Your browser is old and dusty. Try Google Chrome!

Details for ssl3580

ORF ssl3580
Accession NP_441500.1
Symbol hypC
Category Hydrogenase
Definition putative hydrogenase expression/formation protein HypC
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -278 -264 10.3243 0.0635
NP_440557.1_1 Reverse -207 -226 0.392778 0.265
NP_440795.1_7 Forward -278 -271 14.6904 0.0123
NP_440795.1_7 Reverse -271 -278 14.6904 0.0123
NP_441418.1_6 Forward -279 -260 -19.4701 0.0888
NP_441418.1_6 Forward -215 -196 -27.9265 0.203
NP_441480.1_1 Forward -341 -322 3.04771 0.287
NP_442291.1_5 Forward -280 -264 11.5633 0.0388
NP_442291.1_5 Reverse -269 -285 -0.531451 0.185
NP_440897.1_6 Reverse -270 -289 -1.08295 0.187
NP_441453.1_4 Reverse -270 -278 16.539 0.00633
NP_441453.1_4 Forward -279 -271 16.539 0.00633
NP_441453.1_4 Forward -215 -207 6.80426 0.121
NP_441453.1_4 Reverse -206 -214 6.11594 0.121
NP_441623.1_1 Forward -32 -14 -2.53746 0.241
NP_442151.1_6 Forward -215 -201 12.0943 0.0818
NP_442151.1_6 Reverse -270 -284 8.84938 0.164
NP_442151.1_6 Forward -279 -265 7.76774 0.19
NP_443043.1_7 Reverse -367 -386 9.43923 0.263
NP_441818.1_1 Forward -278 -267 18.8393 0.00301
NP_441818.1_1 Reverse -271 -282 15.4961 0.0264
NP_441818.1_9 Forward -399 -380 -10.522 0.295
NP_440226.1_1 Forward -279 -260 14.2574 0.0321
NP_440226.1_1 Reverse -270 -289 9.63589 0.0703
NP_440259.1_4 Forward -182 -168 13.9382 0.217
NP_441976.1_4 Forward -392 -375 19.6067 0.126
NP_442655.1_10 Forward -396 -377 -19.4701 0.282
NP_442173.1_1 Forward -278 -270 15.4574 0.00633
NP_442173.1_1 Reverse -271 -279 15.4574 0.00633
NP_442173.1_1 Reverse -207 -215 12.0158 0.0316
NP_442173.1_1 Forward -214 -206 4.83764 0.241
NP_442752.1_4 Forward -279 -272 13.8055 0.0199
NP_442752.1_4 Reverse -270 -277 13.8055 0.0199
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_442752.1_4 Forward -196 -189 5.44732 0.202
NP_443027.1_4 Reverse -268 -278 14.0414 0.0452
NP_443027.1_4 Forward -281 -271 11.0914 0.107
NP_441812.1_3 Forward -280 -266 10.9143 0.215
NP_442975.1_10 Reverse -266 -280 4.62054 0.241
NP_442975.1_10 Forward -283 -269 3.34225 0.259
NP_440784.1_7 Forward -278 -271 15.9687 0.0123
NP_440784.1_7 Reverse -271 -278 15.9687 0.0123
NP_440784.1_7 Forward -214 -207 6.23397 0.241
NP_440784.1_7 Reverse -207 -214 6.13563 0.241
NP_442909.1_7 Forward -278 -264 12.0937 0.131
NP_440061.1_9 Reverse -268 -282 17.9935 0.0113
NP_441054.1_4 Reverse -260 -278 0.412472 0.174
NP_442062.1_8 Forward -279 -269 17.3846 0.00193
NP_442062.1_8 Reverse -270 -280 17.3846 0.00193
NP_442062.1_8 Forward -144 -134 3.51995 0.267
NP_442062.1_8 Forward -196 -186 2.83163 0.293
NP_441900.1_1 Reverse -186 -205 15.6085 0.156
NP_441900.1_2 Reverse -368 -386 -0.0799167 0.266
NP_441995.1_6 Forward -218 -199 14.9458 0.286
NP_440304.1_4 Reverse -268 -278 10.8948 0.051
NP_440304.1_4 Forward -281 -271 1.84832 0.299
NP_440304.1_4 Forward -258 -248 1.84832 0.299
NP_442242.1_4 Forward -278 -271 14.3954 0.0124
NP_442242.1_4 Reverse -271 -278 14.3954 0.0124
NP_440044.1_8 Forward -278 -259 -2.26216 0.261
NP_441781.1_7 Forward -279 -260 0.982764 0.239
NP_439918.1_2 Forward -207 -188 -2.16383 0.242
NP_439918.1_2 Forward -213 -194 -2.55715 0.244
NP_441161.1_7 Forward -117 -98 16.9124 0.193
NP_441619.1_8 Reverse -264 -278 8.65209 0.237
NP_441594.1_6 Forward -153 -134 10.6192 0.125
NP_441594.1_6 Reverse -144 -163 1.86774 0.261
NP_442110.1_7 Forward -215 -201 4.62115 0.197
NP_442110.1_7 Forward -279 -265 0.294584 0.264
NP_440856.1_7 Forward -156 -137 -6.68705 0.246
NP_441083.1_5 Forward -279 -269 20.3345 0.00053
NP_441083.1_5 Reverse -270 -280 20.3345 0.00053
NP_441083.1_5 Reverse -206 -216 8.82982 0.03
NP_441083.1_5 Forward -215 -205 8.04317 0.046
NP_439957.1_10 Forward -380 -370 16.4996 0.277
NP_442115.2_7 Reverse -106 -123 9.97027 0.153
NP_441738.1_2 Forward -277 -270 15.28 0.0102
NP_441738.1_2 Reverse -272 -279 15.28 0.0102
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441738.1_2 Reverse -189 -196 10.2652 0.101
NP_441558.1_5 Reverse -204 -223 13.6675 0.0561
NP_441645.1_1 Reverse -277 -296 7.17681 0.294
NP_440209.1_1 Reverse -270 -278 18.1123 0.00295
NP_440209.1_1 Forward -279 -271 18.1123 0.00295
NP_440209.1_1 Forward -215 -207 8.57422 0.0425
NP_440209.1_1 Reverse -206 -214 5.52596 0.0821
NP_442889.1_8 Forward -282 -268 11.602 0.0733
NP_442889.1_8 Reverse -267 -281 4.12889 0.27
NP_441770.1_4 Forward -63 -44 -11.8003 0.29
NP_440178.1_7 Forward -280 -261 -4.72043 0.0579
NP_442570.1_3 Forward -217 -198 -7.86702 0.279
NP_441792.1_5 Reverse -187 -203 12.7432 0.19
NP_441716.1_1 Reverse -270 -284 11.3077 0.0936
NP_441716.1_1 Forward -150 -136 8.16106 0.149
NP_441716.1_1 Forward -279 -265 4.22782 0.256
NP_442111.1_4 Reverse -205 -219 12.586 0.0422
NP_442111.1_4 Reverse -269 -283 3.93283 0.226
NP_440906.1_5 Forward -278 -271 15.8704 0.0124
NP_440906.1_5 Reverse -271 -278 15.8704 0.0124
NP_440906.1_5 Forward -214 -207 6.23397 0.234
NP_440906.1_5 Reverse -207 -214 6.13563 0.241
NP_440747.1_10 Forward -282 -270 16.7552 0.0019
NP_440747.1_10 Reverse -267 -279 7.51213 0.00286
NP_440747.1_10 Forward -218 -206 -2.4193 0.0434
NP_440747.1_10 Reverse -203 -215 -12.1541 0.227
NP_440747.1_10 Forward -147 -135 -12.1541 0.227
NP_440747.1_10 Reverse -132 -144 -12.4491 0.282
NP_440747.1_10 Forward -153 -141 -12.5474 0.297
NP_441130.1_10 Reverse -268 -282 8.45605 0.135
NP_441130.1_10 Reverse -204 -218 7.37441 0.162
NP_441130.1_10 Forward -281 -267 5.70279 0.218
