679.1_1 Reverse -230 -249 -2.16383 0.24
NP_442679.1_1 Reverse -238 -257 -3.83545 0.264
NP_442679.1_1 Reverse -237 -256 -4.03212 0.269
NP_442829.1_2 Reverse -233 -249 10.3637 0.287
NP_442829.1_2 Reverse -232 -248 10.1704 0.287
NP_441926.1_3 Forward -346 -330 2.22182 0.289
NP_442837.1_3 Forward -345 -338 6.0373 0.25
NP_442837.1_3 Reverse -338 -345 6.0373 0.25
NP_442837.1_3 Forward -62 -55 6.0373 0.25
NP_442837.1_3 Reverse -55 -62 6.0373 0.25
NP_442053.1_1 Reverse -337 -346 16.6177 0.00257
NP_442053.1_1 Forward -346 -337 8.65285 0.0741
NP_442053.1_1 Forward -63 -54 7.07956 0.105
NP_440505.1_3 Forward -348 -338 6.46988 0.18
NP_440505.1_3 Reverse -52 -62 6.46988 0.18
NP_441102.1_1 Reverse -55 -74 8.75091 0.18
NP_442532.1_4 Forward -156 -138 7.86797 0.289
NP_440914.1_1 Reverse -337 -347 14.373 0.0158
NP_440914.1_1 Forward -346 -336 12.1284 0.0654
NP_440914.1_1 Reverse -54 -64 9.88379 0.167
NP_441011.1_8 Forward -345 -336 13.0777 0.0366
NP_441011.1_8 Reverse -338 -347 6.78456 0.184
NP_441011.1_8 Forward -62 -53 6.78456 0.184
NP_441011.1_8 Forward -361 -352 6.48957 0.191
NP_441011.1_8 Reverse -55 -64 5.40793 0.263
NP_442101.1_10 Forward -354 -335 2.26107 0.0714
NP_442533.1_6 Reverse -337 -346 14.2577 0.0132
NP_442533.1_6 Forward -346 -337 7.47288 0.0898
NP_442533.1_6 Forward -63 -54 4.42462 0.179
NP_442533.1_6 Forward -75 -66 2.26134 0.266
NP_442232.1_3 Reverse -51 -70 -10.522 0.27
NP_442322.1_4 Reverse -176 -193 -9.89323 0.297
NP_442322.1_4 Forward -233 -216 -10.1882 0.298
NP_441482.1_7 Forward -69 -55 -3.24533 0.115
NP_441482.1_7 Reverse -331 -345 -4.62196 0.153
NP_441482.1_7 Reverse -48 -62 -5.21195 0.174
NP_439944.1_9 Reverse -55 -65 6.07655 0.199
NP_441028.1_6 Forward -116 -106 4.60114 0.278
NP_441028.1_6 Forward -247 -237 4.30615 0.278
NP_440116.1_8 Reverse -55 -74 4.12936 0.0747
NP_440116.1_8 Reverse -338 -357 -2.45882 0.134
NP_441527.1_4 Reverse -233 -252 7.59119 0.0933
NP_441527.1_4 Reverse -232 -251 1.57519 0.133
NP_441527.1_4 Reverse -234 -253 -1.38506 0.147
NP_441527.1_4 Reverse -236 -255 -11.8892 0.284
NP_441527.1_4 Reverse -230 -249 -13.0351 0.298
NP_440007.1_9 Forward -67 -53 1.47456 0.285
NP_440903.1_1 Forward -324 -314 17.7779 0.16
NP_441106.1_1 Reverse -336 -345 8.84951 0.0431
NP_441106.1_1 Forward -347 -338 8.75118 0.0469
NP_441106.1_1 Reverse -53 -62 8.75118 0.0469
NP_439903.1_6 Forward -66 -47 0.490334 0.261
NP_439903.1_6 Reverse -334 -353 -0.787962 0.285
NP_439903.1_6 Reverse -187 -206 -1.27961 0.295
NP_001035870.1_3 Reverse -43 -62 7.57094 0.163
NP_442306.1_10 Reverse -332 -351 -21.6334 0.282
NP_441186.1_4 Forward -162 -152 16.1058 0.223
NP_441286.1_1 Forward -363 -351 -5.95921 0.235
NP_442674.1_1 Reverse -231 -250 15.027 0.185
