Your browser is old and dusty. Try Google Chrome!

Details for ssl3451

ORF ssl3451
Accession NP_440634.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_3 Reverse -64 -83 14.8486 0.156
NP_441453.1_1 Reverse -351 -369 3.65664 0.263
NP_441453.1_4 Reverse -350 -358 12.7041 0.0314
NP_441453.1_7 Forward -63 -56 12.9205 0.23
NP_440226.1_1 Reverse -350 -369 3.83436 0.212
NP_440259.1_4 Forward -148 -134 10.7568 0.262
NP_442744.1_9 Reverse -41 -55 16.0349 0.266
NP_441675.1_4 Reverse -284 -303 2.16274 0.298
NP_442909.1_7 Forward -358 -344 5.99717 0.258
NP_440304.1_4 Reverse -45 -55 3.71661 0.293
NP_440304.1_4 Reverse -192 -202 2.7333 0.299
NP_440916.1_1 Reverse -259 -273 9.04604 0.249
NP_441352.1_2 Reverse -281 -300 8.25926 0.162
NP_440273.1_1 Reverse -75 -94 16.5674 0.236
NP_440856.1_4 Reverse -219 -238 -4.32711 0.253
NP_440856.1_7 Forward -349 -330 -9.34199 0.287
NP_441083.1_5 Forward -359 -349 6.96153 0.0717
NP_441083.1_5 Reverse -350 -360 0.275027 0.237
NP_441434.1_6 Reverse -45 -55 16.303 0.243
NP_442111.1_4 Reverse -349 -363 6.6861 0.117
NP_440747.1_10 Reverse -347 -359 -11.7607 0.142
NP_440747.1_10 Forward -362 -350 -12.2524 0.254
NP_442634.1_4 Forward -361 -347 -2.75368 0.156
NP_440376.1_1 Reverse -350 -359 7.76787 0.0688
NP_440376.1_1 Forward -359 -350 5.89959 0.116
NP_442687.1_7 Reverse -349 -359 5.68323 0.189
NP_441846.1_1 Reverse -86 -105 5.50599 0.28
NP_440667.1_2 Reverse -364 -383 -8.35868 0.289
NP_441958.1_5 Forward -360 -350 9.12481 0.025
NP_441958.1_5 Reverse -349 -359 0.963343 0.12
NP_440318.1_1 Forward -142 -123 3.73603 0.251
NP_442486.1_4 Forward -369 -350 10.0292 0.233
NP_440203.1_5 Forward -343 -333 12.5659 0.146
NP_442690.1_1 Forward -171 -152 -13.6686 0.264
NP_442911.1_2 Reverse -340 -359 -8.06369 0.226
NP_441913.1_1 Forward -62 -46 16.5306 0.246
NP_440147.1_4 Forward -361 -348 7.19745 0.0736
NP_441550.1_8 Reverse -293 -303 6.86274 0.188
NP_441550.1_8 Forward -361 -351 4.89613 0.281
NP_441550.1_8 Reverse -348 -358 4.69947 0.291
NP_441916.1_7 Reverse -350 -360 6.27322 0.102
NP_441916.1_10 Reverse -335 -354 8.84924 0.165
NP_442396.1_5 Forward -398 -385 8.08242 0.164
NP_442996.1_7 Reverse -71 -90 14.8254 0.216
NP_441725.1_5 Forward -358 -348 1.65166 0.13
NP_442941.1_3 Reverse -351 -361 -0.314959 0.256
NP_441514.1_4 Reverse -63 -82 11.9205 0.297
NP_442281.1_1 Reverse -345 -359 1.86729 0.285
NP_441079.1_7 Forward -94 -75 -5.70449 0.267
NP_442982.1_5 Reverse -340 -359 -2.36049 0.286
NP_441196.1_2 Reverse -332 -351 5.01433 0.234
NP_441644.1_6 Reverse -350 -360 9.51767 0.0747
NP_440929.1_8 Reverse -350 -359 6.78456 0.082
NP_440929.1_8 Reverse -295 -304 2.06468 0.268
NP_442933.1_1 Forward -164 -145 5.87233 0.289
NP_441751.2_8 Forward -358 -344 -3.04867 0.134
NP_442554.1_8 Forward -358 -348 3.22496 0.235
NP_442554.1_9 Forward -167 -148 12.9785 0.279
NP_442970.1_3 Forward -84 -66 14.6545 0.168
NP_443009.1_5 Forward -257 -246 5.26972 0.21
NP_440730.1_4 Reverse -47 -66 2.45773 0.237