NP_441486.1_1 Reverse -267 -281 14.2576 0.00654
NP_441486.1_1 Forward -282 -268 3.8345 0.0534
NP_441486.1_1 Reverse -203 -217 -5.90027 0.266
NP_442634.1_4 Forward -281 -267 -2.06536 0.149
NP_441014.1_10 Forward -280 -261 17.7965 0.0425
NP_442848.1_1 Reverse -264 -278 16.0275 0.0143
NP_442848.1_5 Reverse -192 -210 0.904127 0.276
NP_441012.1_4 Reverse -59 -72 7.78743 0.272
NP_443018.1_3 Forward -278 -271 14.8871 0.0123
NP_443018.1_3 Reverse -271 -278 14.8871 0.0123
NP_443018.1_3 Reverse -207 -214 11.7405 0.0655
NP_443018.1_3 Forward -214 -207 5.44732 0.193
NP_441634.1_8 Forward -281 -267 5.01447 0.114
NP_440376.1_1 Forward -279 -270 19.4693 0.000692
NP_440376.1_1 Reverse -270 -279 19.4693 0.000692
NP_440376.1_1 Forward -215 -206 5.99792 0.111
NP_440376.1_1 Reverse -120 -129 0.589713 0.267
NP_440376.1_1 Reverse -206 -215 -0.196935 0.285
NP_441588.1_4 Forward -277 -267 8.63316 0.14
NP_441588.1_4 Reverse -272 -282 6.46988 0.193
NP_442687.1_7 Forward -280 -270 8.92815 0.0994
NP_442687.1_7 Reverse -269 -279 8.92815 0.0994
NP_442687.1_7 Reverse -62 -72 4.89658 0.23
NP_442687.1_7 Forward -216 -206 4.50326 0.245
NP_441077.1_6 Reverse -168 -184 7.04377 0.233
NP_440642.1_10 Forward -330 -316 4.42388 0.255
NP_441763.1_10 Reverse -259 -278 9.93006 0.176
NP_442658.1_1 Forward -281 -271 7.94438 0.199
NP_442658.1_1 Forward -217 -207 7.35439 0.214
NP_442658.1_1 Reverse -268 -278 6.76441 0.214
NP_442658.1_1 Reverse -185 -195 4.7978 0.297
NP_442496.1_5 Reverse -9 -27 4.6407 0.289
NP_442544.1_6 Forward -222 -203 2.75272 0.111
NP_441414.1_9 Forward -279 -260 7.07928 0.0358
NP_441414.1_9 Reverse -270 -289 3.14605 0.0601
NP_441414.1_9 Reverse -206 -225 -6.1954 0.19
NP_442300.1_1 Forward -399 -380 4.916 0.288
NP_442937.1_5 Forward -284 -265 12.9791 0.0966
NP_442937.1_5 Reverse -130 -149 7.47261 0.251
NP_442321.1_1 Forward -74 -55 -6.49039 0.24
NP_441958.1_5 Forward -280 -270 12.2714 0.00183
NP_441958.1_5 Reverse -269 -279 12.2714 0.00183
NP_441958.1_5 Forward -216 -206 0.865012 0.12
NP_441127.1_1 Reverse -14 -28 9.43936 0.275
NP_442836.1_5 Forward -285 -266 1.86774 0.271
NP_442836.1_5 Reverse -264 -283 1.37609 0.287
NP_439905.1_1 Reverse -207 -220 11.229 0.204
NP_439905.1_1 Reverse -271 -284 7.00078 0.269
NP_440995.1_8 Forward -289 -270 1.37609 0.264
NP_440984.1_7 Forward -220 -206 9.34103 0.127
NP_440984.1_7 Forward -284 -270 7.76774 0.163
NP_441097.1_2 Forward -217 -200 14.5918 0.126
NP_439990.1_5 Forward -284 -271 13.4906 0.0942
NP_439990.1_5 Reverse -265 -278 6.70579 0.223
NP_439990.1_5 Forward -149 -136 5.32916 0.298
NP_442911.1_2 Reverse -260 -279 3.93269 0.0406
NP_442911.1_2 Forward -289 -270 -9.53865 0.258
NP_443055.1_6 Reverse -198 -216 1.98502 0.222
NP_443055.1_6 Reverse -127 -145 -2.63651 0.298
NP_440471.1_3 Forward -346 -332 19.2725 0.0708
NP_440602.1_8 Forward -215 -201 16.8142 0.11
NP_440138.1_6 Reverse -136 -155 3.63691 0.241
NP_441099.1_3 Forward -206 -187 2.45773 0.279
NP_441099.1_5 Reverse -260 -279 -1.57384 0.11
NP_441099.1_5 Reverse -196 -215 -10.0303 0.24
NP_441099.1_5 Forward -289 -270 -12.0953 0.294
NP_442002.1_9 Reverse -126 -133 12.2322 0.185
NP_442002.1_9 Forward -216 -209 10.7572 0.185
NP_441938.1_3 Forward -275 -256 12.8808 0.116
NP_442438.1_10 Reverse -265 -279 -0.393733 0.259
NP_441000.1_6 Reverse -205 -219 -3.147 0.221
NP_441000.1_6 Reverse -269 -283 -3.73699 0.225
NP_440147.1_4 Reverse -268 -281 9.75405 0.0371
NP_440147.1_4 Forward -281 -268 8.67241 0.0475
NP_441550.1_8 Forward -281 -271 15.1225 0.0132
NP_441550.1_8 Reverse -268 -278 12.3692 0.0336
NP_441550.1_8 Reverse -204 -214 7.74772 0.149
NP_441550.1_8 Forward -217 -207 7.55106 0.154
NP_441916.1_7 Forward -279 -269 10.3048 0.0261
NP_441916.1_7 Reverse -270 -280 10.3048 0.0261
NP_441916.1_10 Reverse -9 -28 9.63589 0.154
NP_441916.1_10 Reverse -323 -342 3.24438 0.236
NP_441041.1_4 Forward -279 -260 4.32602 0.0588
NP_441041.1_4 Forward -345 -326 -11.7019 0.251
NP_441041.1_7 Forward -218 -206 10.0414 0.103
NP_442396.1_5 Reverse -266 -279 9.16406 0.13
NP_440703.1_9 Reverse -147 -160 7.2952 0.264
NP_441725.1_5 Forward -278 -268 11.2881 0.0247
NP_441725.1_5 Reverse -271 -281 2.04498 0.115
NP_441725.1_5 Forward -214 -204 -0.41329 0.251
NP_439966.1_7 Reverse -268 -278 15.8108 0.0124
NP_439966.1_7 Reverse -204 -214 15.5158 0.0152
NP_439966.1_7 Forward -281 -271 15.3192 0.0152
NP_439966.1_7 Forward -217 -207 8.23937 0.14
NP_439966.1_9 Forward -217 -208 0.884706 0.253
NP_442941.1_3 Forward -278 -268 19.9412 0.00262
NP_442941.1_3 Reverse -271 -281 19.2529 0.00262
NP_442941.1_3 Reverse -207 -217 0.963343 0.16
NP_442941.1_3 Forward -214 -204 0.766681 0.171
NP_440289.1_2 Reverse -267 -280 13.294 0.0132
NP_440289.1_2 Forward -282 -269 3.06754 0.0811
NP_440289.1_2 Forward -218 -205 0.117615 0.175
NP_440289.1_2 Reverse -203 -216 -3.61896 0.267
NP_440983.1_5 Reverse -135 -154 -9.047 0.3
NP_440260.1_8 Forward -210 -192 -4.40575 0.272
NP_440260.1_8 Reverse -365 -383 -4.50408 0.273
NP_442281.1_1 Reverse -265 -279 16.9119 0.00698
NP_442281.1_1 Reverse -201 -215 7.17714 0.106
NP_442281.1_1 Reverse -58 -72 2.65393 0.26
NP_441334.1_6 Forward -368 -349 16.1257 0.264
NP_442256.1_2 Forward -281 -263 -0.964162 0.155
NP_440647.1_9 Forward -217 -199 5.03403 0.23
NP_442012.1_1 Forward -202 -183 13.8641 0.058
NP_440498.1_1 Forward -224 -206 1.49411 0.204
NP_440498.1_1 Reverse -261 -279 0.314141 0.218
NP_441644.1_6 Forward -279 -269 17.3841 0.00127
NP_441644.1_6 Reverse -270 -280 17.3841 0.00127