NP_440670.1_8 Forward -346 -337 18.0926 0.00136
NP_440670.1_8 Reverse -54 -63 16.0277 0.00443
NP_440670.1_8 Reverse -337 -346 15.831 0.00494
NP_440670.1_8 Forward -63 -54 12.5861 0.0253
NP_441479.1_9 Reverse -54 -72 12.5072 0.293
NP_442908.1_1 Forward -248 -229 1.37609 0.277
NP_440886.1_7 Forward -363 -353 13.2542 0.0802
NP_440886.1_7 Reverse -336 -346 6.76441 0.114
NP_442072.1_9 Forward -347 -329 -4.8974 0.0538
NP_442072.1_9 Reverse -53 -71 -23.3836 0.292
NP_440513.1_4 Forward -63 -44 8.25926 0.295
NP_442213.1_5 Reverse -205 -224 -1.27885 0.293
NP_442295.1_7 Forward -224 -206 13.3914 0.289
NP_440907.2_8 Forward -62 -52 14.1392 0.0325
NP_440907.2_8 Reverse -338 -348 14.1392 0.0325
NP_440907.2_8 Forward -345 -335 6.37109 0.171
NP_440907.2_8 Forward -361 -351 6.0761 0.179
NP_441021.1_1 Forward -280 -261 -12.3902 0.286
NP_441463.1_3 Reverse -343 -362 -10.0303 0.288
NP_442842.1_10 Forward -253 -234 5.80468 0.207
NP_441626.1_2 Forward -345 -338 12.2322 0.0511
NP_441626.1_2 Reverse -55 -62 12.2322 0.0511
NP_441626.1_2 Reverse -338 -345 5.93897 0.231
NP_441626.1_2 Forward -62 -55 5.93897 0.231
NP_442365.1_7 Forward -67 -48 -2.95047 0.208
NP_442794.1_1 Forward -67 -55 7.02048 0.152
NP_442615.1_1 Reverse -328 -346 5.23069 0.0398
NP_442615.1_1 Reverse -57 -75 -3.22577 0.159
NP_442615.1_1 Forward -371 -353 -5.68405 0.22
NP_442615.1_1 Reverse -45 -63 -7.55234 0.296
NP_440387.1_1 Reverse -337 -353 7.13836 0.0282
NP_440387.1_1 Forward -346 -330 5.76173 0.031
NP_440387.1_1 Reverse -54 -70 -3.67804 0.164
NP_440387.1_1 Forward -63 -47 -3.97304 0.171
NP_441488.1_8 Forward -351 -337 9.6354 0.148
NP_440467.1_3 Forward -74 -55 13.0141 0.214
NP_440114.1_10 Forward -346 -332 11.6026 0.107
NP_440287.1_6 Reverse -328 -347 2.26107 0.247
NP_439988.1_3 Reverse -56 -70 9.83269 0.245
NP_439988.1_8 Forward -398 -379 22.8122 0.00811
NP_440422.1_10 Forward -252 -233 8.66165 0.212
NP_442743.1_5 Reverse -191 -210 4.71934 0.213
NP_441311.1_2 Forward -352 -338 14.1586 0.229
NP_440457.1_1 Forward -293 -281 5.15219 0.145
NP_440457.1_1 Reverse -50 -62 3.18557 0.202
NP_440457.1_1 Forward -350 -338 0.628964 0.25
NP_440798.1_6 Reverse -338 -351 3.06754 0.153
NP_440798.1_6 Forward -345 -332 2.08423 0.186
NP_440798.1_6 Forward -62 -49 1.9859 0.188
NP_440798.1_6 Reverse -55 -68 0.707601 0.251
NP_442561.1_2 Reverse -198 -217 17.0107 0.26
NP_441489.1_3 Reverse -237 -251 10.9932 0.229
NP_440554.1_4 Reverse -55 -65 7.64985 0.101
NP_440554.1_4 Reverse -338 -348 5.87989 0.129
NP_440554.1_4 Forward -62 -52 5.87989 0.129
NP_441885.1_5 Forward -346 -336 9.12481 0.0238
NP_441885.1_5 Reverse -337 -347 1.55333 0.109
NP_441885.1_5 Reverse -54 -64 -0.0199663 0.186
NP_441885.1_5 Forward -362 -352 -1.29827 0.259
