Your browser is old and dusty. Try Google Chrome!

Details for ssl3573

ORF ssl3573
Accession NP_441505.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -131 -145 12.0943 0.222
NP_441061.1_2 Reverse -300 -314 13.3726 0.0405
NP_441061.1_2 Reverse -132 -146 1.27789 0.192
NP_441061.1_2 Reverse -171 -185 -1.08205 0.249
NP_440795.1_7 Forward -307 -300 14.6904 0.0123
NP_440795.1_7 Reverse -300 -307 14.6904 0.0123
NP_440795.1_7 Forward -139 -132 14.6904 0.0123
NP_440795.1_7 Reverse -132 -139 14.6904 0.0123
NP_440795.1_7 Forward -205 -198 10.2655 0.154
NP_441418.1_6 Reverse -299 -318 6.78429 0.00677
NP_441418.1_6 Reverse -131 -150 -12.1936 0.0614
NP_441418.1_6 Forward -308 -289 -29.2048 0.219
NP_441418.1_6 Reverse -365 -384 -29.3032 0.221
NP_441418.1_6 Forward -320 -301 -30.1882 0.262
NP_441418.1_6 Forward -317 -298 -30.5815 0.286
NP_441418.1_6 Reverse -353 -372 -30.7781 0.296
NP_440897.1_6 Forward -308 -289 -1.27961 0.187
NP_440897.1_6 Reverse -308 -327 -1.96793 0.2
NP_441453.1_4 Reverse -299 -307 16.539 0.00633
NP_441453.1_4 Reverse -131 -139 16.539 0.00633
NP_441453.1_4 Forward -308 -300 16.539 0.00633
NP_441453.1_4 Forward -140 -132 16.539 0.00633
NP_441453.1_4 Reverse -197 -205 4.14932 0.264
NP_441623.1_1 Reverse -346 -364 -2.14413 0.241
NP_442151.1_6 Reverse -131 -145 12.4876 0.0722
NP_442151.1_6 Forward -140 -126 8.65272 0.167
NP_442151.1_6 Forward -308 -294 6.78443 0.221
NP_441818.1_6 Forward -315 -301 10.9143 0.253
NP_441818.1_9 Reverse -150 -169 -2.0655 0.201
NP_440226.1_1 Forward -308 -289 12.8808 0.0399
NP_440226.1_1 Reverse -299 -318 11.7008 0.0509
NP_440226.1_1 Reverse -131 -150 8.84924 0.0817
NP_441630.1_3 Reverse -123 -142 0.196116 0.283
NP_442623.1_3 Reverse -132 -151 -18.5851 0.263
NP_440150.1_2 Reverse -207 -226 4.52188 0.281
NP_440150.1_6 Reverse -296 -315 0.687771 0.296
NP_442655.1_1 Reverse -126 -145 12.4875 0.0847
NP_442173.1_1 Forward -307 -299 15.4574 0.00633
NP_442173.1_1 Forward -139 -131 15.4574 0.00633
NP_442173.1_1 Reverse -300 -308 15.4574 0.00633
NP_442173.1_1 Reverse -132 -140 15.4574 0.00633
NP_442173.1_1 Forward -132 -124 6.01761 0.2
NP_442173.1_1 Forward -205 -197 4.73931 0.258
NP_442752.1_4 Forward -308 -301 13.8055 0.0199
NP_442752.1_4 Reverse -299 -306 13.8055 0.0199
NP_442752.1_4 Forward -140 -133 13.8055 0.0199
NP_442752.1_4 Reverse -131 -138 13.8055 0.0199
NP_443027.1_4 Reverse -297 -307 16.2046 0.0437
NP_443027.1_4 Forward -310 -300 13.943 0.0452
NP_443027.1_4 Forward -142 -132 13.943 0.0452
NP_443027.1_4 Reverse -129 -139 5.87989 0.294
NP_441812.1_3 Forward -309 -295 7.9644 0.254
NP_442975.1_10 Forward -144 -130 13.1753 0.0459
NP_442975.1_10 Forward -312 -298 12.0937 0.0477
NP_442975.1_10 Reverse -127 -141 11.602 0.0497
NP_441675.1_4 Forward -275 -256 5.89931 0.236
NP_440784.1_7 Forward -307 -300 15.9687 0.0123
NP_440784.1_7 Reverse -300 -307 15.9687 0.0123
NP_440784.1_7 Forward -139 -132 15.9687 0.0123
NP_440784.1_7 Reverse -132 -139 15.9687 0.0123
NP_441250.1_8 Reverse -88 -97 19.4688 0.274
NP_440061.1_9 Reverse -297 -311 12.0937 0.102
NP_440110.1_4 Reverse -288 -307 2.45773 0.253
NP_441054.1_2 Reverse -345 -364 17.404 0.109
NP_441476.1_5 Forward -157 -138 -4.32711 0.25
NP_441476.1_5 Reverse -138 -157 -7.4737 0.29
NP_439979.1_9 Forward -184 -166 13.7855 0.227
NP_440878.1_9 Forward -150 -131 0.196116 0.196
NP_442062.1_8 Reverse -299 -309 19.4496 0.000558
NP_442062.1_8 Forward -140 -130 19.4496 0.000558
NP_442062.1_8 Reverse -131 -141 19.4496 0.000558
NP_442062.1_8 Forward -308 -298 10.3048 0.0493
NP_442062.1_8 Reverse -197 -207 3.81494 0.252
NP_442826.1_10 Reverse -140 -159 20.8447 0.11
NP_440761.1_4 Forward -190 -171 -13.6686 0.257
NP_440761.1_4 Forward -313 -294 -13.8652 0.257
NP_441995.1_8 Reverse -60 -77 13.4119 0.276
NP_441859.1_3 Reverse -298 -317 18.1898 0.0348
NP_441859.1_3 Reverse -130 -149 13.0766 0.0834
NP_441859.1_3 Forward -321 -302 3.73524 0.236
NP_441802.1_1 Forward -128 -109 5.211 0.286
NP_440304.1_4 Reverse -297 -307 19.9412 0.00364
NP_440304.1_4 Forward -310 -300 9.91146 0.051
NP_440304.1_4 Forward -142 -132 9.91146 0.051
NP_440304.1_4 Reverse -129 -139 1.84832 0.299
NP_442242.1_4 Forward -307 -300 14.3954 0.0124
NP_442242.1_4 Reverse -300 -307 14.3954 0.0124
NP_442242.1_4 Forward -139 -132 14.3954 0.0124
NP_442242.1_4 Reverse -132 -139 14.3954 0.0124
NP_440044.1_8 Reverse -300 -319 7.96426 0.0798
NP_440044.1_8 Reverse -132 -151 6.88262 0.0876
NP_440044.1_8 Forward -139 -120 2.16274 0.155
NP_441781.1_7 Forward -185 -166 1.76941 0.22
NP_439918.1_3 Forward -311 -292 20.8456 0.0457
NP_439923.1_4 Forward -256 -237 10.5209 0.234
NP_441208.1_9 Reverse -296 -310 8.25939 0.219
NP_441208.1_9 Forward -188 -174 8.25939 0.219
NP_441208.1_9 Forward -311 -297 7.9644 0.219
NP_441208.1_9 Forward -222 -208 7.27608 0.223
NP_441208.1_9 Forward -299 -285 6.98109 0.229
NP_441208.1_9 Reverse -128 -142 5.89945 0.259
NP_441594.1_6 Forward -149 -130 4.52268 0.219
NP_441594.1_6 Reverse -302 -321 3.14605 0.236
NP_441594.1_6 Forward -317 -298 -0.39387 0.299
NP_442276.1_6 Forward -155 -141 21.8284 0.0675
NP_440132.1_1 Forward -310 -292 11.4255 0.207
NP_442110.1_7 Reverse -131 -145 10.226 0.0684
NP_442110.1_7 Forward -308 -294 2.75286 0.222
NP_441925.1_4 Reverse -172 -191 -15.3409 0.263
NP_441925.1_4 Reverse -166 -185 -16.4225 0.282
NP_440856.1_4 Reverse -292 -311 8.45592 0.0597
NP_441083.1_5 Forward -140 -130 11.3864 0.0159
NP_441083.1_5 Reverse -299 -309 11.3864 0.0159
NP_441083.1_5 Reverse -131 -141 11.3864 0.0159
NP_441083.1_5 Forward -308 -298 11.2881 0.0159
NP_441083.1_5 Forward -133 -123 5.68323 0.11
NP_442827.1_8 Forward -316 -297 0.0970122 0.215
NP_441434.1_7 Forward -138 -124 9.2427 0.209
NP_441738.1_2 Forward -306 -299 15.28 0.0102
NP_441738.1_2 Reverse -301 -308 15.28 0.0102
NP_441738.1_2 Forward -138 -131 15.28 0.0102
NP_441738.1_2 Reverse -133 -140 15.28 0.0102
NP_441558.1_5 Forward -142 -123 5.01433 0.265
NP_440209.1_1 Reverse -299 -307 18.1123 0.00295
NP_440209.1_1 Reverse -131 -139 18.1123 0.00295
NP_440209.1_1 Forward -308 -300 18.1123 0.00295
NP_440209.1_1 Forward -140 -132 18.1123 0.00295
NP_442889.1_1 Forward -185 -166 -14.2585 0.272
NP_442889.1_8 Forward -143 -129 12.8803 0.0599
NP_442889.1_8 Reverse -128 -142 3.44058 0.278
NP_440447.1_1 Reverse -294 -312 2.57575 0.278
NP_440447.1_5 Forward -356 -346 11.4848 0.291
NP_440056.1_9 Forward -301 -282 14.0678 0.272
NP_441713.1_1 Forward -314 -295 -3.04881 0.113
NP_441713.1_1 Reverse -293 -312 -14.2585 0.257
NP_441713.1_1 Forward -146 -127 -15.9302 0.275
NP_442675.1_4 Forward -319 -301 -3.91409 0.257
NP_440178.1_7 Forward -141 -122 -22.2233 0.258
NP_440178.1_7 Reverse -130 -149 -22.5183 0.267
NP_440659.1_8 Forward -256 -237 13.5691 0.221
NP_441716.1_1 Forward -308 -294 13.2743 0.0689
NP_441716.1_1 Forward -245 -231 2.94952 0.284
NP_442111.1_4 Forward -309 -295 9.43936 0.0609
NP_442111.1_4 Reverse -298 -312 7.17775 0.103
NP_442111.1_4 Reverse -130 -144 3.44117 0.244
NP_440906.1_5 Forward -307 -300 15.8704 0.0124
NP_440906.1_5 Reverse -300 -307 15.8704 0.0124
NP_440906.1_5 Forward -139 -132 15.8704 0.0124
NP_440906.1_5 Reverse -132 -139 15.8704 0.0124
NP_441924.1_9 Forward -159 -140 15.6332 0.26
NP_440747.1_10 Reverse -296 -308 7.80712 0.00223
NP_440747.1_10 Reverse -128 -140 5.44718 0.0137
NP_440747.1_10 Forward -311 -299 -2.02597 0.0196
NP_440747.1_10 Forward -143 -131 -2.02597 0.0196
NP_441130.1_10 Reverse -297 -311 11.6026 0.106
NP_441130.1_10 Reverse -129 -143 11.6026 0.106
NP_441130.1_10 Forward -142 -128 11.3077 0.107
NP_441130.1_10 Forward -53 -39 5.80112 0.214
NP_441854.1_10 Forward -187 -168 2.45773 0.282
NP_441486.1_1 Forward -143 -129 12.9793 0.00973
NP_441486.1_1 Reverse -128 -142 12.291 0.0126
NP_441486.1_1 Forward -311 -297 3.24451 0.0638
NP_441486.1_1 Reverse -296 -310 -4.81863 0.209
NP_441486.1_1 Forward -136 -122 -6.19526 0.283
NP_441880.2_10 Reverse -132 -150 15.3588 0.111
NP_441880.2_10 Reverse -300 -318 7.98396 0.284
NP_442634.1_2 Reverse -293 -312 7.86593 0.174
NP_442634.1_4 Forward -310 -296 15.6342 0.0115
NP_442634.1_4 Forward -187 -173 11.8976 0.0467
NP_442634.1_4 Reverse -297 -311 -3.54032 0.161
NP_441265.1_3 Reverse -293 -307 6.09611 0.181
NP_441265.1_3 Forward -146 -132 1.67122 0.2
NP_440403.1_4 Forward -317 -298 -8.752 0.26
NP_440403.1_10 Reverse -299 -318 4.32602 0.262
NP_442848.1_1 Forward -314 -300 -2.45868 0.263
NP_442848.1_1 Forward -146 -132 -3.24533 0.263
NP_442848.1_5 Forward -174 -156 2.18243 0.276