NP_441198.1_8 Reverse -383 -393 11.3181 0.211
NP_441673.1_1 Forward -359 -350 1.27803 0.155
NP_441673.1_1 Reverse -350 -359 1.27803 0.155
NP_441826.1_2 Reverse -344 -358 -1.8687 0.257
NP_441637.1_9 Forward -80 -62 -3.91409 0.296
NP_441612.1_2 Reverse -60 -70 8.83972 0.21
NP_442559.1_3 Forward -67 -48 11.2092 0.214
NP_442808.1_1 Reverse -349 -359 7.74772 0.0697
NP_442630.1_5 Forward -94 -75 14.6508 0.263
NP_442820.1_3 Forward -143 -133 15.4175 0.267
NP_442542.1_2 Forward -361 -348 6.4108 0.227
NP_441878.1_6 Reverse -349 -359 2.24165 0.0462
NP_441534.1_5 Forward -271 -252 1.96607 0.293
NP_441557.1_5 Forward -359 -350 0.393051 0.166
NP_441557.1_5 Reverse -350 -359 0.393051 0.166
NP_441445.1_9 Reverse -329 -347 19.1937 0.092
NP_442397.1_9 Forward -359 -340 1.37609 0.283
NP_441728.2_4 Reverse -66 -85 11.5064 0.293
NP_442998.1_5 Forward -59 -49 13.7464 0.157
NP_442998.1_5 Reverse -134 -144 7.84651 0.28
NP_442998.1_10 Reverse -352 -359 12.5271 0.0457
NP_440299.1_1 Reverse -346 -359 2.87033 0.269
NP_440256.1_1 Reverse -347 -366 -7.4737 0.238
NP_440256.1_1 Reverse -85 -104 -9.14533 0.275
NP_440915.1_6 Forward -363 -349 -1.27871 0.229
NP_440306.1_8 Reverse -251 -270 0.490334 0.204
NP_441340.1_5 Forward -358 -351 3.97235 0.274
NP_440327.1_6 Forward -370 -351 5.211 0.264
NP_442714.1_5 Reverse -129 -148 4.12936 0.238
NP_441160.1_5 Forward -169 -150 0.884433 0.288
NP_440027.1_4 Forward -97 -78 0.750038 0.297
NP_443051.1_1 Forward -360 -351 6.78456 0.071
NP_439937.1_9 Forward -305 -288 -14.6131 0.287
NP_440439.1_1 Forward -362 -349 0.707601 0.179
NP_440770.1_3 Forward -115 -101 15.2409 0.245
NP_440139.1_1 Forward -365 -346 6.39016 0.143
NP_441018.1_7 Forward -356 -337 7.07928 0.277
NP_442262.1_10 Reverse -351 -358 9.47889 0.187
NP_442910.1_9 Reverse -112 -123 20.3143 0.263
NP_440297.1_9 Forward -358 -348 7.05986 0.15
NP_440350.1_5 Forward -165 -146 -4.13045 0.273
NP_442280.1_10 Forward -349 -331 5.35702 0.287
NP_442845.1_2 Forward -70 -56 3.24451 0.298
NP_441319.1_9 Reverse -350 -369 20.5506 0.147
NP_441918.1_7 Forward -125 -106 -3.44213 0.297
NP_442710.1_7 Reverse -73 -92 -7.60718 0.296
NP_440710.1_1 Forward -367 -349 -6.66736 0.226
NP_440220.1_4 Reverse -253 -272 2.55527 0.227
NP_441462.1_2 Forward -359 -349 8.53483 0.0354
NP_441462.1_2 Reverse -350 -360 0.668351 0.135
NP_441410.1_3 Reverse -341 -360 17.3057 0.121
NP_440544.1_5 Reverse -262 -269 14.5681 0.264
NP_440516.1_6 Forward -346 -332 8.75042 0.246
NP_440516.1_8 Forward -359 -350 7.07956 0.0867
NP_440516.1_8 Reverse -350 -359 5.11294 0.118
NP_442120.1_10 Reverse -41 -60 -15.1435 0.289
NP_442120.1_10 Reverse -20 -39 -15.7335 0.294
NP_440673.1_3 Forward -344 -337 6.72562 0.277
NP_440436.1_2 Reverse -323 -342 16.9065 0.203
NP_442907.1_9 Reverse -345 -364 1.96607 0.174
NP_440296.1_6 Forward -91 -73 10.6016 0.295
NP_441115.1_4 Forward -279 -261 7.58986 0.279
NP_442694.1_9 Forward -66 -47 11.7992 0.207
NP_441157.1_1 Reverse -252 -266 5.50552 0.235
NP_441157.1_1 Reverse -219 -233 5.21053 0.249