NP_441644.1_6 Forward -129 -119 7.74772 0.117
NP_441644.1_6 Reverse -206 -216 7.15773 0.133
NP_441644.1_6 Forward -150 -140 5.87944 0.174
NP_441644.1_6 Forward -215 -205 4.01116 0.253
NP_443049.1_6 Forward -216 -206 11.6409 0.24
NP_442215.1_2 Forward -281 -265 2.02515 0.123
NP_442215.1_2 Forward -159 -143 -4.95634 0.242
NP_442215.1_2 Forward -131 -115 -6.52964 0.273
NP_442215.1_2 Reverse -132 -148 -7.41462 0.294
NP_442177.1_5 Forward -205 -191 8.16106 0.286
NP_442029.1_1 Forward -152 -133 -3.44213 0.188
NP_442029.1_5 Forward -280 -261 16.8047 0.217
NP_440253.1_2 Reverse -270 -288 10.3439 0.0401
NP_440253.1_2 Forward -215 -197 5.42735 0.0933
NP_440253.1_2 Forward -279 -261 2.87075 0.128
NP_440929.1_8 Forward -279 -270 19.2726 0.000701
NP_440929.1_8 Reverse -270 -279 19.2726 0.000701
NP_440929.1_8 Reverse -206 -215 7.07956 0.0713
NP_442933.1_10 Forward -279 -270 17.601 0.00325
NP_442933.1_10 Reverse -270 -279 17.601 0.00325
NP_441751.2_8 Forward -278 -264 12.7826 0.0191
NP_441751.2_8 Reverse -207 -221 -2.95034 0.134
NP_441751.2_8 Reverse -271 -285 -4.52363 0.174
NP_441751.2_8 Reverse -136 -150 -5.40861 0.206
NP_442926.1_5 Forward -220 -201 11.6293 0.203
NP_442554.1_8 Reverse -271 -281 16.2046 0.0065
NP_442554.1_8 Forward -278 -268 15.9097 0.00747
NP_442554.1_8 Reverse -207 -217 4.3066 0.189
NP_442554.1_8 Reverse -142 -152 4.3066 0.189
NP_442554.1_8 Forward -214 -204 4.0116 0.2
NP_442554.1_8 Forward -71 -61 2.33998 0.274
NP_441762.1_7 Forward -216 -204 -5.36923 0.203
NP_441762.1_7 Reverse -269 -281 -6.74586 0.284
NP_441762.1_7 Forward -280 -268 -6.84419 0.284
NP_442142.1_4 Reverse -138 -151 15.6533 0.0264
NP_442142.1_4 Reverse -267 -280 14.1783 0.0311
NP_442142.1_4 Reverse -203 -216 10.8351 0.0662
NP_442142.1_4 Forward -282 -269 4.24695 0.227
NP_442142.1_4 Reverse -381 -394 3.95196 0.239
NP_442142.1_4 Forward -218 -205 2.28034 0.295
NP_442292.1_1 Forward -278 -269 18.486 0.00229
NP_442292.1_1 Reverse -271 -280 18.486 0.00229
NP_442292.1_1 Forward -214 -205 -0.0986038 0.239
NP_442292.1_1 Reverse -207 -216 -0.196935 0.239
NP_442292.1_5 Forward -382 -363 -0.885524 0.257
NP_442476.1_6 Reverse -207 -221 2.94952 0.169
NP_442476.1_6 Reverse -271 -285 2.85119 0.171
NP_442476.1_6 Forward -278 -264 0.491246 0.258
NP_440895.1_6 Forward -285 -272 10.049 0.202
NP_442381.1_8 Forward -218 -199 -13.7669 0.279
NP_442381.1_8 Reverse -267 -286 -14.7502 0.284
NP_443009.1_5 Reverse -269 -280 8.90795 0.0965
NP_443009.1_5 Forward -280 -269 8.90795 0.0965
NP_443009.1_5 Reverse -186 -197 7.43299 0.129
NP_441715.1_4 Reverse -271 -281 17.3846 0.0106
NP_441715.1_4 Forward -278 -268 14.828 0.0268
NP_441715.1_4 Reverse -207 -217 9.02648 0.105
NP_441715.1_4 Reverse -385 -395 6.56821 0.138
NP_440015.1_9 Reverse -270 -288 -1.45582 0.283
NP_441448.1_1 Forward -116 -97 7.57094 0.221
NP_440183.1_1 Forward -278 -259 14.7491 0.239
NP_440183.1_9 Reverse -143 -162 -12.6852 0.26
NP_441468.1_1 Forward -278 -271 15.8704 0.0124
NP_441468.1_1 Reverse -271 -278 15.8704 0.0124
NP_441468.1_1 Forward -214 -207 6.13563 0.209
NP_441468.1_1 Reverse -207 -214 6.0373 0.223
NP_441673.1_1 Forward -279 -270 20.8459 0.000698
NP_441673.1_1 Reverse -270 -279 20.8459 0.000698
NP_441673.1_1 Forward -215 -206 1.37636 0.114
NP_441673.1_1 Reverse -206 -215 1.1797 0.163
NP_441826.1_2 Reverse -264 -278 10.7177 0.0451
NP_441826.1_2 Forward -150 -136 0.786239 0.172
NP_441826.1_2 Forward -221 -207 -4.7203 0.299
NP_441637.1_9 Forward -326 -308 -0.865831 0.292
NP_442868.1_6 Forward -281 -271 19.2529 0.00563
NP_442868.1_6 Reverse -268 -278 9.91146 0.038
NP_442868.1_6 Forward -217 -207 0.57002 0.217
NP_442868.1_6 Reverse -204 -214 -0.216628 0.273
NP_442719.1_2 Forward -55 -37 -10.8963 0.284
NP_441056.1_1 Forward -279 -260 -7.08038 0.271
NP_441612.1_2 Reverse -270 -280 8.54929 0.21
NP_441612.1_2 Forward -279 -269 8.54929 0.21
NP_443058.1_7 Forward -280 -261 2.55606 0.287
NP_442427.1_8 Forward -288 -269 12.0942 0.152
NP_442427.1_8 Reverse -261 -280 11.5042 0.152
NP_441911.1_10 Reverse -2 -21 9.90869 0.226
NP_442808.1_1 Reverse -205 -215 9.616 0.0481
NP_442808.1_1 Reverse -269 -279 8.63269 0.0481
NP_442808.1_1 Forward -280 -270 8.63269 0.0481
NP_442775.1_6 Forward -278 -259 14.1591 0.268
NP_440145.1_3 Forward -289 -270 -3.04881 0.185
NP_442542.1_2 Forward -217 -204 15.4572 0.0832
NP_442542.1_2 Forward -281 -268 9.75405 0.131
NP_442542.1_9 Forward -222 -208 10.422 0.116
NP_442050.1_5 Reverse -268 -278 16.4991 0.00812
NP_442050.1_5 Forward -281 -271 14.3359 0.0206
NP_442050.1_5 Reverse -204 -214 13.3526 0.0369
NP_441114.1_3 Forward -70 -61 7.66954 0.231
NP_440558.1_2 Forward -153 -134 -0.295539 0.2
NP_441518.1_3 Reverse -260 -279 -15.2418 0.288
NP_441878.1_6 Forward -280 -270 10.4031 0.0176
NP_441878.1_6 Reverse -269 -279 10.4031 0.0176
NP_441878.1_6 Forward -73 -63 0.766681 0.134
NP_441878.1_6 Reverse -62 -72 0.57002 0.14
NP_441878.1_6 Reverse -119 -129 -7.88644 0.278
NP_441036.1_8 Forward -280 -270 8.33817 0.174
NP_441036.1_8 Reverse -269 -279 8.33817 0.174
NP_441036.1_8 Forward -216 -206 6.8632 0.213
NP_441557.1_5 Forward -279 -270 19.9609 0.000699
NP_441557.1_5 Reverse -270 -279 19.9609 0.000699
NP_441557.1_5 Forward -215 -206 1.08137 0.0794
NP_441557.1_5 Reverse -206 -215 0.589713 0.134
NP_441445.1_1 Forward -159 -140 9.14423 0.11
NP_441445.1_1 Forward -288 -269 8.75091 0.116
NP_441445.1_1 Reverse -261 -280 0.294447 0.278
NP_441445.1_1 Reverse -111 -130 -0.4922 0.294
NP_441445.1_8 Forward -70 -51 -5.40875 0.277