NP_443018.1_3 Forward -307 -300 14.8871 0.0123
NP_443018.1_3 Reverse -300 -307 14.8871 0.0123
NP_443018.1_3 Forward -139 -132 14.8871 0.0123
NP_443018.1_3 Reverse -132 -139 14.8871 0.0123
NP_443018.1_3 Forward -205 -198 4.36568 0.254
NP_443018.1_3 Reverse -198 -205 4.07068 0.299
NP_441316.1_7 Reverse -297 -312 4.89645 0.121
NP_441316.1_7 Forward -310 -295 4.01147 0.137
NP_441634.1_1 Reverse -112 -131 5.11266 0.222
NP_441634.1_8 Reverse -297 -311 12.9793 0.0465
NP_441634.1_8 Reverse -129 -143 5.40779 0.114
NP_441634.1_8 Forward -319 -305 -3.73699 0.295
NP_441634.1_8 Forward -190 -176 -4.13031 0.295
NP_441634.1_8 Forward -142 -128 -4.22864 0.295
NP_440376.1_1 Forward -308 -299 19.4693 0.000692
NP_440376.1_1 Reverse -299 -308 19.4693 0.000692
NP_440376.1_1 Forward -140 -131 19.4693 0.000692
NP_440376.1_1 Reverse -131 -140 19.4693 0.000692
NP_440376.1_1 Forward -133 -124 2.458 0.221
NP_440376.1_1 Forward -347 -338 1.37636 0.252
NP_441857.1_5 Forward -147 -129 7.78729 0.185
NP_441588.1_4 Forward -138 -128 16.4996 0.0369
NP_441588.1_4 Reverse -133 -143 6.96153 0.178
NP_442687.1_7 Forward -309 -299 15.8113 0.0125
NP_442687.1_7 Forward -141 -131 15.8113 0.0125
NP_442687.1_7 Reverse -130 -140 15.8113 0.0125
NP_442687.1_7 Reverse -298 -308 9.02648 0.0994
NP_442687.1_7 Reverse -123 -133 6.56821 0.159
NP_442191.1_4 Forward -307 -293 15.5501 0.0585
NP_440066.1_5 Reverse -346 -365 9.83173 0.251
NP_440066.1_5 Forward -324 -305 9.14342 0.256
NP_442485.1_3 Reverse -297 -316 0.294447 0.247
NP_442485.1_3 Forward -319 -300 -5.50708 0.291
NP_442530.1_2 Reverse -217 -227 16.008 0.203
NP_441013.1_2 Forward -322 -304 -1.25915 0.282
NP_442483.1_6 Reverse -37 -56 12.88 0.271
NP_440667.1_2 Forward -206 -187 3.34271 0.189
NP_440667.1_9 Reverse -338 -357 15.3391 0.248
NP_441950.1_7 Reverse -153 -172 -7.27704 0.278
NP_441763.1_9 Forward -161 -142 9.53756 0.191
NP_441763.1_10 Forward -151 -132 5.60352 0.284
NP_440360.1_10 Reverse -301 -315 6.58777 0.227
NP_442658.1_1 Forward -310 -300 18.7607 0.00222
NP_442658.1_1 Forward -142 -132 18.7607 0.00222
NP_442658.1_1 Reverse -129 -139 15.9091 0.00966
NP_442658.1_1 Reverse -297 -307 13.0576 0.04
NP_442658.1_1 Forward -208 -198 6.0761 0.238
NP_442198.1_3 Forward -329 -310 2.16274 0.3
NP_442198.1_7 Forward -311 -292 21.5331 0.055
NP_442161.1_7 Reverse -247 -266 3.73603 0.26
NP_442782.1_2 Forward -308 -294 4.22782 0.256
NP_442782.1_7 Forward -148 -129 -0.4922 0.272
NP_442205.1_9 Forward -314 -298 -1.51476 0.264
NP_440656.1_8 Reverse -120 -139 -7.76869 0.264
NP_440656.1_8 Forward -319 -300 -9.24366 0.28
NP_441414.1_9 Forward -308 -289 1.17943 0.0759
NP_441414.1_9 Reverse -299 -318 -6.29373 0.192
NP_441414.1_9 Forward -347 -328 -8.06369 0.229
NP_441414.1_9 Forward -140 -121 -10.6203 0.29
NP_440607.1_8 Reverse -363 -382 1.47442 0.264
NP_441487.1_6 Reverse -291 -310 0.0977854 0.259
NP_441487.1_9 Forward -141 -122 12.0942 0.0617
NP_441487.1_9 Reverse -235 -254 0.687771 0.219
NP_441958.1_5 Reverse -298 -308 21.2195 0.000805
NP_441958.1_5 Forward -309 -299 12.2714 0.00183
NP_441958.1_5 Forward -141 -131 12.2714 0.00183
NP_441958.1_5 Reverse -130 -140 12.2714 0.00183
NP_441958.1_5 Reverse -123 -133 -1.29827 0.236
NP_442836.1_5 Forward -146 -127 5.99764 0.185
NP_442836.1_10 Forward -261 -251 16.4996 0.208
NP_440203.1_5 Forward -305 -295 11.2876 0.2
NP_439905.1_1 Reverse -300 -313 12.5073 0.194
NP_439905.1_1 Reverse -171 -184 7.09911 0.268
NP_440984.1_7 Reverse -126 -140 15.3392 0.0563
NP_440984.1_7 Forward -313 -299 12.8809 0.121
NP_440984.1_7 Forward -145 -131 10.6193 0.122
NP_440984.1_7 Forward -247 -233 4.71948 0.292
NP_439990.1_5 Reverse -294 -307 8.08242 0.181
NP_439990.1_6 Reverse -201 -220 9.83255 0.197
NP_442690.1_1 Forward -30 -11 -15.8318 0.28
NP_442911.1_2 Reverse -289 -308 15.9291 0.0103
NP_442911.1_2 Forward -318 -299 6.58763 0.0283
NP_442911.1_2 Forward -150 -131 6.58763 0.0283
NP_441580.1_6 Forward -151 -132 14.8474 0.0472
NP_440153.1_5 Reverse -132 -146 3.93283 0.199
NP_440153.1_5 Reverse -300 -314 2.35953 0.225
NP_442536.1_8 Forward -314 -295 12.5858 0.253
NP_443055.1_6 Reverse -123 -141 10.0481 0.131
NP_443055.1_6 Forward -140 -122 3.8533 0.192
NP_440993.1_2 Reverse -294 -310 11.8583 0.0789
NP_440993.1_2 Forward -145 -129 4.77842 0.249
NP_440993.1_2 Reverse -126 -142 3.59845 0.256
NP_440993.1_3 Reverse -289 -308 5.50519 0.151
NP_440827.1_8 Reverse -247 -265 10.2456 0.264
NP_440850.1_6 Forward -311 -292 17.7974 0.0753
NP_441099.1_5 Forward -150 -131 -8.26035 0.191
NP_441099.1_5 Reverse -92 -111 -10.7186 0.261
NP_442002.1_9 Forward -309 -302 10.7572 0.185
NP_442002.1_9 Forward -141 -134 10.7572 0.185
NP_442002.1_9 Reverse -130 -137 10.7572 0.185
NP_440809.1_9 Reverse -290 -308 1.78911 0.12
NP_440809.1_9 Forward -317 -299 -7.15901 0.225
NP_441294.1_7 Reverse -127 -141 10.9784 0.161
NP_441646.1_1 Reverse -163 -182 1.17943 0.235
NP_441646.1_1 Forward -315 -296 -0.295539 0.26
NP_442438.1_10 Forward -145 -131 17.7975 0.0179
NP_442438.1_10 Forward -313 -299 4.81781 0.142
NP_442438.1_10 Reverse -294 -308 4.42448 0.147
NP_442438.1_10 Reverse -279 -293 2.5562 0.173
NP_442438.1_10 Reverse -126 -140 1.96621 0.188
NP_442431.1_10 Reverse -147 -165 -0.7675 0.294
NP_441000.1_6 Forward -141 -127 13.3726 0.0396
NP_441000.1_6 Reverse -130 -144 4.81781 0.0933
NP_441000.1_6 Reverse -298 -312 -4.03198 0.225
NP_441000.1_6 Forward -309 -295 -5.11362 0.261
NP_441000.1_6 Forward -52 -38 -5.70361 0.29
NP_442771.1_1 Forward -310 -292 -3.81576 0.166
NP_440147.1_4 Reverse -129 -142 20.7671 0.00185
NP_440147.1_4 Reverse -297 -310 11.819 0.0326
NP_440147.1_4 Forward -310 -297 2.77255 0.202
NP_440147.1_4 Forward -142 -129 2.18257 0.209
NP_440147.1_4 Reverse -195 -208 0.707601 0.247
NP_441550.1_8 Reverse -297 -307 13.0576 0.0273
NP_441550.1_8 Forward -310 -300 10.501 0.066
NP_441550.1_8 Forward -142 -132 10.501 0.066
NP_441550.1_8 Reverse -129 -139 8.3377 0.124
NP_441550.1_8 Reverse -122 -132 5.87944 0.224
NP_441916.1_7 Forward -308 -298 18.9579 0.00144
NP_441916.1_7 Reverse -299 -309 18.4663 0.00144
NP_441916.1_7 Forward -140 -130 18.4663 0.00144
NP_441916.1_7 Reverse -131 -141 18.4663 0.00144
NP_441916.1_7 Reverse -197 -207 5.78156 0.12
NP_441916.1_7 Forward -206 -196 5.38824 0.134
NP_440465.1_10 Reverse -296 -315 -0.295539 0.29
NP_440465.1_10 Forward -291 -272 -1.18052 0.29
NP_441041.1_1 Reverse -347 -366 10.2259 0.211
NP_441041.1_4 Forward -132 -113 -4.22878 0.132
NP_441041.1_4 Forward -308 -289 -8.94866 0.209
NP_441041.1_4 Forward -185 -166 -10.227 0.228
NP_441041.1_4 Reverse -131 -150 -10.9153 0.238
NP_441041.1_4 Forward -140 -121 -11.2103 0.242
NP_441041.1_7 Forward -143 -131 19.5648 0.00277
NP_441041.1_7 Reverse -128 -140 18.9817 0.00435
NP_441041.1_7 Forward -311 -299 10.2357 0.1
NP_441041.1_7 Reverse -296 -308 6.34865 0.211
NP_440569.1_6 Forward -129 -110 7.37428 0.228
NP_441547.1_2 Reverse -288 -306 5.52568 0.219
NP_442004.1_6 Forward -308 -294 6.19444 0.181
NP_441725.1_5 Forward -307 -297 11.1898 0.0247
NP_441725.1_5 Reverse -300 -310 9.02648 0.0553
NP_441725.1_5 Reverse -132 -142 9.02648 0.0553
NP_441725.1_5 Forward -139 -129 2.04498 0.115
NP_439966.1_7 Forward -310 -300 17.4824 0.00636
NP_439966.1_7 Forward -142 -132 17.4824 0.00636
NP_439966.1_7 Reverse -297 -307 14.8275 0.0177
NP_439966.1_7 Reverse -129 -139 9.91099 0.0968
NP_439966.1_9 Forward -310 -301 10.7178 0.0863
NP_439966.1_9 Forward -142 -133 10.7178 0.0863
NP_439966.1_9 Reverse -129 -138 0.884706 0.253
NP_440736.1_3 Forward -142 -123 9.24257 0.145
NP_440736.1_3 Reverse -297 -316 1.37609 0.282
NP_442941.1_3 Forward -307 -297 19.9412 0.00262
NP_442941.1_3 Forward -139 -129 2.63497 0.14
NP_442941.1_3 Reverse -300 -310 2.53664 0.14
NP_442941.1_3 Reverse -132 -142 2.53664 0.14
NP_440289.1_2 Forward -143 -130 12.999 0.0132
NP_440289.1_2 Reverse -128 -141 5.91914 0.0605
NP_440289.1_2 Forward -311 -298 3.46087 0.078
NP_440289.1_2 Reverse -296 -309 -2.83231 0.262
NP_440983.1_5 Reverse -302 -321 -2.75381 0.231
NP_440260.1_7 Reverse -150 -169 -4.81876 0.252
NP_440260.1_8 Forward -114 -96 -7.06068 0.295
NP_442281.1_1 Reverse -126 -140 20.7467 0.00192
NP_442281.1_1 Forward -145 -131 17.6985 0.00542
NP_442281.1_1 Forward -313 -299 9.24208 0.0726
NP_441334.1_7 Forward -310 -291 -19.3717 0.275
NP_441334.1_7 Reverse -297 -316 -20.2567 0.275
NP_440437.1_1 Reverse -293 -312 23.7955 0.00694
NP_440437.1_1 Reverse -125 -144 -2.65548 0.22
NP_440437.1_1 Forward -146 -127 -4.32711 0.256
NP_442012.1_1 Forward -146 -127 2.75272 0.194