NP_442703.1_9 Reverse -231 -249 3.95239 0.266
NP_442341.1_7 Reverse -336 -350 1.37622 0.292
NP_442341.1_9 Reverse -52 -66 9.04542 0.159
NP_442341.1_9 Forward -348 -334 8.3571 0.171
NP_442341.1_9 Reverse -335 -349 5.01387 0.284
NP_442395.2_4 Forward -69 -50 1.76863 0.234
NP_443000.1_7 Forward -348 -338 0.963343 0.278
NP_443000.1_7 Reverse -52 -62 0.963343 0.278
NP_443000.1_7 Reverse -335 -345 0.865012 0.285
NP_440076.1_5 Forward -206 -187 12.585 0.265
NP_441842.1_10 Forward -353 -339 15.4376 0.0436
NP_440275.1_3 Forward -348 -338 6.46988 0.105
NP_440275.1_3 Reverse -52 -62 6.46988 0.105
NP_442638.1_3 Reverse -374 -393 10.074 0.298
NP_441635.1_6 Forward -247 -228 13.8641 0.24
NP_441105.1_3 Forward -280 -261 -3.04881 0.172
NP_440216.1_1 Reverse -337 -351 4.81781 0.0229
NP_440216.1_1 Forward -346 -332 -3.24533 0.0754
NP_440216.1_1 Forward -63 -49 -5.70361 0.135
NP_440216.1_1 Reverse -54 -68 -12.1934 0.247
NP_440216.1_9 Forward -279 -270 5.89959 0.289
NP_440172.1_1 Reverse -337 -347 14.6313 0.011
NP_440172.1_1 Forward -346 -336 7.84651 0.0718
NP_440172.1_1 Forward -63 -53 4.79825 0.166
NP_440046.1_5 Reverse -147 -166 13.2896 0.121
NP_442015.1_10 Forward -67 -54 10.934 0.0391
NP_441226.1_7 Forward -345 -338 12.7234 0.0312
NP_441226.1_7 Reverse -55 -62 12.7234 0.0312
NP_441226.1_7 Reverse -338 -345 11.5435 0.0757
NP_441226.1_7 Forward -62 -55 11.5435 0.0757
NP_441757.1_3 Forward -100 -81 3.14605 0.155
NP_441111.1_7 Forward -345 -337 8.96754 0.0463
NP_441111.1_7 Reverse -338 -346 8.86921 0.0589
NP_441111.1_7 Forward -62 -54 8.86921 0.0589
NP_441766.1_2 Reverse -337 -346 13.9627 0.0114
NP_441766.1_2 Forward -63 -54 12.6844 0.0158
NP_441766.1_2 Forward -346 -337 7.76787 0.0714
NP_442417.1_5 Reverse -337 -351 13.9626 0.071
NP_442417.1_5 Reverse -54 -68 6.6861 0.211
NP_440845.1_1 Forward -190 -171 -6.29373 0.296
NP_442046.1_1 Forward -328 -314 20.2558 0.116
NP_440261.1_5 Forward -98 -85 -11.0921 0.237
NP_440261.1_5 Forward -188 -175 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCAGAAACTATGCCAATCATTAAACTGCTACAGGTTCGGCTATCCCGCCCTTAGGCGATCGGCTAACATTTATTTGTGTGTGAGGAGTAAGATTAATAAGGAAGCAGCCGGAGGGTCGAAACATGGCAAGACTCCTTGCGGACTTCCTTATTTTTTTGCCTATTTTTTCGGTAATACCCGCCCCAGCAAGTCTCAGGAAAGGCGAAGATGAGGGATTGACCGTAGTCTATCCACTCGTTAACAAAACTTTATGGTATATTTAGATACAGCGGTGAAAGATTGATATTTCTCCATAGAAGTGTCTGCCGCCCCGAGGGTTTATTTGCCTAGCCCCAATCCGATCGCCTAACTTAGCTTTTGACTGGATTCTCCCCTCTCCATCCTCGAACTTACTGCTTT

CDS

ATGTTGGTACTTTCCGTCCTATCTTTGGCCTTAGCCTCGTTTTCTGCCATCCTGTGCTTCACTGTGCAGGAAGATGTGGTCAGGGCTTCGTTAGGTTGTGTGGCCGTATTGTCGATTTTGGTCACTCTCTTTTTTGCTCCCTGGGCGTTAAAACTGACTTTAATGGCGGTTCCCTTCGGTTTAGAGCGGTTTTATCGCCTCAATCAAAATGCCCCCATGGATTGA

Protein

MLVLSVLSLALASFSAILCFTVQEDVVRASLGCVAVLSILVTLFFAPWALKLTLMAVPFGLERFYRLNQNAPMD