NP_442066.2_9 Forward -283 -270 10.639 0.154
NP_442066.2_9 Reverse -266 -279 9.06573 0.181
NP_440101.1_3 Forward -220 -201 6.09597 0.185
NP_442183.1_1 Forward -279 -265 19.8624 0.0054
NP_442397.1_1 Forward -56 -42 14.5009 0.291
NP_440414.1_8 Reverse -211 -230 9.53756 0.237
NP_442170.1_5 Forward -215 -196 0.196116 0.224
NP_442347.1_2 Forward -278 -269 12.4878 0.056
NP_442347.1_2 Reverse -271 -280 12.4878 0.056
NP_442347.1_2 Reverse -207 -216 8.94785 0.0718
NP_442645.1_2 Reverse -262 -281 -14.3569 0.173
NP_442594.1_7 Reverse -259 -278 7.96345 0.187
NP_440690.1_5 Forward -265 -246 15.6341 0.206
NP_441633.1_3 Forward -281 -268 3.36254 0.0699
NP_441633.1_3 Reverse -268 -281 -5.97891 0.236
NP_440136.1_2 Forward -278 -271 15.9687 0.0123
NP_440136.1_2 Reverse -271 -278 15.9687 0.0123
NP_440136.1_2 Forward -214 -207 6.23397 0.171
NP_440136.1_2 Reverse -207 -214 6.13563 0.193
NP_442590.1_10 Forward -162 -143 3.14605 0.295
NP_442998.1_5 Forward -379 -369 8.92815 0.26
NP_442998.1_5 Reverse -167 -177 8.04317 0.274
NP_442998.1_10 Forward -277 -270 15.5754 0.0102
NP_442998.1_10 Reverse -272 -279 15.5754 0.0102
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_440899.1_8 Forward -29 -10 -9.53865 0.264
NP_440299.1_1 Forward -283 -270 11.0318 0.0529
NP_440299.1_1 Reverse -59 -72 4.54195 0.207
NP_440299.1_1 Reverse -266 -279 4.34528 0.209
NP_441799.1_1 Reverse -266 -280 12.2903 0.0441
NP_441799.1_1 Forward -283 -269 11.307 0.0591
NP_441799.1_1 Reverse -202 -216 5.60385 0.201
NP_441007.1_10 Reverse -265 -278 9.95071 0.0804
NP_441449.1_8 Reverse -256 -275 17.5675 0.188
NP_441449.1_10 Reverse -200 -218 18.407 0.164
NP_440256.1_1 Reverse -267 -286 3.04771 0.0575
NP_440256.1_1 Forward -282 -263 -7.96535 0.248
NP_443042.1_3 Forward -95 -77 21.4553 0.0471
NP_441559.1_8 Reverse -379 -393 4.52282 0.117
NP_441559.1_8 Forward -398 -384 0.392915 0.167
NP_441559.1_8 Forward -284 -270 -5.80194 0.27
NP_441559.1_8 Reverse -232 -246 -7.57189 0.295
NP_442860.1_9 Reverse -189 -202 19.3898 0.159
NP_440915.1_6 Forward -219 -205 1.27789 0.142
NP_440915.1_6 Forward -283 -269 0.786239 0.153
NP_442158.1_4 Forward -267 -257 12.4681 0.252
NP_441179.1_9 Reverse -139 -149 8.92768 0.284
NP_441704.1_8 Forward -290 -271 5.30853 0.297
NP_442069.1_6 Reverse -141 -160 10.3242 0.139
NP_442866.1_1 Forward -220 -201 -5.31042 0.24
NP_442866.1_6 Forward -217 -198 17.2074 0.136
NP_440748.1_5 Forward -126 -107 0.786102 0.242
NP_441939.1_3 Reverse -207 -226 10.8159 0.12
NP_441494.1_6 Forward -261 -248 7.39411 0.262
NP_442993.1_1 Reverse -362 -378 0.156866 0.0653
NP_442993.1_1 Forward -215 -199 -7.11963 0.146
NP_442993.1_1 Forward -279 -263 -9.38124 0.185
NP_442386.1_9 Reverse -269 -278 13.8639 0.0289
NP_442386.1_9 Forward -280 -271 13.8639 0.0289
NP_442386.1_9 Reverse -205 -214 11.9957 0.0754
NP_442386.1_9 Forward -216 -207 5.9975 0.23
NP_440570.1_5 Forward -217 -198 -0.885524 0.265
NP_441750.1_4 Forward -219 -200 1.47442 0.28
NP_441340.1_5 Forward -278 -271 15.6737 0.0124
NP_441340.1_5 Reverse -271 -278 15.6737 0.0124
NP_441340.1_5 Forward -214 -207 13.5105 0.0314
NP_441340.1_5 Reverse -207 -214 5.84064 0.208
NP_440327.1_6 Forward -212 -193 2.94938 0.285
NP_440586.1_1 Forward -400 -381 -2.55715 0.254
NP_440586.1_8 Forward -278 -271 13.2151 0.026
NP_440586.1_8 Reverse -271 -278 13.2151 0.026
NP_440586.1_8 Reverse -207 -214 9.47853 0.146
NP_440586.1_8 Forward -149 -142 5.8403 0.283
NP_440586.1_8 Reverse -64 -71 5.8403 0.283
NP_440586.1_8 Forward -214 -207 5.74197 0.283
NP_442251.1_6 Forward -278 -271 15.2804 0.0124
NP_442251.1_6 Reverse -271 -278 15.2804 0.0124
NP_440192.1_4 Forward -258 -239 12.2112 0.184
NP_442959.1_4 Forward -165 -146 5.50599 0.25
NP_440684.1_9 Reverse -264 -278 9.83269 0.216
NP_441262.1_3 Reverse -270 -277 14.7888 0.0223
NP_441262.1_3 Forward -279 -272 14.7888 0.0223
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_440027.1_3 Reverse -141 -159 3.26332 0.275
NP_443051.1_1 Reverse -269 -278 10.4228 0.00754
NP_443051.1_1 Forward -280 -271 10.4228 0.00754
NP_443051.1_1 Forward -216 -207 7.47288 0.0571
NP_439937.1_9 Forward -257 -240 -12.3515 0.271
NP_439937.1_9 Reverse -269 -286 -14.7114 0.287
NP_439937.1_9 Reverse -247 -264 -17.0714 0.291
NP_440439.1_1 Forward -218 -205 -0.177378 0.209
NP_439943.1_1 Reverse -357 -376 -3.3438 0.202
NP_440372.1_2 Forward -278 -271 16.3621 0.0124
NP_440372.1_2 Reverse -271 -278 16.3621 0.0124
NP_440372.1_2 Forward -214 -207 13.8055 0.0214
NP_440372.1_2 Reverse -207 -214 6.52896 0.188
NP_440574.1_3 Forward -220 -201 2.75272 0.173
NP_441181.1_6 Forward -392 -374 4.9357 0.239
NP_441789.1_7 Forward -123 -104 -2.55791 0.257
NP_440316.1_10 Forward -216 -206 11.1898 0.214
NP_439977.1_5 Forward -285 -266 -1.57384 0.256
NP_440139.1_1 Forward -285 -266 2.55527 0.229
NP_441572.1_1 Reverse -360 -379 1.96607 0.212
NP_442384.1_10 Reverse -270 -283 12.2123 0.0296
NP_442384.1_10 Forward -279 -266 8.18076 0.0685
NP_442384.1_10 Reverse -206 -219 5.23083 0.134
NP_442384.1_10 Forward -72 -59 3.46087 0.19
NP_442114.1_4 Reverse -206 -217 8.4168 0.197
NP_441877.1_7 Reverse -130 -149 0.686995 0.255
NP_442790.1_4 Forward -288 -269 -11.0136 0.22
NP_442790.1_4 Forward -224 -205 -11.8986 0.237
NP_442262.1_10 Forward -278 -271 14.1988 0.0123
NP_442262.1_10 Reverse -271 -278 14.1988 0.0123
NP_442262.1_10 Reverse -207 -214 13.2155 0.0213
NP_441689.1_5 Reverse -268 -278 15.3192 0.0403
NP_441689.1_5 Reverse -204 -214 5.97777 0.197
NP_441689.1_5 Forward -281 -271 5.78111 0.197