NP_441087.1_6 Forward -369 -351 -2.14486 0.284
NP_441457.1_7 Reverse -129 -148 -0.983855 0.293
NP_440098.1_1 Forward -138 -119 16.7157 0.0929
NP_440498.1_1 Reverse -122 -140 4.83737 0.114
NP_440498.1_1 Reverse -290 -308 0.314141 0.218
NP_440498.1_1 Forward -317 -299 -3.32411 0.261
NP_442982.1_5 Reverse -289 -308 7.07928 0.135
NP_440375.1_8 Forward -139 -120 0.982764 0.252
NP_443030.1_6 Forward -175 -156 17.3057 0.172
NP_441644.1_6 Forward -308 -298 19.0557 0.000803
NP_441644.1_6 Reverse -299 -309 10.1076 0.0628
NP_441644.1_6 Forward -140 -130 10.1076 0.0628
NP_441644.1_6 Reverse -131 -141 10.1076 0.0628
NP_441644.1_6 Forward -185 -175 4.89613 0.22
NP_441644.1_6 Reverse -176 -186 4.50281 0.235
NP_440867.1_10 Reverse -108 -127 8.84924 0.25
NP_440867.1_10 Forward -141 -122 5.50599 0.271
NP_442215.1_1 Reverse -295 -314 6.4893 0.223
NP_442215.1_2 Reverse -129 -145 10.3833 0.0501
NP_442215.1_2 Forward -142 -126 7.13836 0.0694
NP_442215.1_2 Forward -310 -294 0.845183 0.147
NP_442215.1_2 Forward -135 -119 -1.02311 0.177
NP_442029.1_6 Reverse -270 -289 3.6377 0.28
NP_440253.1_2 Reverse -131 -149 15.0638 0.0173
NP_440253.1_2 Forward -140 -122 11.5239 0.031
NP_440253.1_2 Reverse -299 -317 3.06741 0.123
NP_440253.1_2 Forward -188 -170 -3.02911 0.284
NP_440929.1_8 Forward -308 -299 19.2726 0.000701
NP_440929.1_8 Reverse -299 -308 19.2726 0.000701
NP_440929.1_8 Forward -140 -131 19.2726 0.000701
NP_440929.1_8 Reverse -131 -140 19.2726 0.000701
NP_441346.1_7 Forward -223 -204 17.994 0.122
NP_442933.1_10 Forward -308 -299 17.601 0.00325
NP_442933.1_10 Reverse -299 -308 17.601 0.00325
NP_442933.1_10 Forward -140 -131 17.601 0.00325
NP_442933.1_10 Reverse -131 -140 17.601 0.00325
NP_442933.1_10 Forward -206 -197 5.11294 0.204
NP_441751.2_8 Forward -307 -293 15.8309 0.0113
NP_441751.2_8 Reverse -300 -314 -3.93365 0.157
NP_442926.1_1 Forward -323 -304 -5.21209 0.278
NP_442926.1_3 Forward -319 -300 7.07928 0.193
NP_442554.1_8 Forward -307 -297 16.9913 0.0065
NP_442554.1_8 Reverse -300 -310 16.008 0.0065
NP_442554.1_8 Reverse -132 -142 16.008 0.0065
NP_442554.1_8 Forward -139 -129 13.2547 0.0187
NP_442554.1_8 Reverse -309 -319 2.24165 0.276
NP_442554.1_9 Reverse -146 -165 12.0252 0.298
NP_441762.1_7 Reverse -130 -142 21.5735 0.00342
NP_441762.1_7 Forward -141 -129 19.3118 0.00342
NP_441762.1_7 Reverse -298 -310 12.527 0.0142
NP_441762.1_7 Forward -309 -297 2.20226 0.0676
NP_441762.1_7 Forward -318 -306 -5.76255 0.238
NP_442142.1_4 Reverse -296 -309 17.4232 0.0264
NP_442142.1_4 Forward -143 -130 16.4399 0.0264
NP_442142.1_4 Reverse -128 -141 15.1616 0.0289
NP_442142.1_4 Reverse -305 -318 14.8666 0.0302
NP_442142.1_4 Forward -311 -298 6.60689 0.16
NP_442142.1_4 Forward -320 -307 3.16532 0.265
NP_442142.1_9 Reverse -301 -320 2.94938 0.282
NP_442292.1_1 Forward -307 -298 17.5026 0.00435
NP_442292.1_1 Reverse -300 -309 9.63616 0.0183
NP_442292.1_1 Forward -139 -130 9.63616 0.0183
NP_442292.1_1 Reverse -132 -141 9.63616 0.0183
NP_440919.1_7 Forward -359 -341 10.7533 0.171
NP_440919.1_7 Forward -70 -52 7.95751 0.218
NP_442476.1_6 Reverse -300 -314 14.1593 0.0401
NP_442476.1_6 Reverse -132 -146 7.57108 0.112
NP_442381.1_8 Forward -143 -124 5.89931 0.0616
NP_443009.1_5 Reverse -298 -309 19.626 0.00102
NP_443009.1_5 Reverse -130 -141 11.6612 0.0602
NP_443009.1_5 Forward -141 -130 11.6612 0.0602
NP_443009.1_5 Forward -309 -298 7.82632 0.118
NP_441715.1_4 Forward -307 -297 14.238 0.0295
NP_441715.1_4 Forward -139 -129 9.41981 0.097
NP_441715.1_4 Reverse -300 -310 9.32148 0.097
NP_441715.1_4 Reverse -132 -142 9.32148 0.097
NP_441448.1_2 Reverse -181 -200 -1.08295 0.267
NP_440183.1_9 Reverse -301 -320 -20.4534 0.286
NP_441198.1_8 Reverse -297 -307 13.2713 0.108
NP_440379.1_5 Reverse -299 -318 -1.67217 0.192
NP_440379.1_5 Forward -189 -170 -9.24366 0.262
NP_440379.1_5 Reverse -161 -180 -11.6036 0.299
NP_441468.1_1 Forward -307 -300 15.8704 0.0124
NP_441468.1_1 Reverse -300 -307 15.8704 0.0124
NP_441468.1_1 Forward -139 -132 15.8704 0.0124
NP_441468.1_1 Reverse -132 -139 15.8704 0.0124
NP_441468.1_1 Forward -205 -198 4.46401 0.224
NP_441020.2_6 Forward -142 -125 18.3284 0.0126
NP_441020.2_6 Forward -310 -293 12.9202 0.0824
NP_441020.2_6 Reverse -297 -314 12.2319 0.0995
NP_441020.2_6 Reverse -129 -146 6.52869 0.262
NP_441015.1_10 Forward -190 -171 -5.80207 0.232
NP_441015.1_10 Reverse -303 -322 -11.0136 0.29
NP_441673.1_1 Forward -308 -299 20.8459 0.000698
NP_441673.1_1 Reverse -299 -308 20.8459 0.000698
NP_441673.1_1 Forward -140 -131 20.8459 0.000698
NP_441673.1_1 Reverse -131 -140 20.8459 0.000698
NP_441731.1_1 Forward -83 -65 16.3311 0.258
NP_441876.1_9 Forward -325 -315 11.091 0.28
NP_441826.1_2 Forward -146 -132 13.9626 0.0213
NP_441826.1_2 Forward -323 -309 1.17956 0.161
NP_441826.1_2 Forward -314 -300 -0.197071 0.204
NP_441826.1_2 Reverse -125 -139 -4.22864 0.293
NP_441826.1_2 Reverse -293 -307 -4.4253 0.296
NP_441826.1_5 Reverse -132 -151 7.17762 0.221
NP_441330.1_1 Reverse -192 -211 -4.03212 0.0864
NP_441637.1_9 Forward -27 -9 -2.83245 0.292
NP_442490.1_9 Reverse -299 -318 7.07928 0.14
NP_442490.1_9 Reverse -287 -306 -7.67036 0.278
NP_442868.1_6 Forward -310 -300 8.53483 0.0555
NP_442868.1_6 Forward -142 -132 8.53483 0.0555
NP_442868.1_6 Reverse -297 -307 1.06167 0.205
NP_442868.1_6 Reverse -129 -139 0.865012 0.205
NP_442719.1_2 Reverse -23 -41 -9.81463 0.267
NP_442227.1_2 Reverse -304 -323 -0.787193 0.259
NP_442227.1_2 Reverse -301 -320 -1.96717 0.269
NP_442361.1_3 Reverse -125 -138 8.37742 0.285
NP_442808.1_1 Forward -309 -299 18.4657 0.00201
NP_442808.1_1 Forward -141 -131 18.4657 0.00201
NP_442808.1_1 Reverse -130 -140 18.4657 0.00201
NP_442808.1_1 Reverse -298 -308 8.73102 0.0481
NP_442808.1_1 Reverse -337 -347 5.68278 0.144
NP_442808.1_1 Forward -375 -365 4.10949 0.207
NP_440145.1_3 Reverse -121 -140 -0.885524 0.144
NP_442542.1_2 Forward -310 -297 12.3107 0.114
NP_442542.1_9 Reverse -124 -138 11.1104 0.111
NP_442113.1_10 Reverse -104 -123 -8.65367 0.282
NP_442050.1_5 Reverse -297 -307 18.0724 0.00365
NP_442050.1_5 Forward -310 -300 8.23937 0.234
NP_442050.1_5 Forward -142 -132 8.23937 0.234
NP_442342.1_9 Forward -310 -294 10.1866 0.137
NP_440342.1_1 Reverse -161 -180 18.6823 0.164
NP_440342.1_1 Forward -189 -170 11.1109 0.279
NP_440346.1_6 Forward -279 -269 15.6049 0.203
NP_440558.1_2 Forward -183 -164 5.30933 0.145
NP_440558.1_2 Reverse -290 -309 -1.7705 0.218
NP_440558.1_2 Reverse -167 -186 -3.3438 0.234
NP_441518.1_3 Reverse -121 -140 -12.3902 0.263
NP_441878.1_6 Reverse -298 -308 10.5014 0.0176
NP_441878.1_6 Forward -309 -299 10.4031 0.0176
NP_441878.1_6 Forward -141 -131 10.4031 0.0176
NP_441878.1_6 Reverse -130 -140 10.4031 0.0176
NP_441878.1_6 Forward -186 -176 -7.19813 0.21
NP_441036.1_8 Forward -309 -299 17.7779 0.000554
NP_441036.1_8 Forward -141 -131 17.7779 0.000554
NP_441036.1_8 Reverse -130 -140 17.7779 0.000554
NP_441036.1_8 Reverse -298 -308 15.713 0.00724
NP_441557.1_5 Forward -308 -299 19.9609 0.000699
NP_441557.1_5 Reverse -299 -308 19.9609 0.000699
NP_441557.1_5 Forward -140 -131 19.9609 0.000699
NP_441557.1_5 Reverse -131 -140 19.9609 0.000699
NP_441445.1_1 Reverse -290 -309 5.80098 0.163
NP_441445.1_1 Reverse -156 -175 4.52268 0.193
NP_441445.1_1 Forward -317 -298 3.34271 0.215
NP_442066.2_4 Reverse -131 -150 -2.45882 0.211
NP_442066.2_9 Forward -312 -299 10.934 0.154
NP_442066.2_9 Forward -144 -131 8.37742 0.185
NP_441433.1_8 Reverse -309 -328 -3.93378 0.285
NP_442419.1_2 Forward -322 -303 -2.95047 0.247
NP_441308.1_8 Reverse -297 -307 13.353 0.218
NP_441308.1_8 Forward -310 -300 9.22315 0.226
NP_441308.1_8 Forward -142 -132 9.22315 0.226
NP_440101.1_3 Reverse -303 -322 4.03102 0.224
NP_442183.1_1 Reverse -299 -313 20.0591 0.00507
NP_442183.1_1 Reverse -131 -145 11.406 0.0702
NP_442166.1_7 Forward -307 -293 9.43936 0.191
NP_442397.1_6 Reverse -149 -163 16.2242 0.272
NP_441116.1_9 Reverse -352 -366 14.4542 0.229
NP_440979.1_3 Reverse -300 -318 12.8022 0.234
NP_441574.1_1 Reverse -299 -318 1.67108 0.172
NP_442444.1_1 Reverse -139 -158 20.8627 0.22
NP_441549.1_9 Forward -312 -294 14.2771 0.0304
NP_441549.1_9 Forward -189 -171 2.67408 0.0948
NP_440540.1_8 Reverse -125 -144 9.53756 0.249
NP_442170.1_5 Forward -140 -121 1.57275 0.192
NP_442347.1_2 Reverse -300 -309 11.1111 0.056
NP_442347.1_2 Forward -139 -130 11.1111 0.056
NP_442347.1_2 Reverse -132 -141 11.1111 0.056
NP_442347.1_2 Forward -307 -298 3.34298 0.284
NP_442645.1_2 Forward -148 -129 -20.65 0.288