NP_441668.1_4 Reverse -282 -301 -2.55715 0.291
NP_442515.1_1 Reverse -142 -156 5.70279 0.107
NP_442515.1_1 Reverse -349 -363 1.67122 0.152
NP_441982.1_6 Reverse -132 -141 11.6259 0.288
NP_440338.1_4 Reverse -66 -85 7.4718 0.28
NP_442689.1_8 Forward -167 -150 -5.76269 0.276
NP_441409.1_6 Reverse -263 -282 -15.2418 0.285
NP_442843.1_1 Reverse -276 -295 -2.55715 0.207
NP_442450.1_3 Reverse -65 -83 7.58986 0.211
NP_442450.1_5 Reverse -356 -366 4.69992 0.297
NP_440023.1_5 Reverse -77 -96 8.84924 0.195
NP_443047.1_7 Forward -35 -16 6.4893 0.228
NP_441078.1_4 Forward -359 -350 8.35786 0.0338
NP_441078.1_4 Reverse -350 -359 7.27622 0.0764
NP_440793.1_1 Forward -53 -39 8.55376 0.295
NP_441432.1_8 Forward -360 -351 12.7828 0.0354
NP_440313.1_5 Forward -64 -46 11.9164 0.252
NP_442003.1_9 Reverse -48 -67 4.12936 0.263
NP_442489.1_7 Reverse -350 -359 1.27803 0.0935
NP_442489.1_7 Forward -359 -350 0.589713 0.17
NP_440559.1_1 Forward -358 -349 4.91628 0.175
NP_441659.2_8 Reverse -350 -360 8.04317 0.0508
NP_441659.2_8 Forward -359 -349 0.275027 0.27
NP_441022.1_1 Reverse -283 -292 10.491 0.299
NP_442008.1_2 Reverse -347 -366 5.30933 0.226
NP_440831.1_3 Reverse -349 -368 12.0176 0.153
NP_440034.1_4 Reverse -73 -85 17.9689 0.223
NP_442828.1_5 Reverse -78 -97 10.52 0.289
NP_441329.1_3 Reverse -36 -46 14.5211 0.253
NP_441329.1_6 Reverse -134 -153 4.53544 0.201
NP_441329.1_6 Reverse -136 -155 1.00224 0.245
NP_441895.1_2 Reverse -276 -295 -17.6018 0.234
NP_441895.1_10 Reverse -130 -149 -18.6834 0.282
NP_440671.1_4 Reverse -344 -358 6.3911 0.248
NP_441973.1_1 Forward -138 -123 0.27489 0.235
NP_442943.1_1 Forward -91 -76 13.1545 0.117
NP_440204.1_4 Reverse -364 -383 1.76941 0.238
NP_441813.1_5 Reverse -348 -358 3.22496 0.173
NP_442497.1_10 Forward -358 -349 0.29472 0.199
NP_440821.1_4 Reverse -348 -358 0.275027 0.19
NP_442669.1_1 Forward -233 -214 4.22769 0.137
NP_441541.1_7 Reverse -58 -76 12.0022 0.225
NP_440833.1_6 Forward -58 -44 11.4053 0.222
NP_441617.1_5 Forward -20 -1 19.0748 0.0725
NP_440546.1_4 Forward -359 -349 10.6277 0.109
NP_440546.1_4 Reverse -350 -360 8.10685 0.203
NP_441230.1_5 Forward -364 -345 -0.688862 0.292
NP_442479.1_5 Reverse -77 -96 11.2293 0.222
NP_442402.1_4 Reverse -252 -271 1.27698 0.173
NP_442402.1_10 Reverse -50 -60 10.501 0.288
NP_441848.1_4 Reverse -274 -290 12.8982 0.195
NP_442039.1_4 Forward -400 -393 7.02061 0.269
NP_442039.1_7 Forward -62 -52 11.2881 0.257
NP_441926.1_3 Forward -56 -40 5.6634 0.17
NP_442053.1_1 Reverse -350 -359 6.8829 0.111
NP_440505.1_3 Forward -361 -351 6.27322 0.187
NP_441011.1_8 Forward -358 -349 8.06287 0.16
NP_442533.1_6 Reverse -350 -359 5.11294 0.155
NP_440854.1_1 Reverse -66 -85 8.83258 0.152
NP_441219.1_6 Forward -285 -267 9.95058 0.265
NP_441482.1_7 Reverse -344 -358 6.09611 0.0343
NP_441482.1_9 Forward -292 -279 19.4882 0.278
NP_439944.1_9 Forward -358 -348 5.28991 0.262
NP_441697.1_5 Forward -92 -73 -9.40638 0.268
NP_441697.1_5 Reverse -75 -94 -9.50187 0.268