NP_440163.1_10 Reverse -267 -277 11.3864 0.169
NP_440344.1_10 Forward -286 -269 -6.451 0.113
NP_440344.1_10 Reverse -263 -280 -7.43431 0.117
NP_440531.1_6 Reverse -262 -281 -1.67217 0.237
NP_440562.1_10 Reverse -126 -144 15.9488 0.123
NP_440562.1_10 Forward -138 -120 5.23069 0.298
NP_441965.1_10 Forward -282 -266 9.00665 0.123
NP_441965.1_10 Reverse -203 -219 7.33503 0.15
NP_441640.1_8 Forward -214 -195 -4.6221 0.266
NP_440838.1_5 Reverse -220 -239 12.9791 0.271
NP_440297.1_9 Forward -278 -268 9.32148 0.0917
NP_440297.1_9 Reverse -271 -281 -0.118297 0.282
NP_440297.1_9 Forward -71 -61 -0.118297 0.282
NP_440999.1_2 Reverse -332 -351 12.1925 0.198
NP_440999.1_9 Reverse -266 -280 1.27789 0.168
NP_440999.1_9 Forward -219 -205 -2.55701 0.27
NP_440888.1_2 Reverse -270 -284 16.1252 0.00789
NP_440888.1_2 Forward -279 -265 14.4536 0.0176
NP_440888.1_2 Reverse -206 -220 9.34041 0.13
NP_440600.1_4 Forward -287 -269 0.21581 0.142
NP_442147.1_6 Reverse -204 -218 16.2235 0.205
NP_441748.1_4 Forward -121 -102 18.9773 0.298
NP_441543.1_2 Forward -278 -269 16.9127 0.00359
NP_441543.1_2 Reverse -271 -280 16.9127 0.00359
NP_441543.1_2 Reverse -207 -216 8.65285 0.0968
NP_442845.1_2 Reverse -264 -278 6.09611 0.217
NP_441304.1_10 Reverse -13 -22 13.8644 0.23
NP_441469.1_8 Forward -280 -271 6.48957 0.227
NP_441469.1_8 Reverse -269 -278 6.48957 0.227
NP_441469.1_8 Forward -216 -207 6.39124 0.227
NP_443064.1_6 Forward -279 -269 12.5669 0.0796
NP_443064.1_6 Reverse -270 -280 12.5669 0.0796
NP_443064.1_6 Reverse -135 -145 11.9852 0.107
NP_442337.1_6 Forward -151 -132 19.4993 0.0936
NP_442337.1_8 Forward -161 -142 4.62101 0.21
NP_442578.1_7 Forward -278 -271 14.5921 0.026
NP_442578.1_7 Reverse -271 -278 14.5921 0.026
NP_442578.1_7 Forward -214 -207 6.0373 0.18
NP_441462.1_2 Forward -279 -269 11.5831 0.00406
NP_441462.1_2 Reverse -270 -280 11.5831 0.00406
NP_441462.1_2 Forward -215 -205 7.55152 0.0543
NP_443062.1_1 Forward -279 -261 14.2013 0.051
NP_443062.1_1 Reverse -206 -224 7.96088 0.163
NP_443062.1_1 Reverse -270 -288 4.54812 0.258
NP_443062.1_6 Reverse -262 -281 13.2741 0.0914
NP_442204.1_1 Forward -219 -208 1.7303 0.266
NP_442204.1_1 Reverse -59 -70 -0.0396598 0.285
NP_442204.1_1 Forward -148 -137 -0.432984 0.299
NP_440516.1_8 Forward -215 -206 18.9776 0.00442
NP_440516.1_8 Forward -279 -270 16.9127 0.00442
NP_440516.1_8 Reverse -270 -279 16.9127 0.00442
NP_440516.1_8 Reverse -206 -215 5.01461 0.118
NP_442428.1_5 Forward -278 -271 15.8704 0.0124
NP_442428.1_5 Reverse -271 -278 15.8704 0.0124
NP_442428.1_5 Forward -214 -207 6.13563 0.209
NP_442428.1_5 Reverse -207 -214 6.0373 0.212
NP_441867.1_2 Reverse -7 -26 -13.9635 0.277
NP_440673.1_3 Forward -277 -270 12.4288 0.0426
NP_440673.1_3 Reverse -272 -279 12.4288 0.0426
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_441052.1_2 Forward -279 -269 19.9412 0.00106
NP_441052.1_2 Reverse -270 -280 19.9412 0.00106
NP_441052.1_2 Forward -144 -134 4.69992 0.149
NP_441052.1_2 Reverse -141 -151 4.60159 0.154
NP_441052.1_2 Reverse -206 -216 1.25834 0.249
NP_441052.1_2 Forward -215 -205 0.668351 0.256
NP_442219.1_9 Forward -278 -269 17.7976 0.00718
NP_442219.1_9 Reverse -271 -280 17.7976 0.00718
NP_442219.1_9 Forward -214 -205 8.65285 0.0681
NP_440436.1_4 Forward -278 -269 17.2072 0.00233
NP_440436.1_4 Reverse -271 -280 17.2072 0.00233
NP_440436.1_4 Reverse -207 -216 8.55409 0.0997
NP_440314.1_9 Reverse -271 -290 -9.53865 0.269
NP_441719.1_4 Forward -278 -271 16.3621 0.0124
NP_441719.1_4 Reverse -271 -278 16.3621 0.0124
NP_441719.1_4 Forward -214 -207 6.82395 0.0855
NP_441719.1_4 Reverse -207 -214 6.52896 0.188
NP_441719.1_6 Reverse -196 -215 12.29 0.269
NP_441004.1_1 Forward -399 -380 -17.0118 0.288
NP_441004.1_4 Reverse -360 -370 12.3697 0.245
NP_442813.1_4 Forward -275 -256 -9.047 0.299
NP_442366.1_3 Forward -216 -198 -2.0458 0.219
NP_442366.1_5 Reverse -102 -112 10.796 0.233
NP_440296.1_7 Forward -318 -299 16.1249 0.23
NP_442206.1_10 Forward -279 -264 5.48643 0.178
NP_443054.1_2 Reverse -197 -211 5.40779 0.236
NP_443054.1_2 Forward -281 -267 1.08123 0.251
NP_442430.1_10 Forward -225 -206 14.7483 0.139
NP_442586.1_1 Forward -393 -374 8.65258 0.197
NP_441851.1_10 Forward -280 -270 15.8113 0.00552
NP_441851.1_10 Reverse -269 -279 15.8113 0.00552
NP_441555.1_1 Forward -314 -295 19.0748 0.0944
NP_442856.1_7 Forward -224 -205 -2.95047 0.239
NP_442515.1_1 Reverse -269 -283 19.0758 0.0192
NP_442515.1_1 Forward -280 -266 10.7177 0.0469
NP_441982.1_6 Reverse -165 -174 11.3395 0.288
NP_440463.1_8 Forward -124 -105 6.82221 0.269
NP_441046.1_2 Reverse -259 -278 4.22769 0.229
NP_441349.1_10 Forward -289 -270 2.3594 0.075
NP_441349.1_10 Forward -154 -135 -2.16383 0.114
NP_441349.1_10 Reverse -260 -279 -9.24366 0.287
NP_441409.1_6 Reverse -264 -283 -6.98204 0.14
NP_441409.1_6 Forward -285 -266 -8.45701 0.168
NP_441394.1_2 Forward -395 -376 17.5024 0.251
NP_440432.1_9 Forward -278 -263 -3.36336 0.179
NP_440432.1_9 Reverse -271 -286 -3.36336 0.179
NP_440431.1_3 Reverse -269 -288 -4.03212 0.178
NP_442450.1_5 Reverse -268 -278 9.32148 0.115
NP_440588.1_2 Forward -224 -205 0.294447 0.148
NP_440588.1_5 Reverse -50 -64 15.5779 0.215
NP_440195.1_4 Reverse -258 -277 20.4523 0.0315
NP_442006.1_2 Reverse -23 -40 -16.6774 0.261
NP_441570.1_1 Forward -279 -261 2.18243 0.0259
NP_441570.1_1 Forward -215 -197 -10.4039 0.17
NP_441078.1_4 Forward -279 -270 19.6659 0.0007
NP_441078.1_4 Reverse -270 -279 19.6659 0.0007