NP_442645.1_2 Reverse -123 -142 -21.7317 0.29
NP_442888.1_6 Reverse -31 -50 2.3594 0.261
NP_441037.1_4 Forward -310 -300 16.2838 0.0168
NP_441037.1_4 Forward -142 -132 16.2838 0.0168
NP_441037.1_4 Reverse -129 -139 14.7245 0.028
NP_441037.1_4 Reverse -297 -307 7.31769 0.237
NP_442594.1_8 Reverse -350 -369 6.98095 0.215
NP_442594.1_8 Forward -197 -178 2.65439 0.294
NP_441633.1_3 Reverse -129 -142 20.5705 0.00512
NP_441633.1_3 Reverse -297 -310 3.95252 0.0699
NP_441633.1_3 Forward -142 -129 3.65753 0.0699
NP_441633.1_3 Forward -310 -297 -3.91395 0.177
NP_440136.1_2 Forward -307 -300 15.9687 0.0123
NP_440136.1_2 Reverse -300 -307 15.9687 0.0123
NP_440136.1_2 Forward -139 -132 15.9687 0.0123
NP_440136.1_2 Reverse -132 -139 15.9687 0.0123
NP_442590.1_10 Reverse -332 -351 5.60432 0.258
NP_442590.1_10 Forward -185 -166 4.62101 0.273
NP_442590.1_10 Forward -314 -295 3.53937 0.29
NP_442998.1_5 Reverse -61 -71 15.0247 0.149
NP_442998.1_5 Reverse -319 -329 13.0581 0.158
NP_442998.1_10 Forward -306 -299 15.5754 0.0102
NP_442998.1_10 Reverse -301 -308 15.5754 0.0102
NP_442998.1_10 Forward -138 -131 15.5754 0.0102
NP_442998.1_10 Reverse -133 -140 15.5754 0.0102
NP_442998.1_10 Reverse -44 -51 10.2655 0.0946
NP_440299.1_1 Forward -144 -131 11.4251 0.0489
NP_440299.1_1 Reverse -295 -308 9.45847 0.0709
NP_440299.1_1 Forward -312 -299 7.59019 0.109
NP_440299.1_1 Reverse -127 -140 2.28034 0.292
NP_441799.1_1 Reverse -295 -309 16.9119 0.0128
NP_441799.1_1 Forward -312 -298 16.0269 0.0153
NP_441799.1_1 Reverse -127 -141 14.8469 0.0221
NP_441799.1_1 Forward -144 -130 5.01387 0.227
NP_441799.1_1 Reverse -193 -207 4.03056 0.269
NP_441799.1_4 Reverse -171 -190 -5.11376 0.219
NP_441799.1_9 Reverse -298 -317 -2.85214 0.222
NP_442802.1_6 Reverse -298 -317 -0.787193 0.204
NP_441007.1_10 Forward -313 -300 11.4257 0.064
NP_441007.1_10 Forward -145 -132 3.46087 0.182
NP_441007.1_10 Forward -190 -177 1.88757 0.203
NP_442333.2_5 Forward -283 -264 -12.6852 0.249
NP_442333.2_5 Reverse -304 -323 -15.1435 0.289
NP_440256.1_1 Reverse -128 -147 6.39097 0.0301
NP_440256.1_1 Reverse -296 -315 6.19431 0.0314
NP_440256.1_1 Reverse -194 -213 5.40766 0.0364
NP_440256.1_1 Forward -143 -124 -8.94866 0.27
NP_440087.1_1 Forward -317 -298 -4.42544 0.246
NP_440087.1_6 Reverse -351 -370 10.8159 0.114
NP_441512.1_4 Reverse -295 -314 10.6192 0.237
NP_441559.1_8 Reverse -294 -308 8.45605 0.0676
NP_441559.1_8 Forward -77 -63 -5.90027 0.271
NP_441559.1_8 Forward -145 -131 -6.29359 0.276
NP_441559.1_8 Forward -313 -299 -6.98191 0.281
NP_441270.1_5 Reverse -269 -288 14.5557 0.211
NP_440915.1_6 Forward -144 -130 15.9292 0.0183
NP_440915.1_6 Forward -312 -298 6.88276 0.0779
NP_440915.1_6 Reverse -295 -309 1.08123 0.147
NP_440915.1_6 Forward -210 -196 -0.197071 0.186
NP_440915.1_6 Reverse -127 -141 -3.24533 0.292
NP_441179.1_9 Forward -319 -309 10.3043 0.28
NP_440717.1_1 Forward -287 -268 7.27595 0.265
NP_440717.1_1 Reverse -300 -319 7.07928 0.265
NP_442785.1_7 Reverse -297 -311 11.0127 0.228
NP_442866.1_1 Forward -313 -294 4.62101 0.151
NP_441464.1_8 Reverse -299 -313 8.25939 0.2
NP_441464.1_8 Reverse -176 -190 6.6861 0.226
NP_440695.1_5 Reverse -299 -318 4.916 0.186
NP_440188.1_4 Forward -151 -132 7.7676 0.264
NP_441199.1_6 Forward -312 -293 -0.4922 0.272
NP_441494.1_6 Reverse -316 -329 6.1158 0.289
NP_442993.1_1 Forward -140 -124 2.12349 0.0502
NP_442993.1_1 Forward -308 -292 -9.5779 0.188
NP_442993.1_1 Reverse -42 -58 -9.97122 0.201
NP_440677.1_6 Reverse -290 -309 11.3075 0.234
NP_442386.1_9 Reverse -130 -139 15.7322 0.0144
NP_442386.1_9 Forward -309 -300 15.7322 0.0144
NP_442386.1_9 Forward -141 -132 15.7322 0.0144
NP_442386.1_9 Reverse -298 -307 6.39082 0.219
NP_442386.1_9 Forward -207 -198 5.21086 0.262
NP_442386.1_9 Reverse -307 -316 4.62087 0.294
NP_441340.1_5 Forward -307 -300 15.6737 0.0124
NP_441340.1_5 Reverse -300 -307 15.6737 0.0124
NP_441340.1_5 Forward -139 -132 15.6737 0.0124
NP_441340.1_5 Reverse -132 -139 15.6737 0.0124
NP_441340.1_5 Reverse -198 -205 3.97235 0.274
NP_441340.1_9 Forward -33 -23 8.93007 0.256
NP_442484.1_2 Reverse -113 -132 1.57275 0.229
NP_442484.1_2 Forward -151 -132 1.17943 0.238
NP_440168.1_4 Reverse -304 -323 -7.4737 0.283
NP_440168.1_9 Forward -319 -300 2.16274 0.232
NP_440168.1_9 Reverse -242 -261 0.294447 0.273
NP_440161.1_3 Forward -310 -291 18.584 0.0611
NP_441160.1_1 Reverse -345 -364 5.70265 0.179
NP_440211.1_1 Forward -379 -360 14.1583 0.176
NP_440586.1_1 Forward -192 -173 -5.01543 0.28
NP_440586.1_8 Forward -307 -300 13.2151 0.026
NP_440586.1_8 Forward -139 -132 13.2151 0.026
NP_440586.1_8 Reverse -300 -307 13.2151 0.026
NP_440586.1_8 Reverse -132 -139 13.2151 0.026
NP_440586.1_8 Forward -234 -227 9.18354 0.171
NP_442251.1_6 Forward -307 -300 15.2804 0.0124
NP_442251.1_6 Reverse -300 -307 15.2804 0.0124
NP_442251.1_6 Forward -139 -132 15.2804 0.0124
NP_442251.1_6 Reverse -132 -139 15.2804 0.0124
NP_440192.1_4 Forward -75 -56 10.6589 0.237
NP_442959.1_5 Reverse -52 -71 8.16093 0.224
NP_441262.1_3 Reverse -299 -306 14.7888 0.0223
NP_441262.1_3 Reverse -131 -138 14.7888 0.0223
NP_441262.1_3 Forward -308 -301 14.7888 0.0223
NP_441262.1_3 Forward -140 -133 14.7888 0.0223
NP_443051.1_1 Reverse -298 -307 19.5676 0.00335
NP_443051.1_1 Reverse -130 -139 10.4228 0.00754
NP_443051.1_1 Forward -309 -300 10.4228 0.00754
NP_443051.1_1 Forward -141 -132 10.4228 0.00754
NP_439996.1_6 Forward -127 -108 6.45564 0.296
NP_441232.1_7 Reverse -139 -158 21.5339 0.0974
NP_441232.1_10 Forward -319 -300 2.45773 0.247
NP_439984.1_2 Forward -139 -126 12.409 0.252
NP_439937.1_8 Forward -322 -303 -4.13045 0.278
NP_439937.1_8 Reverse -297 -316 -5.60541 0.299
NP_439937.1_9 Reverse -130 -147 8.98622 0.0679
NP_439937.1_9 Reverse -298 -315 -6.255 0.157
NP_439937.1_9 Forward -309 -292 -7.04165 0.157
NP_439937.1_9 Forward -289 -272 -8.8116 0.177
NP_439937.1_9 Reverse -250 -267 -11.1715 0.245
NP_441595.1_5 Reverse -124 -142 7.00065 0.222
NP_440439.1_1 Forward -311 -298 18.8005 0.0105
NP_440439.1_1 Reverse -296 -309 16.2439 0.0128
NP_440439.1_1 Forward -143 -130 9.65572 0.0447
NP_440439.1_1 Reverse -128 -141 1.39592 0.156
NP_442239.1_8 Reverse -140 -159 10.5209 0.242
NP_439943.1_1 Forward -71 -52 -8.85033 0.28
NP_440372.1_2 Forward -307 -300 16.3621 0.0124
NP_440372.1_2 Reverse -300 -307 16.3621 0.0124
NP_440372.1_2 Forward -139 -132 16.3621 0.0124
NP_440372.1_2 Reverse -132 -139 16.3621 0.0124
NP_441789.1_7 Forward -157 -138 -3.14789 0.268
NP_440316.1_10 Reverse -278 -288 8.1415 0.24
NP_440316.1_10 Reverse -344 -354 5.38824 0.299
NP_441803.1_2 Reverse -126 -145 14.5524 0.0425
NP_441803.1_2 Forward -145 -126 6.29264 0.155
NP_441803.1_2 Reverse -135 -154 3.93269 0.185
NP_440139.1_1 Reverse -125 -144 9.34008 0.0996
NP_441572.1_7 Forward -146 -127 6.98095 0.0785
NP_441572.1_7 Forward -314 -295 -5.9004 0.276
NP_440267.1_2 Reverse -294 -308 8.65209 0.162
NP_442384.1_10 Forward -308 -295 14.4739 0.0148
NP_442384.1_10 Reverse -299 -312 9.36073 0.054
NP_442384.1_10 Forward -185 -172 3.16588 0.199
NP_442384.1_10 Reverse -131 -144 2.2809 0.23
NP_442114.1_4 Reverse -299 -310 12.1534 0.107
NP_442114.1_4 Reverse -131 -142 12.1534 0.107
NP_440364.1_6 Forward -309 -296 13.6867 0.275
NP_442790.1_4 Forward -317 -298 0.0977854 0.0927
NP_442790.1_4 Forward -262 -243 -14.4552 0.277
NP_442262.1_10 Forward -307 -300 14.1988 0.0123
NP_442262.1_10 Reverse -300 -307 14.1988 0.0123
NP_442262.1_10 Forward -139 -132 14.1988 0.0123
NP_442262.1_10 Reverse -132 -139 14.1988 0.0123
NP_441689.1_5 Reverse -297 -307 17.8758 0.0158
NP_440163.1_10 Forward -314 -304 9.81313 0.222
NP_440344.1_10 Forward -147 -130 19.8034 0.00187
NP_440344.1_10 Reverse -292 -309 -1.0428 0.0491
NP_440344.1_10 Reverse -124 -141 -1.0428 0.0491
NP_440344.1_10 Forward -315 -298 -1.43612 0.0537
NP_440282.1_10 Forward -318 -299 -7.76869 0.253
NP_442123.1_3 Reverse -299 -318 11.0125 0.263
NP_440487.1_1 Forward -311 -292 -2.26216 0.214
NP_441335.1_8 Reverse -350 -369 9.83255 0.228
NP_441965.1_10 Forward -311 -295 10.0883 0.109
NP_441965.1_10 Forward -143 -127 2.32015 0.288
NP_442102.1_7 Forward -311 -292 12.8808 0.282
NP_440297.1_9 Forward -307 -297 9.22315 0.0917
NP_440297.1_9 Forward -139 -129 -0.118297 0.282
NP_440297.1_9 Reverse -300 -310 -0.216628 0.282
NP_440297.1_9 Reverse -132 -142 -0.216628 0.282
NP_441896.1_3 Forward -149 -130 7.07928 0.0974
NP_441896.1_3 Forward -317 -298 2.65439 0.189
NP_441896.1_3 Reverse -122 -141 -0.000545616 0.231