NP_441697.1_5 Reverse -74 -93 -11.3162 0.295
NP_441028.1_6 Forward -67 -57 10.6976 0.197
NP_441028.1_6 Forward -141 -131 6.86274 0.23
NP_441028.1_6 Reverse -261 -271 4.89613 0.275
NP_441527.1_4 Reverse -149 -168 -7.49654 0.235
NP_441527.1_4 Reverse -137 -156 -10.1703 0.266
NP_440007.1_9 Reverse -346 -360 0.88457 0.29
NP_439965.1_7 Forward -149 -130 10.709 0.294
NP_441106.1_3 Forward -90 -71 10.7175 0.245
NP_441286.1_1 Forward -360 -348 -4.77924 0.175
NP_440670.1_8 Forward -359 -350 8.25953 0.0703
NP_440670.1_8 Reverse -350 -359 6.29291 0.124
NP_440828.1_4 Reverse -321 -340 -8.45774 0.297
NP_440841.1_4 Reverse -348 -367 -6.29373 0.215
NP_440841.1_4 Reverse -192 -211 -10.7186 0.286
NP_441463.1_2 Forward -177 -159 -0.398222 0.29
NP_441463.1_3 Forward -369 -350 -4.03212 0.191
NP_441463.1_6 Reverse -45 -59 5.44959 0.287
NP_442365.1_7 Reverse -346 -365 -6.1954 0.286
NP_440387.1_1 Forward -359 -343 -4.85801 0.203
NP_440634.1_1 Forward -361 -342 14.6508 0.26
NP_440634.1_9 Forward -93 -75 18.2409 0.208
NP_442833.1_1 Forward -54 -40 20.1604 0.0451
NP_440766.1_5 Forward -103 -91 7.36932 0.29
NP_440766.1_5 Reverse -278 -290 7.08284 0.29
NP_442103.1_6 Forward -371 -357 18.1061 0.277
NP_440457.1_1 Reverse -346 -358 1.31728 0.241
NP_442680.1_5 Reverse -129 -148 6.81287 0.206
NP_441332.1_3 Forward -57 -38 10.2259 0.173
NP_442509.1_9 Reverse -295 -305 10.4026 0.179
NP_440554.1_4 Reverse -351 -361 5.28991 0.153
NP_441885.1_5 Forward -359 -349 7.84651 0.0419
NP_442341.1_9 Forward -361 -347 13.372 0.083
NP_441173.1_9 Forward -140 -132 12.9004 0.206
NP_441173.1_9 Reverse -52 -60 10.9338 0.242
NP_441173.1_9 Forward -287 -279 9.85212 0.275
NP_443000.1_7 Forward -361 -351 0.766681 0.29
NP_440275.1_3 Forward -361 -351 3.71661 0.215
NP_440258.1_1 Reverse -308 -327 12.2908 0.102
NP_440216.1_1 Reverse -350 -364 2.85119 0.0284
NP_440216.1_1 Forward -359 -345 -12.6851 0.296
NP_440216.1_9 Forward -62 -53 11.9961 0.252
NP_440172.1_1 Reverse -350 -360 5.28991 0.146
NP_442371.1_1 Forward -60 -50 14.0409 0.191
NP_441766.1_2 Reverse -350 -359 4.22796 0.193
NP_440416.1_9 Forward -366 -347 -16.4218 0.215
NP_442116.1_6 Forward -91 -74 5.68616 0.291
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAGATTGGGGAGTCCTTCCAAAAATAAAACCCGCTCGATCAGGCTATCGGCCTGCTTCATTGCCTTGATGGATACTTTATATTCGTACTGATTAAGTGCGTTCAGCCCCCAATTTTTGCACATGCGAGCATGGAGAAAATATTGGTTAATCGCAGTAAGTTGTAGCTTTAACGCTTGGTTGAGATGTTGTCTGACTTCCAGGTTGCCTTCCATGTTGTTATCCTCTGATGTGGAGTTTTGTTTGATGTTGTTGTTTCCATTTTTACCCATTCACGGTCCGACGACGGAGTTATTTACTGGGACAGCAATAAATTGTTTAAATTGTTTTAATGTTTTACCCCTGGGAAAATTGCCTTTTTCTCAAAGGAAGTGTCCCTCTCTGACCTTAAACTGAACCAAT

CDS

ATGGCTGATTTGTTTGTCGGTGCCCCAGTTCGTTTAATTGCCCGTCCCCCCTATTTGAAAACCGCTGATCCCATGCCCATGCTCCGTCCTCCGGATTTATTGGCGATCGCCGCGGAGGGAATGGTGGTAGACCGTCGACCGGCTGGCTATTGGGGAGTAAAGTTTGACCGAGGCACTTTTCTGTTGGAAAGCCAGTATTTGGAAGTGATTCGGCCTCAGGAAGAAAAAACGGAAGTCTCGGATTAA

Protein

MADLFVGAPVRLIARPPYLKTADPMPMLRPPDLLAIAAEGMVVDRRPAGYWGVKFDRGTFLLESQYLEVIRPQEEKTEVSD