NP_441078.1_4 Forward -215 -206 0.196389 0.205
NP_441078.1_4 Reverse -206 -215 -0.000272808 0.205
NP_442729.1_5 Forward -151 -141 17.6796 0.0748
NP_442729.1_5 Reverse -62 -72 8.4365 0.248
NP_442729.1_8 Reverse -266 -279 9.75405 0.125
NP_441663.1_8 Forward -221 -202 2.75272 0.199
NP_442348.1_2 Forward -196 -187 15.7327 0.119
NP_440526.1_3 Forward -278 -267 10.1862 0.0646
NP_440526.1_3 Reverse -271 -282 1.04151 0.267
NP_441432.1_8 Reverse -269 -278 16.8143 0.00595
NP_441432.1_8 Forward -280 -271 16.8143 0.00595
NP_441432.1_8 Forward -216 -207 5.50626 0.151
NP_441432.1_8 Reverse -134 -143 4.91628 0.196
NP_441432.1_8 Reverse -361 -370 3.34298 0.248
NP_441432.1_8 Reverse -16 -25 2.55633 0.298
NP_443024.1_3 Reverse -14 -24 17.4829 0.251
NP_442320.1_8 Forward -285 -271 6.19444 0.029
NP_442320.1_8 Reverse -264 -278 3.14618 0.0674
NP_442344.1_7 Reverse -207 -226 -10.4236 0.3
NP_441732.1_2 Reverse -266 -282 -16.5594 0.174
NP_440760.1_1 Forward -279 -260 -12.1936 0.0915
NP_442274.1_8 Reverse -185 -203 15.3831 0.257
NP_440199.1_10 Reverse -267 -277 16.7946 0.0381
NP_440578.1_10 Forward -293 -274 9.24257 0.286
NP_440913.1_1 Forward -281 -263 13.4905 0.139
NP_442489.1_2 Reverse -259 -278 0.58944 0.297
NP_442489.1_6 Reverse -137 -156 22.0256 0.0973
NP_442489.1_7 Forward -279 -270 20.1576 0.000695
NP_442489.1_7 Reverse -270 -279 20.1576 0.000695
NP_442489.1_7 Forward -215 -206 0.688044 0.152
NP_442489.1_7 Reverse -206 -215 0.688044 0.152
NP_442489.1_7 Forward -144 -135 -1.96689 0.28
NP_442489.1_7 Reverse -135 -144 -2.16355 0.295
NP_440559.1_1 Forward -278 -269 17.4043 0.00658
NP_440559.1_1 Reverse -271 -280 17.4043 0.00658
NP_440559.1_1 Forward -214 -205 6.48957 0.134
NP_441659.2_8 Forward -279 -269 18.1713 0.00133
NP_441659.2_8 Reverse -270 -280 18.1713 0.00133
NP_442913.1_10 Reverse -261 -280 0.687771 0.153
NP_442913.1_10 Reverse -111 -130 -5.60541 0.271
NP_442849.1_1 Reverse -2 -16 8.25939 0.282
NP_442346.1_5 Forward -280 -270 16.6963 0.00248
NP_442346.1_5 Reverse -269 -279 16.6963 0.00248
NP_442346.1_5 Reverse -62 -72 14.1397 0.0164
NP_442346.1_5 Forward -151 -141 4.89658 0.269
NP_442346.1_10 Forward -162 -143 1.67108 0.212
NP_441629.1_1 Reverse -112 -131 8.35759 0.235
NP_442934.1_1 Reverse -65 -84 13.5691 0.229
NP_440459.1_2 Reverse -204 -221 10.4619 0.198
NP_441653.1_2 Forward -226 -207 5.26902 0.248
NP_440010.1_4 Reverse -131 -150 -0.886293 0.265
NP_442603.1_7 Reverse -270 -284 10.1271 0.133
NP_442603.1_7 Forward -279 -265 7.57046 0.202
NP_441833.1_4 Forward -278 -271 15.9687 0.0124
NP_441833.1_4 Reverse -271 -278 15.9687 0.0124
NP_441833.1_4 Reverse -207 -214 6.52896 0.0924
NP_441833.1_4 Forward -214 -207 6.23397 0.163
NP_441329.1_3 Reverse -43 -53 14.5211 0.253
NP_442162.1_9 Forward -278 -271 16.2637 0.0124
NP_442162.1_9 Reverse -271 -278 16.2637 0.0124
NP_442162.1_9 Forward -214 -207 12.9205 0.0282
NP_442162.1_9 Reverse -207 -214 12.9205 0.0282
NP_440671.1_4 Forward -150 -136 15.3392 0.0454
NP_440671.1_4 Reverse -264 -278 8.06273 0.204
NP_440224.1_1 Reverse -195 -214 -1.57384 0.178
NP_440772.1_8 Reverse -135 -154 9.63589 0.253
NP_442140.1_3 Reverse -207 -217 12.1731 0.0637
NP_442140.1_3 Reverse -271 -281 10.3048 0.0902
NP_442140.1_3 Reverse -64 -74 6.96153 0.156
NP_442140.1_3 Forward -278 -268 4.40493 0.243
NP_442723.1_1 Reverse -131 -150 3.24359 0.278
NP_442021.1_3 Forward -207 -188 -4.42544 0.251
NP_442021.1_3 Reverse -356 -375 -5.01543 0.251
NP_440875.1_9 Reverse -208 -218 17.327 0.0126
NP_441813.1_5 Forward -281 -271 18.1713 0.00743
NP_441813.1_5 Reverse -268 -278 15.9097 0.01
NP_441813.1_5 Reverse -204 -214 12.7631 0.0192
NP_441813.1_5 Forward -217 -207 9.7148 0.0241
NP_442254.1_1 Reverse -51 -70 4.916 0.183
NP_440590.1_4 Reverse -271 -284 11.6223 0.019
NP_440590.1_4 Forward -278 -265 -4.40561 0.261
NP_440590.1_4 Reverse -207 -220 -5.88057 0.293
NP_440567.1_1 Forward -278 -264 3.34284 0.145
NP_442497.1_10 Forward -278 -269 10.4228 0.0087
NP_442497.1_10 Reverse -271 -280 10.4228 0.0087
NP_442497.1_10 Reverse -207 -216 0.589713 0.153
NP_440821.1_4 Reverse -268 -278 18.2696 0.00448
NP_440821.1_4 Forward -281 -271 9.41981 0.0286
NP_440821.1_4 Reverse -204 -214 6.07655 0.1
NP_440821.1_4 Forward -217 -207 0.471689 0.174
NP_441239.1_9 Reverse -204 -216 5.34885 0.223
NP_441239.1_9 Forward -281 -269 5.25052 0.223
NP_441239.1_9 Reverse -268 -280 4.36554 0.253
NP_441239.1_9 Forward -74 -62 3.57889 0.283
NP_442691.1_2 Reverse -190 -209 5.211 0.247
NP_441892.1_1 Reverse -54 -71 0.333834 0.17
NP_441892.1_1 Reverse -132 -149 -4.38605 0.26
NP_440863.1_1 Reverse -165 -179 13.1279 0.263
NP_440900.1_1 Reverse -214 -233 7.17762 0.296
NP_442138.1_10 Reverse -362 -381 -4.72043 0.263
NP_442138.1_10 Forward -144 -125 -7.76869 0.291
NP_442052.1_8 Forward -74 -64 14.238 0.253
NP_442809.1_1 Forward -24 -5 9.24175 0.299
NP_440546.1_4 Forward -215 -205 12.1791 0.0679
NP_440546.1_4 Reverse -63 -73 10.2399 0.109
NP_440546.1_4 Forward -279 -269 10.046 0.109
NP_440546.1_4 Reverse -270 -280 10.046 0.109
NP_440546.1_4 Forward -150 -140 6.94336 0.269
NP_440546.1_4 Reverse -206 -216 6.55553 0.291
NP_441603.1_8 Reverse -260 -279 18.6815 0.108
NP_440462.1_6 Forward -281 -271 9.61647 0.0429
NP_440462.1_6 Reverse -268 -278 7.74818 0.0699
NP_440462.1_6 Forward -217 -207 7.74818 0.0699
NP_440462.1_6 Reverse -204 -214 3.81494 0.228
NP_440868.1_4 Forward -219 -207 17.0502 0.0124
NP_440868.1_4 Reverse -266 -278 8.20045 0.0602
NP_440868.1_4 Forward -283 -271 7.70879 0.0648