NP_440990.1_7 Forward -320 -301 6.88262 0.243
NP_440894.1_10 Reverse -126 -145 8.45592 0.176
NP_440894.1_10 Forward -145 -126 8.16093 0.182
NP_441778.1_8 Forward -211 -197 16.7152 0.273
NP_443036.1_1 Forward -214 -195 10.0284 0.267
NP_442067.1_4 Reverse -106 -125 6.39097 0.213
NP_440999.1_9 Forward -312 -298 16.1259 0.0216
NP_440999.1_9 Forward -144 -130 14.6509 0.0277
NP_440999.1_9 Reverse -107 -121 -1.8687 0.252
NP_440999.1_9 Reverse -175 -189 -2.55701 0.27
NP_440888.1_2 Reverse -131 -145 20.9434 0.000502
NP_440888.1_2 Reverse -299 -313 14.3553 0.0187
NP_440888.1_2 Forward -308 -294 14.1586 0.02
NP_440888.1_2 Reverse -197 -211 10.0287 0.107
NP_440888.1_2 Forward -140 -126 9.43874 0.127
NP_440888.1_2 Reverse -338 -352 8.06211 0.172
NP_440888.1_2 Forward -219 -205 5.99717 0.254
NP_440179.1_6 Reverse -300 -319 6.19431 0.22
NP_440491.1_1 Forward -143 -124 11.4001 0.173
NP_440052.1_5 Forward -151 -132 1.57275 0.165
NP_440052.1_5 Forward -217 -198 0.491109 0.175
NP_439969.1_3 Forward -145 -126 5.40766 0.19
NP_442277.1_4 Forward -149 -130 8.4551 0.128
NP_442277.1_4 Forward -317 -298 5.60352 0.175
NP_441949.1_4 Forward -193 -174 8.84924 0.213
NP_441543.1_2 Forward -139 -130 18.486 0.00236
NP_441543.1_2 Reverse -300 -309 18.486 0.00236
NP_441543.1_2 Reverse -132 -141 18.486 0.00236
NP_441543.1_2 Forward -307 -298 15.9293 0.00518
NP_442845.1_2 Forward -185 -171 5.70279 0.225
NP_442845.1_2 Forward -107 -93 5.30946 0.237
NP_442845.1_2 Reverse -293 -307 5.01447 0.247
NP_442845.1_2 Forward -146 -132 3.44117 0.29
NP_440208.1_1 Forward -256 -237 -9.047 0.257
NP_441551.1_5 Forward -312 -296 23.1655 0.00858
NP_441178.1_6 Reverse -334 -353 1.6703 0.279
NP_441319.1_8 Reverse -293 -311 15.9488 0.0739
NP_441469.1_8 Reverse -130 -139 16.126 0.00797
NP_441469.1_8 Forward -309 -300 16.126 0.00797
NP_441469.1_8 Forward -141 -132 16.126 0.00797
NP_441469.1_8 Reverse -307 -316 9.73449 0.227
NP_441469.1_8 Reverse -298 -307 6.5879 0.227
NP_441469.1_8 Forward -207 -198 5.11294 0.289
NP_443064.1_6 Forward -308 -298 10.8217 0.13
NP_442578.1_7 Forward -307 -300 14.5921 0.026
NP_442578.1_7 Forward -139 -132 14.5921 0.026
NP_442578.1_7 Reverse -300 -307 14.5921 0.026
NP_442578.1_7 Reverse -132 -139 14.5921 0.026
NP_441462.1_2 Forward -308 -298 20.2362 0.000805
NP_441462.1_2 Reverse -299 -309 11.5831 0.00406
NP_441462.1_2 Forward -140 -130 11.5831 0.00406
NP_441462.1_2 Reverse -131 -141 11.5831 0.00406
NP_441462.1_2 Reverse -176 -186 -0.806614 0.254
NP_441462.1_2 Forward -133 -123 -1.29827 0.299
NP_441621.1_7 Forward -310 -296 13.9626 0.0266
NP_441621.1_7 Forward -142 -128 6.09611 0.068
NP_441621.1_7 Reverse -129 -143 5.99778 0.068
NP_441621.1_7 Reverse -297 -311 -3.24533 0.188
NP_441621.1_7 Forward -319 -305 -3.34366 0.188
NP_441621.1_7 Reverse -306 -320 -4.7203 0.242
NP_443062.1_1 Forward -308 -290 16.9316 0.0278
NP_443062.1_1 Reverse -131 -149 9.13097 0.14
NP_443062.1_1 Reverse -299 -317 8.2534 0.157
NP_443062.1_1 Forward -206 -188 4.45062 0.26
NP_443062.1_6 Reverse -291 -310 11.7008 0.1
NP_441601.1_4 Reverse -304 -323 2.75272 0.212
NP_440936.1_10 Reverse -73 -92 -4.91826 0.294
NP_442204.1_1 Reverse -295 -306 9.49844 0.0759
NP_442204.1_1 Forward -321 -310 0.845319 0.281
NP_442204.1_5 Forward -150 -131 4.916 0.16
NP_442204.1_5 Reverse -121 -140 3.24438 0.193
NP_442204.1_5 Forward -245 -226 -0.688862 0.296
NP_441560.1_6 Reverse -303 -322 14.0608 0.241
NP_441351.1_8 Forward -142 -123 6.19431 0.202
NP_440516.1_8 Forward -308 -299 16.9127 0.00442
NP_440516.1_8 Reverse -299 -308 16.9127 0.00442
NP_440516.1_8 Forward -140 -131 16.9127 0.00442
NP_440516.1_8 Reverse -131 -140 16.9127 0.00442
NP_440516.1_8 Reverse -124 -133 5.11294 0.118
NP_440516.1_8 Forward -133 -124 5.01461 0.118
NP_441033.1_2 Reverse -121 -140 -8.94866 0.293
NP_442428.1_4 Forward -309 -290 7.27595 0.188
NP_442428.1_5 Forward -307 -300 15.8704 0.0124
NP_442428.1_5 Reverse -300 -307 15.8704 0.0124
NP_442428.1_5 Forward -139 -132 15.8704 0.0124
NP_442428.1_5 Reverse -132 -139 15.8704 0.0124
NP_442428.1_5 Forward -205 -198 4.759 0.223
NP_442428.1_8 Reverse -304 -323 2.16274 0.224
NP_440818.1_6 Reverse -120 -139 7.86593 0.252
NP_441867.1_2 Reverse -344 -363 -14.1602 0.277
NP_440673.1_3 Forward -306 -299 12.4288 0.0426
NP_440673.1_3 Forward -138 -131 12.4288 0.0426
NP_440673.1_3 Reverse -301 -308 12.4288 0.0426
NP_440673.1_3 Reverse -133 -140 12.4288 0.0426
NP_440673.1_7 Forward -151 -132 2.75272 0.221
NP_441052.1_2 Reverse -299 -309 10.5014 0.0285
NP_441052.1_2 Forward -140 -130 10.5014 0.0285
NP_441052.1_2 Reverse -131 -141 10.5014 0.0285
NP_441052.1_2 Forward -308 -298 10.4031 0.0285
NP_441052.1_2 Reverse -308 -318 1.84832 0.225
NP_442219.1_8 Forward -298 -279 6.52434 0.294
NP_442219.1_9 Reverse -300 -309 8.35786 0.0681
NP_442219.1_9 Forward -139 -130 8.35786 0.0681
NP_442219.1_9 Reverse -132 -141 8.35786 0.0681
NP_442219.1_9 Forward -307 -298 8.25953 0.0681
NP_440436.1_4 Forward -139 -130 18.1905 0.00233
NP_440436.1_4 Reverse -300 -309 18.1905 0.00233
NP_440436.1_4 Reverse -132 -141 18.1905 0.00233
NP_440436.1_4 Forward -307 -298 9.24241 0.0871
NP_440436.1_4 Reverse -198 -207 4.42421 0.265
NP_441884.1_9 Forward -143 -124 -12.8819 0.138
NP_441884.1_9 Reverse -128 -147 -13.3736 0.138
NP_441884.1_9 Reverse -296 -315 -14.9469 0.138
NP_440314.1_9 Reverse -32 -51 -3.3438 0.181
NP_440314.1_9 Reverse -300 -319 -4.52377 0.209
NP_441719.1_2 Forward -68 -54 15.0784 0.278
NP_441719.1_4 Forward -307 -300 16.3621 0.0124
NP_441719.1_4 Reverse -300 -307 16.3621 0.0124
NP_441719.1_4 Forward -139 -132 16.3621 0.0124
NP_441719.1_4 Reverse -132 -139 16.3621 0.0124
NP_441733.1_9 Forward -124 -110 19.6658 0.193
NP_441733.1_10 Forward -143 -130 19.9805 0.0151
NP_441733.1_10 Reverse -128 -141 10.1474 0.106
NP_441733.1_10 Reverse -296 -309 5.91914 0.203
NP_441004.1_1 Reverse -347 -366 -0.197208 0.123
NP_441004.1_1 Forward -200 -181 -2.55715 0.147
NP_441004.1_1 Reverse -302 -321 -18.2901 0.299
NP_441004.1_2 Reverse -342 -361 -2.85214 0.266
NP_441004.1_3 Forward -140 -121 4.81767 0.224
NP_441004.1_4 Forward -255 -245 7.64985 0.294
NP_442813.1_4 Forward -56 -37 -7.67036 0.299
NP_441231.1_3 Reverse -246 -265 11.5033 0.271
NP_442366.1_3 Forward -309 -291 13.6872 0.0245
NP_442366.1_3 Forward -141 -123 12.0155 0.0326
NP_442366.1_3 Reverse -130 -148 0.412472 0.172
NP_442366.1_5 Reverse -128 -138 12.7626 0.108
NP_442873.1_9 Forward -318 -299 5.70185 0.259
NP_443029.1_8 Reverse -137 -156 14.2574 0.293
NP_441115.1_4 Reverse -130 -148 14.5713 0.0532
NP_441115.1_4 Forward -309 -291 13.588 0.0741
NP_442694.1_4 Forward -261 -252 12.9794 0.225
NP_442206.1_1 Reverse -299 -318 -10.9153 0.219
NP_442206.1_10 Reverse -299 -314 4.79811 0.178
NP_442206.1_10 Forward -308 -293 -0.511758 0.298
NP_442854.1_6 Forward -253 -234 13.7658 0.147
NP_443054.1_2 Reverse -129 -143 12.7826 0.0722
NP_443054.1_2 Reverse -297 -311 12.1926 0.0722
NP_443054.1_2 Forward -142 -128 11.6026 0.0761
NP_443054.1_2 Reverse -122 -136 3.04785 0.24
NP_443054.1_2 Reverse -336 -350 1.57289 0.245
NP_442430.1_4 Reverse -109 -128 14.8474 0.186
NP_441966.1_7 Reverse -166 -185 1.37531 0.208
NP_441851.1_10 Forward -309 -299 16.008 0.00552
NP_441851.1_10 Forward -141 -131 16.008 0.00552
NP_441851.1_10 Reverse -130 -140 16.008 0.00552
NP_441851.1_10 Reverse -298 -308 8.53483 0.114
NP_442208.1_5 Reverse -156 -175 -8.06369 0.275
NP_441545.1_1 Forward -319 -300 4.12936 0.222
NP_442622.1_1 Reverse -298 -317 -2.16383 0.177
NP_442622.1_5 Forward -310 -291 -4.52377 0.2
NP_442515.1_1 Reverse -298 -312 5.01447 0.107
NP_441396.1_5 Reverse -271 -280 8.1612 0.224
NP_440593.1_3 Forward -184 -165 3.44104 0.155
NP_440165.1_5 Reverse -298 -317 -6.78538 0.246
NP_441349.1_10 Reverse -289 -308 7.47261 0.0313
NP_441349.1_10 Reverse -166 -185 -7.4737 0.251
NP_441409.1_6 Reverse -293 -312 -15.1435 0.28
NP_440432.1_9 Forward -139 -124 -0.216765 0.164
NP_440432.1_9 Forward -205 -190 -0.511758 0.164
NP_440432.1_9 Reverse -132 -147 -2.38005 0.17
NP_440474.1_8 Reverse -300 -314 14.4536 0.0624
NP_440474.1_8 Reverse -132 -146 8.45543 0.186
NP_440474.1_8 Forward -139 -125 8.16044 0.189
NP_440474.1_8 Forward -307 -293 4.8172 0.266
NP_440396.1_10 Reverse -300 -316 13.3325 0.153
NP_441524.1_6 Forward -210 -192 4.05072 0.287
NP_440726.1_2 Reverse -166 -185 -0.590531 0.295
NP_441477.1_10 Reverse -232 -250 9.85225 0.181
NP_442450.1_5 Reverse -297 -307 9.41981 0.115
NP_442450.1_5 Reverse -129 -139 7.55152 0.13
NP_442168.1_5 Forward -184 -165 -3.83545 0.293
NP_440588.1_2 Reverse -290 -309 15.8307 0.0124
NP_440588.1_2 Reverse -167 -186 1.86774 0.127
NP_440588.1_2 Forward -326 -307 1.17943 0.139
NP_440195.1_4 Forward -63 -44 4.81767 0.292
NP_442006.1_2 Forward -317 -300 -7.13932 0.169
NP_442006.1_2 Forward -126 -109 -15.6941 0.228
NP_440483.1_1 Forward -352 -333 -2.85214 0.208
NP_440483.1_1 Forward -211 -192 -8.65367 0.292
NP_442243.1_1 Forward -248 -230 1.69003 0.21
NP_442243.1_1 Forward -146 -128 -3.12816 0.299
NP_441570.1_1 Forward -308 -290 1.69077 0.029
NP_441570.1_1 Reverse -299 -317 -17.2871 0.269
NP_441570.1_1 Forward -117 -99 -17.5821 0.283
NP_441078.1_4 Forward -308 -299 19.6659 0.0007
NP_441078.1_4 Reverse -299 -308 19.6659 0.0007
NP_441078.1_4 Forward -140 -131 19.6659 0.0007
NP_441078.1_4 Reverse -131 -140 19.6659 0.0007
NP_441078.1_4 Reverse -42 -51 -1.37691 0.254
NP_441078.1_4 Forward -185 -176 -1.86856 0.272
NP_442729.1_5 Forward -127 -117 8.04317 0.251
NP_442729.1_8 Forward -312 -299 9.75405 0.125
NP_442729.1_8 Forward -144 -131 8.47575 0.125
NP_442729.1_8 Forward -55 -42 6.70579 0.181
NP_442388.1_3 Reverse -296 -315 15.1424 0.152
NP_441528.1_2 Forward -183 -164 7.4718 0.297
NP_442443.1_1 Forward -268 -249 4.81767 0.157
NP_442443.1_1 Reverse -346 -365 -4.6221 0.275
NP_442443.1_1 Reverse -202 -221 -5.21209 0.282
NP_442443.1_1 Forward -128 -109 -6.29373 0.294
NP_440526.1_3 Reverse -132 -143 11.7595 0.0646
NP_440526.1_3 Reverse -300 -311 2.41814 0.267
NP_440526.1_3 Forward -139 -128 2.02482 0.267
NP_441432.1_8 Reverse -298 -307 16.8143 0.00595
NP_441432.1_8 Reverse -130 -139 8.25953 0.0755
NP_441432.1_8 Forward -309 -300 8.25953 0.0755
NP_441432.1_8 Forward -141 -132 8.25953 0.0755
NP_442320.1_8 Forward -146 -132 24.2873 0.00275
NP_442320.1_8 Reverse -125 -139 5.21113 0.0401
NP_442320.1_8 Forward -314 -300 -2.85201 0.1
NP_442320.1_8 Forward -212 -198 -4.4253 0.168
NP_442344.1_7 Forward -139 -120 22.4189 0.0082
NP_442344.1_7 Reverse -300 -319 -5.9004 0.168
NP_441732.1_2 Reverse -295 -311 11.8583 0.00594
NP_441732.1_2 Reverse -127 -143 -16.2644 0.165
NP_441732.1_2 Reverse -172 -188 -17.346 0.253
NP_440629.1_6 Reverse -293 -312 22.2645 0.00873
NP_440321.1_1 Forward -188 -171 14.4935 0.27
NP_442797.1_7 Reverse -130 -148 0.707465 0.271
NP_440578.1_8 Forward -195 -176 17.3057 0.202
NP_441805.1_2 Forward -217 -198 -4.72043 0.281
NP_441057.1_4 Forward -189 -171 10.1472 0.141
NP_441057.1_4 Reverse -361 -379 6.11567 0.195
NP_442353.1_6 Reverse -300 -319 9.73422 0.298
NP_442968.1_8 Reverse -337 -356 13.4708 0.196
NP_440713.1_4 Reverse -289 -308 17.699 0.0472
NP_442489.1_7 Forward -308 -299 20.1576 0.000695
NP_442489.1_7 Reverse -299 -308 20.1576 0.000695
NP_442489.1_7 Forward -140 -131 20.1576 0.000695
NP_442489.1_7 Reverse -131 -140 20.1576 0.000695
NP_442489.1_7 Forward -185 -176 -1.37691 0.195
NP_442489.1_7 Forward -133 -124 -1.77023 0.247
NP_442079.1_7 Forward -307 -288 15.2408 0.0744
NP_442079.1_7 Reverse -300 -319 7.47261 0.136
NP_440559.1_1 Reverse -300 -309 8.75118 0.0586
NP_440559.1_1 Reverse -132 -141 8.75118 0.0586
NP_440559.1_1 Forward -139 -130 8.75118 0.0586
NP_440559.1_1 Forward -307 -298 8.65285 0.0586
NP_441659.2_8 Forward -308 -298 20.9245 0.000805
NP_441659.2_8 Reverse -299 -309 11.9764 0.0147
NP_441659.2_8 Forward -140 -130 11.9764 0.0147
NP_441659.2_8 Reverse -131 -141 11.9764 0.0147
NP_441659.2_8 Reverse -176 -186 6.17489 0.084
NP_442913.1_9 Reverse -125 -144 8.65258 0.25
NP_442913.1_10 Forward -317 -298 4.03102 0.0942
NP_442913.1_10 Reverse -122 -141 1.37609 0.143
NP_441040.1_2 Forward -214 -195 -5.99873 0.181
NP_441040.1_2 Reverse -163 -182 -16.5201 0.3
NP_439956.1_7 Forward -191 -172 3.44104 0.257
NP_442008.1_2 Reverse -296 -315 5.01433 0.231
NP_442008.1_2 Reverse -139 -158 4.81767 0.232
NP_441800.1_7 Forward -379 -361 -3.12744 0.268
NP_441800.1_7 Reverse -174 -192 -3.6191 0.279
NP_442776.1_1 Reverse -186 -205 4.03102 0.278
NP_442776.1_6 Forward -310 -291 10.7175 0.207
NP_440779.1_5 Forward -140 -123 -14.4158 0.246
NP_442346.1_5 Reverse -298 -308 16.303 0.00248
NP_442346.1_5 Forward -309 -299 9.02648 0.118
NP_442346.1_5 Forward -141 -131 9.02648 0.118
NP_442346.1_5 Reverse -130 -140 9.02648 0.118
NP_442346.1_5 Reverse -196 -206 8.63316 0.131
NP_442346.1_5 Reverse -175 -185 7.94484 0.152
NP_440545.1_3 Reverse -295 -312 16.8534 0.0111
NP_440545.1_3 Forward -312 -295 7.02034 0.0522
NP_440545.1_3 Reverse -172 -189 3.57876 0.0817
NP_440545.1_3 Reverse -127 -144 -3.40274 0.203
NP_440545.1_3 Forward -189 -172 -6.15601 0.27
NP_441856.1_3 Forward -311 -292 -0.688862 0.225
NP_440025.1_1 Reverse -127 -146 12.1925 0.147
NP_440025.1_3 Reverse -248 -262 11.6757 0.288
NP_440831.1_3 Forward -317 -298 7.06668 0.265
NP_440459.1_2 Forward -135 -118 13.9035 0.122
NP_440459.1_2 Reverse -129 -146 11.4452 0.175
NP_440459.1_2 Reverse -122 -139 9.97027 0.212
NP_441653.1_2 Reverse -132 -151 6.6219 0.225
NP_440010.1_3 Forward -320 -301 -5.11376 0.25
NP_440010.1_3 Forward -359 -340 -8.35868 0.297
NP_440010.1_4 Reverse -298 -317 0.785326 0.243
NP_440010.1_10 Forward -129 -110 10.9142 0.209
NP_440010.1_10 Reverse -333 -352 2.16274 0.287
NP_442603.1_7 Reverse -299 -313 6.78381 0.23
NP_441888.1_7 Forward -313 -299 3.8345 0.225
NP_441888.1_7 Forward -145 -131 2.5562 0.225
NP_441888.1_7 Forward -211 -197 0.88457 0.276
NP_441888.1_7 Forward -322 -308 0.589577 0.292
NP_441050.1_5 Forward -269 -251 -3.22577 0.286
NP_440449.1_6 Forward -193 -175 8.64489 0.197
NP_440449.1_6 Forward -148 -130 4.94889 0.287
NP_441948.1_4 Reverse -292 -310 17.3254 0.0169
NP_441948.1_4 Reverse -124 -142 15.3588 0.0265
NP_441833.1_4 Forward -307 -300 15.9687 0.0124
NP_441833.1_4 Reverse -300 -307 15.9687 0.0124
NP_441833.1_4 Forward -139 -132 15.9687 0.0124
NP_441833.1_4 Reverse -132 -139 15.9687 0.0124
NP_441895.1_2 Forward -279 -260 -26.9432 0.275
NP_441895.1_10 Forward -258 -239 -18.4868 0.282
NP_442699.1_8 Reverse -312 -331 -12.9802 0.266
NP_442162.1_9 Forward -307 -300 16.2637 0.0124
NP_442162.1_9 Reverse -300 -307 16.2637 0.0124
NP_442162.1_9 Forward -139 -132 16.2637 0.0124
NP_442162.1_9 Reverse -132 -139 16.2637 0.0124
NP_442162.1_9 Forward -132 -125 5.93897 0.214
NP_440671.1_4 Forward -146 -132 8.06273 0.204
NP_440671.1_4 Reverse -293 -307 7.76774 0.208
NP_440671.1_4 Forward -139 -125 5.40779 0.283
NP_440772.1_6 Reverse -300 -319 11.7008 0.212
NP_442199.1_5 Reverse -291 -310 -0.4922 0.177
NP_442199.1_5 Forward -148 -129 -4.13045 0.219
NP_442140.1_3 Reverse -300 -310 17.4829 0.0159
NP_442140.1_3 Reverse -132 -142 17.4829 0.0159
NP_442140.1_3 Forward -139 -129 16.2046 0.0255
NP_442140.1_3 Forward -316 -306 4.60159 0.242
NP_442723.1_1 Reverse -81 -100 13.175 0.238
NP_440875.1_9 Reverse -133 -143 17.619 0.0104
NP_440875.1_9 Reverse -301 -311 15.2829 0.0295
NP_440875.1_9 Forward -138 -128 8.46937 0.233
NP_440875.1_9 Forward -306 -296 8.27469 0.233
NP_441813.1_5 Reverse -297 -307 15.9097 0.01
NP_441813.1_5 Forward -310 -300 10.0098 0.0208
NP_441813.1_5 Forward -142 -132 10.0098 0.0208
NP_441813.1_5 Reverse -129 -139 9.91146 0.021
NP_441813.1_5 Forward -208 -198 -0.511621 0.247
NP_441813.1_7 Reverse -176 -190 9.14375 0.262
NP_440594.1_5 Reverse -65 -84 6.68515 0.293
NP_441227.1_6 Forward -200 -181 17.6007 0.293
NP_442089.1_1 Reverse -128 -147 2.3594 0.226
NP_442089.1_1 Forward -143 -124 -0.295539 0.261
NP_440590.1_4 Reverse -132 -145 21.7504 0.00377
NP_440590.1_4 Forward -139 -126 10.049 0.0314
NP_440590.1_4 Reverse -300 -313 5.23083 0.0585
NP_440567.1_1 Reverse -132 -146 18.8791 0.0136
NP_440567.1_1 Reverse -300 -314 16.9125 0.0164
NP_440567.1_1 Forward -307 -293 8.06273 0.0621
NP_440567.1_1 Forward -139 -125 7.57108 0.0689
NP_442497.1_10 Forward -307 -298 17.601 0.00813
NP_442497.1_10 Forward -139 -130 10.4228 0.0087
NP_442497.1_10 Reverse -300 -309 10.4228 0.0087
NP_442497.1_10 Reverse -132 -141 10.4228 0.0087
NP_440821.1_4 Forward -310 -300 18.7612 0.00422
NP_440821.1_4 Forward -142 -132 18.7612 0.00422
NP_440821.1_4 Reverse -297 -307 11.0914 0.0146
NP_440821.1_4 Reverse -129 -139 10.2065 0.0163
NP_441239.1_9 Forward -142 -130 18.6235 0.0114
NP_441239.1_9 Forward -310 -298 16.0669 0.0175
NP_441239.1_9 Reverse -129 -141 14.887 0.0247
NP_441239.1_9 Reverse -297 -309 14.6903 0.0258
NP_441239.1_9 Reverse -306 -318 8.6921 0.125
NP_441009.1_4 Forward -308 -289 12.4875 0.232
NP_441009.1_10 Forward -313 -294 14.0599 0.281
NP_440156.1_4 Forward -361 -351 14.5325 0.176
NP_442897.1_7 Reverse -347 -366 13.4708 0.291