NP_441204.1_1 Reverse -126 -145 5.11266 0.296
NP_441474.1_1 Forward -124 -105 7.07848 0.212
NP_442402.1_4 Forward -183 -164 -1.67294 0.194
NP_441848.1_7 Reverse -245 -264 -0.0996487 0.235
NP_442039.1_4 Forward -278 -271 15.1821 0.0124
NP_442039.1_4 Reverse -271 -278 15.1821 0.0124
NP_442039.1_4 Forward -214 -207 11.6422 0.0747
NP_442829.1_2 Reverse -309 -325 9.97713 0.287
NP_441926.1_3 Reverse -362 -378 3.79511 0.208
NP_440825.1_6 Forward -65 -46 8.75091 0.285
NP_442837.1_3 Forward -278 -271 15.7721 0.0124
NP_442837.1_3 Reverse -271 -278 15.7721 0.0124
NP_442837.1_3 Forward -214 -207 6.0373 0.25
NP_442837.1_3 Reverse -207 -214 6.0373 0.25
NP_440160.1_2 Reverse -51 -70 -9.047 0.293
NP_440160.1_3 Forward -233 -214 7.57013 0.284
NP_442053.1_1 Forward -279 -270 18.3876 0.0007
NP_442053.1_1 Reverse -270 -279 18.3876 0.0007
NP_442053.1_1 Reverse -206 -215 14.4544 0.0114
NP_442053.1_1 Forward -215 -206 7.86621 0.0863
NP_440505.1_3 Forward -281 -271 18.3679 0.00213
NP_440505.1_3 Reverse -268 -278 16.303 0.00696
NP_440505.1_3 Forward -217 -207 14.3364 0.0224
NP_442255.1_5 Forward -56 -37 10.5209 0.227
NP_440914.1_1 Forward -279 -269 17.5935 0.000537
NP_440914.1_1 Reverse -270 -280 17.5935 0.000537
NP_440914.1_1 Forward -215 -205 12.1284 0.0654
NP_440914.1_1 Reverse -187 -197 10.9573 0.116
NP_441011.1_8 Forward -278 -269 8.25953 0.144
NP_441011.1_8 Reverse -271 -280 8.25953 0.144
NP_441011.1_8 Reverse -363 -372 8.06287 0.16
NP_441011.1_8 Reverse -207 -216 7.07956 0.179
NP_442533.1_1 Forward -212 -193 -7.96535 0.201
NP_442533.1_6 Forward -279 -270 17.2076 0.00137
NP_442533.1_6 Reverse -270 -279 17.2076 0.00137
NP_442533.1_6 Forward -129 -120 9.34117 0.0634
NP_442533.1_6 Reverse -63 -72 4.62128 0.179
NP_442533.1_6 Reverse -206 -215 4.42462 0.179
NP_442541.1_10 Forward -26 -12 7.86545 0.225
NP_440263.1_3 Forward -214 -195 6.68596 0.243
NP_442232.1_3 Forward -264 -245 -13.8652 0.283
NP_443016.1_1 Forward -135 -116 -5.50708 0.247
NP_441482.1_7 Reverse -264 -278 -1.47537 0.0721
NP_441482.1_7 Reverse -57 -71 -11.4068 0.262
NP_441482.1_7 Forward -285 -271 -12.2918 0.292
NP_439944.1_9 Forward -278 -268 19.0562 0.00329
NP_439944.1_9 Reverse -271 -281 10.5014 0.0887
NP_442202.1_6 Reverse -17 -36 1.57275 0.265
NP_440116.1_8 Forward -214 -195 6.09597 0.0602
NP_440116.1_8 Forward -278 -259 0.491109 0.0975
NP_441527.1_4 Reverse -172 -191 -10.6478 0.272
NP_440115.1_6 Forward -218 -208 7.64985 0.146
NP_440115.1_6 Forward -282 -272 6.76487 0.167
NP_440007.1_9 Reverse -266 -280 7.07942 0.213
NP_440007.1_9 Forward -219 -205 4.12949 0.267
NP_441972.1_5 Reverse -136 -155 -9.047 0.278
NP_441106.1_1 Forward -280 -271 9.63616 0.0311
NP_441106.1_1 Reverse -269 -278 9.63616 0.0311
NP_441106.1_1 Forward -216 -207 8.45619 0.0548
NP_439903.1_6 Forward -282 -263 2.6536 0.222
NP_439903.1_6 Forward -374 -355 -0.00131823 0.275
NP_439903.1_6 Reverse -261 -280 -0.197979 0.277
NP_441286.1_1 Forward -280 -268 21.3768 0.00196
NP_441286.1_1 Reverse -269 -281 12.9203 0.00815
NP_441286.1_1 Forward -216 -204 1.41561 0.0865
NP_441286.1_1 Forward -151 -139 -1.73098 0.145
NP_442674.1_1 Reverse -14 -33 15.9978 0.159
NP_440670.1_8 Forward -279 -270 18.3876 0.000699
NP_440670.1_8 Reverse -270 -279 18.3876 0.000699
NP_440670.1_8 Forward -215 -206 8.75118 0.0606
NP_440670.1_8 Reverse -206 -215 6.19458 0.124
NP_440886.1_7 Forward -280 -270 7.94438 0.0805
NP_440886.1_7 Reverse -269 -279 7.94438 0.0805
NP_440886.1_7 Forward -216 -206 6.86274 0.113
NP_440886.1_7 Reverse -205 -215 6.66608 0.115
NP_440886.1_7 Reverse -383 -393 4.7978 0.218
NP_442614.1_2 Forward -215 -201 6.78443 0.285
NP_442614.1_2 Forward -279 -265 6.6861 0.287
NP_442614.1_2 Reverse -3 -17 6.19444 0.291
NP_442072.1_9 Forward -280 -262 -12.7639 0.091
NP_439899.1_9 Reverse -350 -369 18.9033 0.199
NP_441808.1_6 Forward -184 -165 9.43841 0.279
NP_442022.1_4 Forward -396 -377 12.7825 0.171
NP_440907.2_8 Reverse -207 -217 6.17443 0.178
NP_440664.1_9 Reverse -172 -191 10.8159 0.226
NP_442264.1_2 Forward -283 -266 4.95539 0.288
NP_441021.1_1 Forward -278 -259 -7.96535 0.192
NP_440841.1_4 Reverse -268 -287 13.2741 0.0415
NP_441463.1_3 Reverse -260 -279 -0.295539 0.132
NP_441463.1_3 Forward -289 -270 -0.885524 0.134
NP_441463.1_3 Reverse -196 -215 -8.35868 0.268
NP_441463.1_6 Reverse -268 -282 8.0587 0.25
NP_441626.1_2 Forward -278 -271 15.7721 0.0124
NP_441626.1_2 Reverse -271 -278 15.7721 0.0124
NP_441626.1_2 Forward -214 -207 12.2322 0.0511
NP_441626.1_2 Reverse -207 -214 5.93897 0.231
NP_441589.1_5 Forward -119 -100 17.0481 0.262
NP_442794.1_1 Forward -283 -271 7.4138 0.138
NP_441401.1_4 Reverse -311 -324 15.0639 0.202
NP_442615.1_1 Forward -288 -270 -4.30741 0.183
NP_441962.1_4 Forward -284 -265 -11.7019 0.244
NP_441962.1_9 Reverse -200 -219 5.89931 0.258
NP_440387.1_1 Forward -279 -263 11.3666 0.017
NP_441431.1_2 Forward -218 -204 6.0955 0.28
NP_441836.1_2 Forward -285 -266 -5.60541 0.284
NP_441193.1_6 Forward -149 -130 0.982764 0.285
NP_441993.1_1 Forward -150 -131 3.40855 0.235
NP_441993.1_1 Reverse -135 -154 2.04414 0.265
NP_441174.1_1 Forward -392 -377 10.3046 0.296
NP_440358.1_1 Reverse -46 -60 16.8142 0.298
NP_440814.1_4 Reverse -261 -280 -11.3086 0.224
NP_440114.1_10 Forward -279 -265 9.5377 0.169
NP_440114.1_10 Forward -215 -201 7.86607 0.223
NP_441858.1_3 Forward -228 -209 20.2548 0.0795
NP_442437.1_3 Forward -126 -107 11.7 0.193
NP_442437.1_3 Reverse -137 -156 9.24175 0.295
NP_440492.1_10 Forward -40 -26 19.9791 0.196