NP_441727.1_3 Forward -315 -296 12.1925 0.136
NP_441727.1_3 Reverse -163 -182 4.71934 0.262
NP_441892.1_1 Forward -149 -132 -4.68105 0.266
NP_440665.1_1 Reverse -302 -321 -11.3086 0.244
NP_440604.1_6 Forward -308 -289 10.6192 0.0654
NP_442044.1_1 Reverse -171 -190 -4.72043 0.18
NP_442044.1_1 Reverse -294 -313 -5.50708 0.188
NP_442044.1_1 Reverse -165 -184 -13.4719 0.277
NP_440612.1_3 Reverse -10 -28 19.1937 0.165
NP_440833.1_6 Forward -363 -349 9.43874 0.263
NP_442216.1_4 Reverse -87 -95 8.08217 0.255
NP_441936.1_2 Reverse -242 -261 21.418 0.132
NP_440949.1_7 Forward -316 -297 9.53674 0.261
NP_440546.1_4 Forward -308 -298 13.5365 0.0459
NP_440546.1_4 Reverse -299 -309 11.8882 0.0679
NP_440546.1_4 Forward -140 -130 11.8882 0.0679
NP_440546.1_4 Reverse -131 -141 11.8882 0.0679
NP_440462.1_6 Forward -310 -300 17.9746 0.00578
NP_440462.1_6 Forward -142 -132 17.9746 0.00578
NP_440462.1_6 Reverse -297 -307 16.893 0.00853
NP_440462.1_6 Reverse -129 -139 9.02648 0.0498
NP_442611.1_1 Forward -308 -289 1.37609 0.238
NP_442611.1_1 Reverse -294 -313 0.392778 0.259
NP_440868.1_4 Forward -312 -300 21.5735 0.00629
NP_440868.1_4 Reverse -295 -307 13.2153 0.022
NP_440868.1_4 Reverse -127 -139 8.49544 0.0602
NP_440868.1_4 Forward -144 -132 2.98891 0.142
NP_442499.1_1 Reverse -171 -190 14.6508 0.201
NP_442479.1_9 Reverse -353 -372 -4.6221 0.261
NP_441582.1_5 Forward -142 -123 5.70185 0.213
NP_442402.1_6 Reverse -348 -357 14.1594 0.241
NP_442402.1_10 Forward -359 -349 12.7626 0.204
NP_442258.1_2 Reverse -119 -138 -5.01543 0.273
NP_441084.1_6 Reverse -297 -311 11.4772 0.201
NP_440653.1_10 Forward -179 -160 8.84924 0.19
NP_440653.1_10 Reverse -132 -151 5.30933 0.234
NP_440696.1_3 Forward -312 -294 0.21581 0.237
NP_441843.2_9 Forward -138 -120 20.2183 0.071
NP_442882.1_7 Forward -315 -301 12.3887 0.261
NP_442039.1_4 Forward -307 -300 15.1821 0.0124
NP_442039.1_4 Reverse -300 -307 15.1821 0.0124
NP_442039.1_4 Forward -139 -132 15.1821 0.0124
NP_442039.1_4 Reverse -132 -139 15.1821 0.0124
NP_442039.1_7 Reverse -347 -357 11.0914 0.257
NP_440825.1_6 Reverse -351 -370 9.3409 0.285
NP_440825.1_7 Forward -139 -129 12.4217 0.155
NP_442837.1_3 Forward -307 -300 15.7721 0.0124
NP_442837.1_3 Reverse -300 -307 15.7721 0.0124
NP_442837.1_3 Forward -139 -132 15.7721 0.0124
NP_442837.1_3 Reverse -132 -139 15.7721 0.0124
NP_440160.1_9 Reverse -164 -183 11.6025 0.216
NP_442053.1_1 Forward -308 -299 18.3876 0.0007
NP_442053.1_1 Reverse -299 -308 18.3876 0.0007
NP_442053.1_1 Forward -140 -131 18.3876 0.0007
NP_442053.1_1 Reverse -131 -140 18.3876 0.0007
NP_440505.1_3 Reverse -297 -307 15.123 0.014
NP_440505.1_3 Forward -310 -300 14.1397 0.0235
NP_440505.1_3 Forward -142 -132 14.1397 0.0235
NP_440505.1_3 Reverse -129 -139 6.76487 0.169
NP_441102.1_1 Reverse -132 -151 6.68596 0.239
NP_441203.1_1 Forward -307 -288 -12.9802 0.149
NP_441203.1_1 Forward -265 -246 -17.1101 0.278
NP_441203.1_1 Reverse -132 -151 -19.1751 0.297
NP_442532.1_7 Reverse -299 -313 14.2576 0.0644
NP_440914.1_1 Forward -308 -298 16.3248 0.00196
NP_440914.1_1 Forward -140 -130 8.6151 0.186
NP_440914.1_1 Reverse -299 -309 8.6151 0.186
NP_440914.1_1 Reverse -131 -141 8.6151 0.186
NP_441011.1_8 Forward -139 -130 16.9127 0.00602
NP_441011.1_8 Reverse -300 -309 16.9127 0.00602
NP_441011.1_8 Reverse -132 -141 16.9127 0.00602
NP_441011.1_8 Forward -307 -298 16.6177 0.00602
NP_441011.1_8 Forward -205 -196 4.91628 0.296
NP_442101.1_10 Reverse -123 -142 -7.27704 0.21
NP_442533.1_6 Forward -308 -299 17.2076 0.00137
NP_442533.1_6 Reverse -299 -308 17.2076 0.00137
NP_442533.1_6 Forward -140 -131 17.2076 0.00137
NP_442533.1_6 Reverse -131 -140 17.2076 0.00137
NP_442533.1_6 Reverse -176 -185 5.60459 0.137
NP_442533.1_6 Reverse -308 -317 4.12963 0.191
NP_442533.1_6 Forward -185 -176 3.7363 0.204
NP_442533.1_6 Forward -206 -197 1.76968 0.289
NP_442541.1_10 Reverse -170 -184 3.44058 0.254
NP_442232.1_3 Reverse -291 -310 -6.29373 0.182
NP_442322.1_4 Forward -377 -360 -0.945159 0.226
NP_442229.1_1 Forward -142 -128 21.0417 0.0686
NP_442229.1_1 Reverse -129 -143 10.8154 0.18
NP_443016.1_1 Reverse -293 -312 -3.63879 0.225
NP_441219.1_4 Reverse -281 -300 9.83255 0.204
NP_441482.1_7 Reverse -293 -307 -1.5737 0.0755
NP_439944.1_9 Forward -307 -297 17.6796 0.00347
NP_439944.1_9 Reverse -300 -310 10.4031 0.0887
NP_439944.1_9 Reverse -132 -142 10.4031 0.0887
NP_441028.1_6 Forward -326 -316 13.2542 0.159
NP_441028.1_6 Forward -68 -58 7.45273 0.229
NP_441028.1_6 Forward -215 -205 5.38779 0.255
NP_442202.1_10 Reverse -169 -183 5.01447 0.255
NP_440116.1_8 Reverse -132 -151 -0.295539 0.106
NP_440116.1_8 Forward -139 -120 -5.50708 0.194
NP_440116.1_8 Forward -307 -288 -7.08038 0.222
NP_440116.1_8 Reverse -300 -319 -9.14533 0.268
NP_440115.1_6 Forward -311 -301 9.61647 0.115
NP_440115.1_6 Reverse -296 -306 7.45319 0.147
NP_440007.1_9 Reverse -295 -309 0.786239 0.29
NP_439965.1_1 Reverse -290 -309 -2.65548 0.177
NP_439965.1_1 Forward -383 -364 -8.16202 0.257
NP_439965.1_1 Forward -149 -130 -10.1286 0.3
NP_441961.1_4 Forward -188 -169 14.2574 0.168
NP_441602.1_3 Forward -184 -165 -0.983855 0.226
NP_441972.1_5 Reverse -132 -151 0.491109 0.149
NP_441972.1_5 Forward -283 -264 -9.14533 0.281
NP_441106.1_1 Reverse -298 -307 18.486 0.0028
NP_441106.1_1 Reverse -130 -139 18.191 0.0028
NP_441106.1_1 Forward -309 -300 18.191 0.0028
NP_441106.1_1 Forward -141 -132 18.191 0.0028
NP_441106.1_1 Reverse -196 -205 5.01461 0.191
NP_441106.1_1 Forward -207 -198 4.71961 0.21
NP_440429.1_4 Reverse -124 -143 13.6675 0.25
NP_441825.1_4 Forward -262 -252 16.008 0.186
NP_439903.1_6 Reverse -296 -315 1.27698 0.249
NP_439903.1_6 Reverse -108 -127 -0.39464 0.282
NP_439903.1_6 Reverse -19 -38 -0.689632 0.284
NP_442588.1_6 Forward -129 -110 -1.7705 0.278
NP_442306.1_10 Reverse -294 -313 -11.2103 0.121
NP_441286.1_1 Reverse -298 -310 5.34885 0.0259
NP_441286.1_1 Reverse -130 -142 5.25052 0.0259
NP_441286.1_1 Forward -309 -297 4.8572 0.0272
NP_441286.1_1 Forward -141 -129 -3.50094 0.145
NP_440670.1_8 Forward -308 -299 18.3876 0.000699
NP_440670.1_8 Reverse -299 -308 18.3876 0.000699
NP_440670.1_8 Forward -140 -131 18.3876 0.000699
NP_440670.1_8 Reverse -131 -140 18.3876 0.000699
NP_440670.1_8 Forward -133 -124 12.2911 0.0274
NP_440670.1_8 Reverse -124 -133 5.80125 0.134
NP_441479.1_1 Forward -311 -292 8.55425 0.247
NP_441930.1_2 Forward -261 -251 12.5664 0.258
NP_440886.1_7 Forward -309 -299 17.7774 0.0011
NP_440886.1_7 Forward -141 -131 17.7774 0.0011
NP_440886.1_7 Reverse -130 -140 17.7774 0.0011
NP_440886.1_7 Reverse -298 -308 8.04271 0.0805
NP_440886.1_7 Reverse -307 -317 7.15773 0.103
NP_440886.1_7 Reverse -175 -185 6.17443 0.141
NP_440886.1_7 Reverse -178 -188 5.38779 0.185
NP_440828.1_4 Reverse -298 -317 -3.44288 0.241
NP_440828.1_4 Reverse -107 -126 -5.99948 0.265
NP_440828.1_4 Reverse -169 -188 -8.45774 0.297
NP_442614.1_2 Forward -308 -294 8.45605 0.255
NP_442072.1_1 Forward -158 -140 2.96908 0.289
NP_442072.1_9 Reverse -130 -148 -3.6191 0.0368
NP_442072.1_9 Forward -52 -34 -13.7472 0.121
NP_442072.1_9 Reverse -123 -141 -13.9439 0.126
NP_442072.1_9 Forward -141 -123 -21.712 0.212
NP_440513.1_4 Reverse -299 -318 11.6025 0.224
NP_442213.1_5 Forward -196 -177 0.392778 0.272
NP_441753.1_10 Forward -149 -130 0.294447 0.296
NP_441808.1_8 Forward -185 -166 7.86593 0.273
NP_440907.2_8 Reverse -300 -310 17.4824 0.00685
NP_440907.2_8 Reverse -132 -142 17.4824 0.00685
NP_440907.2_8 Forward -139 -129 14.2375 0.0312
NP_440907.2_8 Forward -307 -297 9.51767 0.103
NP_441021.1_1 Reverse -132 -151 -11.6036 0.27
NP_441021.1_8 Reverse -126 -144 12.9988 0.0938
NP_441021.1_8 Forward -145 -127 9.55725 0.149
NP_441463.1_3 Forward -318 -299 10.0292 0.0481
NP_441463.1_3 Reverse -289 -308 -2.45882 0.154
NP_441463.1_3 Forward -150 -131 -9.53865 0.28
NP_441463.1_6 Reverse -297 -311 14.5332 0.165
NP_441626.1_2 Forward -307 -300 15.7721 0.0124
NP_441626.1_2 Reverse -300 -307 15.7721 0.0124
NP_441626.1_2 Forward -139 -132 15.7721 0.0124
NP_441626.1_2 Reverse -132 -139 15.7721 0.0124
NP_442365.1_5 Reverse -300 -319 8.25926 0.221
NP_442365.1_7 Reverse -295 -314 -2.26216 0.199
NP_440107.1_5 Reverse -292 -311 -7.4737 0.295
NP_441401.1_4 Reverse -11 -24 14.6706 0.215
NP_442615.1_1 Reverse -122 -140 11.4255 0.0179
NP_442615.1_1 Reverse -290 -308 10.8356 0.0193
NP_442615.1_1 Forward -317 -299 -0.0791831 0.111
NP_442615.1_1 Forward -149 -131 -4.30741 0.183
NP_441962.1_4 Reverse -294 -313 -8.45701 0.2
NP_440387.1_1 Reverse -299 -315 14.6115 0.00635