NP_441510.2_7 Reverse -264 -278 12.782 0.28
NP_441500.1_1 Forward -353 -335 18.8004 0.199
NP_441500.1_2 Forward -203 -184 20.8456 0.188
NP_441500.1_6 Forward -299 -281 19.4887 0.164
NP_439998.1_6 Forward -134 -115 16.5182 0.19
NP_439910.1_2 Reverse -262 -279 -4.18939 0.0692
NP_439910.1_2 Reverse -198 -215 -22.0856 0.207
NP_439910.1_2 Forward -287 -270 -22.3806 0.232
NP_440457.1_1 Forward -219 -207 2.79224 0.205
NP_440457.1_1 Reverse -266 -278 -0.0593532 0.25
NP_440457.1_1 Forward -283 -271 -0.649339 0.271
NP_440798.1_6 Reverse -207 -220 2.96921 0.158
NP_442297.1_4 Forward -148 -129 11.7516 0.294
NP_441984.1_3 Reverse -52 -70 14.8671 0.124
NP_441984.1_3 Forward -226 -208 7.98396 0.239
NP_441436.1_8 Reverse -269 -288 6.68596 0.297
NP_442509.1_9 Reverse -206 -216 9.71433 0.192
NP_442509.1_9 Forward -279 -269 8.14104 0.192
NP_442509.1_9 Reverse -270 -280 8.14104 0.192
NP_441253.1_1 Reverse -107 -126 7.07928 0.217
NP_442514.1_5 Reverse -139 -158 -7.47443 0.276
NP_440554.1_4 Reverse -207 -217 13.5497 0.0245
NP_440554.1_4 Reverse -271 -281 8.92815 0.0646
NP_440554.1_4 Forward -278 -268 7.05986 0.106
NP_442862.1_3 Forward -176 -159 8.29864 0.243
NP_442862.1_3 Reverse -346 -363 8.29864 0.243
NP_442737.1_5 Forward -274 -255 14.3333 0.199
NP_441885.1_5 Forward -279 -269 20.9245 0.000538
NP_441885.1_5 Reverse -270 -280 20.9245 0.000538
NP_441885.1_5 Forward -215 -205 9.51814 0.0206
NP_442310.1_5 Reverse -150 -169 7.37428 0.283
NP_442341.1_7 Reverse -134 -148 15.3392 0.0229
NP_442341.1_7 Forward -280 -266 14.3559 0.0299
NP_442341.1_9 Forward -217 -203 18.1901 0.0199
NP_442341.1_9 Forward -281 -267 10.5204 0.133
NP_441173.1_9 Reverse -77 -85 11.7204 0.226
NP_442395.2_4 Reverse -134 -153 2.85027 0.214
NP_440423.1_6 Reverse -262 -281 -16.9135 0.232
NP_443000.1_7 Forward -281 -271 19.9412 0.00223
NP_443000.1_7 Reverse -268 -278 17.0896 0.00865
NP_443000.1_7 Forward -217 -207 1.84832 0.228
NP_440552.1_8 Reverse -158 -175 11.9886 0.235
NP_443059.1_10 Reverse -256 -275 4.62021 0.198
NP_441561.1_4 Forward -224 -205 5.50599 0.265
NP_440275.1_3 Forward -281 -271 15.123 0.0182
NP_440275.1_3 Forward -217 -207 12.8614 0.0299
NP_440275.1_3 Reverse -268 -278 8.1415 0.0602
NP_442932.1_9 Reverse -11 -30 12.4875 0.175
NP_440091.1_1 Reverse -266 -278 8.88877 0.0567
NP_440091.1_1 Reverse -202 -214 0.137309 0.265
NP_440091.1_1 Forward -283 -271 -0.452677 0.273
NP_441902.1_3 Forward -262 -252 12.1071 0.274
NP_440679.1_10 Forward -400 -381 -20.65 0.286
NP_439962.1_4 Reverse -376 -395 5.211 0.176
NP_439962.1_4 Forward -309 -290 -6.09707 0.28
NP_440641.1_6 Forward -388 -369 10.4225 0.272
NP_440149.1_8 Forward -279 -260 0.491109 0.136
NP_441105.1_3 Forward -290 -271 1.27776 0.115
NP_441105.1_3 Forward -155 -136 -5.01543 0.211
NP_441105.1_3 Reverse -130 -149 -7.57203 0.255
NP_440216.1_1 Reverse -270 -284 7.07942 0.01
NP_440216.1_1 Reverse -206 -220 5.30946 0.0215
NP_440216.1_1 Forward -279 -265 -9.73518 0.145
NP_440216.1_1 Forward -215 -201 -11.5051 0.192
NP_440216.1_9 Reverse -143 -152 5.89959 0.289
NP_440172.1_1 Forward -279 -269 15.0247 0.00945
NP_440172.1_1 Reverse -270 -280 15.0247 0.00945
NP_440172.1_1 Forward -215 -205 6.27322 0.107
NP_442015.1_10 Forward -283 -270 2.77255 0.187
NP_442015.1_10 Reverse -266 -279 0.510939 0.224
NP_441226.1_7 Forward -278 -271 14.4934 0.0123
NP_441226.1_7 Reverse -271 -278 14.4934 0.0123
NP_441226.1_7 Forward -214 -207 12.7234 0.0312
NP_441226.1_7 Reverse -207 -214 11.5435 0.0757
NP_442834.1_9 Forward -152 -133 3.6377 0.298
NP_441111.1_7 Forward -278 -270 18.7023 0.00294
NP_441111.1_7 Reverse -271 -279 18.7023 0.00294
NP_441111.1_7 Reverse -207 -215 8.86921 0.0589
NP_442379.1_10 Reverse -263 -280 -3.40274 0.259
NP_441766.1_2 Forward -279 -270 17.5026 0.00297
NP_441766.1_2 Reverse -270 -279 17.5026 0.00297
NP_441766.1_2 Reverse -206 -215 14.7494 0.00772
NP_441766.1_9 Forward -223 -204 4.12936 0.205
NP_442417.1_5 Reverse -206 -220 6.19444 0.231
NP_440416.1_1 Reverse -270 -289 -13.9635 0.284
NP_440416.1_9 Reverse -199 -218 -17.6018 0.243
NP_440416.1_9 Reverse -367 -386 -19.5684 0.276
NP_443052.1_9 Reverse -377 -396 -0.000545616 0.203
NP_443052.1_9 Reverse -380 -399 -7.27704 0.295
NP_442116.1_6 Reverse -236 -253 5.39969 0.299
NP_440845.1_1 Forward -216 -197 -4.81876 0.233
NP_442403.1_8 Forward -277 -258 4.12936 0.226
NP_442403.1_8 Forward -213 -194 0.884433 0.241
NP_442154.1_1 Forward -395 -377 -13.8455 0.217
NP_440261.1_5 Reverse -207 -220 6.4108 0.0368
NP_440261.1_5 Reverse -271 -284 -4.50394 0.151
NP_440261.1_5 Forward -278 -265 -10.5021 0.201
NP_440988.1_10 Reverse -139 -153 9.44903 0.204
NP_440988.1_10 Reverse -268 -282 7.51277 0.216
NP_440988.1_10 Reverse -204 -218 4.89883 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGTTGCCGGTAATTGCGGGGGAGGAAAAAACCGTTAGCCAAATCTGGTACTACTCACTGTTGGTGGTGCCTTTCAGTTTGCTGCTAGTTTATCCTCTGCACCAGTTGGGCATACTTTATCTGGCGATCGCCATTATTTTGGGGGGACAATTTCTGGTCAAAGCTTGGCAACTCAAACAGGCTCCCGGCGATCGGGATTTGGCTAGGGGATTGTTCAAGTTCTCCATTTTTTACCTAATGTTGCTCTGCCTGGCCATGGTGATTGACAGTTTGCCCGTCACCCATCAGTTGGTGGCCCAAATGGGAACTTTACTGTTGGGTTAAAGTTGAACCATGGCCCAGGTTTGGTTTTTCTCAAAGCTCCACTGACTTATTTGCCAATTCCTCCTTCCTTTCCTCCC

CDS

ATGTGTCTAGCCCTACCTGGCCAGGTTGTCAGTTTAATGCCCAACTCCGATCCCCTGTTACTGACGGGAAAGGTTAGCTTTGGGGGCATCATTAAAACCATTAGCCTTGCCTACGTACCCGAGGTTAAGGTGGGGGATTACGTGATTGTCCATGTGGGCTTTGCCATTAGCATTGTGGACGAAGAGGCGGCCCAGGAAACTTTGATAGACTTGGCAGAAATGGGAGTTTAA

Protein

MCLALPGQVVSLMPNSDPLLLTGKVSFGGIIKTISLAYVPEVKVGDYVIVHVGFAISIVDEEAAQETLIDLAEMGV