NP_440387.1_1 Forward -308 -292 6.35172 0.0282
NP_440387.1_1 Forward -140 -124 -1.12144 0.142
NP_440387.1_1 Reverse -374 -390 -4.1697 0.178
NP_440387.1_1 Forward -185 -169 -6.03799 0.262
NP_441431.1_2 Forward -143 -129 18.8785 0.0152
NP_441431.1_2 Reverse -128 -142 11.897 0.131
NP_441431.1_2 Forward -311 -297 11.012 0.149
NP_441431.1_2 Forward -136 -122 8.3571 0.218
NP_440634.1_8 Reverse -92 -111 7.66846 0.274
NP_441993.1_1 Forward -146 -127 0.972113 0.288
NP_441174.1_2 Reverse -296 -310 20.8458 0.00244
NP_441174.1_2 Forward -320 -306 12.6843 0.247
NP_440358.1_8 Forward -93 -74 2.3594 0.241
NP_440114.1_10 Forward -140 -126 15.4376 0.0252
NP_440114.1_10 Reverse -299 -313 12.586 0.0783
NP_440114.1_10 Reverse -124 -138 8.25939 0.21
NP_440114.1_10 Forward -308 -294 7.17775 0.243
NP_440114.1_10 Reverse -131 -145 6.88276 0.253
NP_441817.1_7 Forward -203 -184 14.3558 0.287
NP_442437.1_8 Forward -151 -132 11.0125 0.179
NP_442437.1_8 Reverse -300 -319 9.24257 0.223
NP_442437.1_8 Forward -319 -300 4.62101 0.256
NP_441510.2_2 Reverse -295 -314 9.7334 0.174
NP_440287.1_6 Forward -142 -123 3.14605 0.226
NP_440293.1_3 Reverse -163 -182 -2.45882 0.241
NP_440766.1_4 Forward -144 -130 17.9942 0.0255
NP_440766.1_4 Reverse -295 -309 6.78443 0.0973
NP_439988.1_7 Reverse -301 -315 13.6669 0.292
NP_441237.1_6 Forward -179 -162 7.02034 0.166
NP_442743.1_4 Reverse -309 -328 6.19431 0.103
NP_442743.1_4 Forward -307 -288 -4.81876 0.255
NP_439910.1_2 Reverse -123 -140 -21.299 0.183
NP_439910.1_2 Forward -148 -131 -21.889 0.195
NP_442867.1_8 Reverse -110 -129 5.11266 0.277
NP_440457.1_1 Reverse -295 -307 10.9537 0.092
NP_440457.1_1 Forward -144 -132 5.34885 0.141
NP_440457.1_1 Forward -312 -300 0.137309 0.25
NP_440798.1_6 Forward -139 -126 14.2773 0.0423
NP_440798.1_6 Reverse -132 -145 3.85419 0.147
NP_440798.1_6 Reverse -300 -313 3.5592 0.15
NP_440798.1_6 Reverse -125 -138 3.16588 0.152
NP_440798.1_6 Forward -307 -294 1.00259 0.24
NP_442680.1_5 Forward -95 -76 1.73297 0.237
NP_440801.1_8 Reverse -344 -363 -2.16383 0.294
NP_440801.1_10 Forward -321 -302 8.35759 0.272
NP_441984.1_3 Reverse -193 -211 11.0322 0.184
NP_441984.1_3 Reverse -127 -145 7.98396 0.239
NP_441436.1_10 Reverse -163 -182 14.6508 0.278
NP_440473.1_9 Forward -319 -300 3.83436 0.0985
NP_442509.1_9 Reverse -299 -309 16.2041 0.00739
NP_442509.1_9 Forward -140 -130 16.2041 0.00739
NP_442509.1_9 Reverse -131 -141 16.2041 0.00739
NP_442509.1_9 Forward -308 -298 8.04271 0.192
NP_442509.1_9 Reverse -124 -134 7.64939 0.21
NP_441496.1_1 Forward -334 -320 14.3354 0.265
NP_442514.1_5 Reverse -116 -135 -6.29447 0.265
NP_440734.1_9 Reverse -170 -189 14.7491 0.201
NP_440554.1_4 Forward -307 -297 16.1063 0.0189
NP_440554.1_4 Reverse -300 -310 13.943 0.0218
NP_440554.1_4 Reverse -132 -142 13.943 0.0218
NP_440554.1_4 Forward -139 -129 7.35486 0.103
NP_440554.1_4 Reverse -198 -208 6.07655 0.128
NP_441845.1_6 Forward -63 -45 2.67408 0.245
NP_441885.1_5 Reverse -299 -309 11.4848 0.00668
NP_441885.1_5 Forward -140 -130 11.4848 0.00668
NP_441885.1_5 Reverse -131 -141 11.4848 0.00668
NP_441885.1_5 Forward -308 -298 11.3864 0.00668
NP_440478.1_10 Forward -208 -194 14.8476 0.107
NP_440649.2_5 Forward -309 -290 11.6025 0.232
NP_441428.1_8 Forward -316 -297 5.50599 0.226
NP_442341.1_7 Reverse -130 -144 22.0257 0.00401
NP_442341.1_7 Forward -141 -127 10.0294 0.0682
NP_442341.1_7 Reverse -298 -312 9.43936 0.0751
NP_442341.1_7 Forward -134 -120 2.94952 0.239
NP_442341.1_7 Reverse -337 -351 2.75286 0.247
NP_442341.1_7 Reverse -123 -137 2.75286 0.247
NP_442341.1_9 Forward -310 -296 8.06211 0.179
NP_441756.1_5 Forward -144 -125 -1.7705 0.264
NP_441173.1_9 Reverse -26 -34 12.1137 0.21
NP_442395.2_4 Reverse -130 -149 9.04509 0.121
NP_442395.2_4 Forward -309 -290 7.86512 0.136
NP_442534.1_7 Reverse -123 -142 15.9291 0.163
NP_443000.1_7 Reverse -297 -307 17.4829 0.00719
NP_443000.1_7 Forward -310 -300 2.04498 0.226
NP_443000.1_7 Forward -142 -132 2.04498 0.226
NP_443000.1_7 Reverse -129 -139 1.94665 0.226
NP_441842.1_10 Forward -315 -301 19.3708 0.0142
NP_441842.1_10 Forward -147 -133 18.5841 0.0173
NP_441842.1_10 Reverse -124 -138 14.0609 0.0636
NP_440275.1_3 Forward -310 -300 17.9746 0.0082
NP_440275.1_3 Forward -142 -132 17.9746 0.0082
NP_440275.1_3 Reverse -297 -307 9.12481 0.055
NP_440275.1_3 Reverse -129 -139 8.33817 0.0602
NP_442932.1_9 Reverse -204 -223 12.0942 0.175
NP_440091.1_1 Forward -144 -132 12.6253 0.0353
NP_440091.1_1 Reverse -127 -139 10.7571 0.0429
NP_440091.1_1 Forward -312 -300 10.1671 0.0498
NP_440091.1_1 Reverse -295 -307 1.51394 0.197
NP_441307.1_4 Reverse -309 -328 1.67108 0.236
NP_440679.1_10 Reverse -301 -320 -15.9302 0.25
NP_443010.1_10 Forward -311 -294 10.7914 0.119
NP_441359.1_5 Reverse -128 -147 10.4225 0.143
NP_442451.1_2 Forward -148 -129 -10.1286 0.265
NP_441122.1_1 Forward -137 -122 4.1098 0.28
NP_439962.1_4 Forward -214 -195 -4.52377 0.271
NP_439962.1_4 Reverse -300 -319 -5.60541 0.28
NP_439962.1_4 Reverse -123 -142 -7.4737 0.289
NP_442495.1_5 Reverse -159 -178 8.45592 0.291
NP_441105.1_3 Forward -131 -112 -5.11376 0.213
NP_442373.1_2 Forward -191 -172 -10.817 0.291
NP_440216.1_1 Forward -140 -126 16.2242 0.00307
NP_440216.1_1 Reverse -131 -145 8.25939 0.0061
NP_440216.1_1 Forward -308 -294 6.6861 0.0139
NP_440216.1_1 Reverse -299 -313 -1.27871 0.0303
NP_440216.1_1 Forward -51 -37 -2.16369 0.0482
NP_440216.1_1 Reverse -124 -138 -4.22864 0.103
NP_440216.1_6 Forward -147 -131 15.2015 0.0619
NP_440172.1_1 Forward -308 -298 17.5813 0.00421
NP_440172.1_1 Reverse -299 -309 8.73149 0.0586
NP_440172.1_1 Forward -140 -130 8.73149 0.0586
NP_440172.1_1 Reverse -131 -141 8.73149 0.0586
NP_442371.1_1 Reverse -349 -359 13.9425 0.191
NP_440167.1_3 Forward -298 -279 11.2092 0.231
NP_442015.1_10 Reverse -166 -179 5.82081 0.132
NP_442015.1_10 Forward -144 -131 3.95252 0.178
NP_442015.1_10 Forward -312 -299 3.06754 0.185
NP_442015.1_10 Reverse -57 -70 2.96921 0.187
NP_442015.1_10 Reverse -127 -140 1.88757 0.204
NP_442015.1_10 Reverse -295 -308 1.49425 0.204
NP_441226.1_7 Forward -307 -300 14.4934 0.0123
NP_441226.1_7 Reverse -300 -307 14.4934 0.0123
NP_441226.1_7 Forward -139 -132 14.4934 0.0123
NP_441226.1_7 Reverse -132 -139 14.4934 0.0123
NP_441226.1_7 Reverse -93 -100 5.64364 0.286
NP_441111.1_7 Forward -307 -299 18.7023 0.00294
NP_441111.1_7 Forward -139 -131 18.7023 0.00294
NP_441111.1_7 Reverse -300 -308 18.7023 0.00294
NP_441111.1_7 Reverse -132 -140 18.7023 0.00294
NP_442379.1_10 Reverse -292 -309 -1.73112 0.223
NP_441766.1_2 Forward -308 -299 17.5026 0.00297
NP_441766.1_2 Reverse -299 -308 17.5026 0.00297
NP_441766.1_2 Forward -140 -131 17.5026 0.00297
NP_441766.1_2 Reverse -131 -140 17.5026 0.00297
NP_441766.1_9 Forward -316 -297 -2.55715 0.284
NP_442417.1_5 Reverse -197 -211 14.2576 0.0653
NP_442417.1_5 Forward -354 -340 6.58777 0.216
NP_440416.1_1 Forward -140 -121 -11.1119 0.272
NP_440416.1_9 Reverse -292 -311 3.44104 0.0372
NP_440416.1_9 Forward -147 -128 -15.1435 0.186
NP_440416.1_9 Reverse -124 -143 -16.7168 0.22
NP_440416.1_9 Forward -324 -305 -20.2567 0.283
NP_443052.1_8 Reverse -121 -140 10.6192 0.0166
NP_443052.1_8 Forward -318 -299 4.03102 0.0452
NP_443052.1_8 Forward -150 -131 -8.45701 0.175
NP_443052.1_9 Forward -157 -138 14.5524 0.0495
NP_442154.1_1 Forward -196 -178 -17.2871 0.251
NP_440261.1_5 Reverse -300 -313 6.80412 0.0316
NP_440261.1_5 Reverse -132 -145 -1.06236 0.0655
NP_440261.1_5 Forward -307 -294 -3.12731 0.115
NP_440261.1_5 Forward -139 -126 -10.5021 0.201
NP_440988.1_4 Reverse -344 -363 6.88262 0.295
NP_440988.1_10 Reverse -135 -149 4.89883 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGCCATTTTGTACTGCGTCTAGCACCTCTAACCCCGGCACAATTTCCCCAGCGGCGTAGGGCGTAATCTGGAATTTACCCCCGGTCATGGCGGCGATCGCCTTGCAGAAGTCCTCAGCGCCCCCAAAAAGAGTGTCGAGGGATTTGGGCCAACTGGTGACCATGCGCCAACGAATATTTGGCAGTTCTCCTCCAGCGGTGGCTTGATTATTGGAGGTGGTGGCCTTGCCACAGGCAACTAAACCAGCAGCAGTTCCAGCGGCGATCGCCGATTGGCCAAGGAGTTGACGGCGTTTCATAGGGACGGGGGATTAAAAATATGATTGAAGGGATTTTCCCACAGGTTTACGGCGATATTCGGTCGATTTTGGAAAACTTGTCTTTAATTTAAAATGTAAAT

CDS

GTGATTGTTGATCAACCTAATGGCGATCGCCAAATTGGCGGCAAATTAACCATGATTGCTTCGCCCGACCTCCGACCGACCCCATTGACCCCAGAGGAATATCTAGCCTGGGAAGCGAAACAAGAAATCTGCCACGAGTACATTGACGGGGAAATCCTAGCTATGACTGGTAGCAGTATTCCCCACGATGATTTGGTTATTAATTTGCTGGGCGTTCTATTACCCCACATTAAAAGTCGGGTTTCTATTTTTCCTAAATTTCCAATGTATTGTCTTTTTACATAA

Protein

MIVDQPNGDRQIGGKLTMIASPDLRPTPLTPEEYLAWEAKQEICHEYIDGEILAMTGSSIPHDDLVINLLGVLLPHIKSRVSIFPKFPMYCLFT