Your browser is old and dusty. Try Google Chrome!

Details for ssl3441

ORF ssl3441
Accession NP_440649.2
Symbol infA
Category Protein modification and translation factors
Definition initiation factor IF-1
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -158 -144 7.57108 0.101
NP_441061.1_2 Forward -90 -76 2.2612 0.178
NP_440557.1_1 Forward -65 -46 2.55606 0.233
NP_440897.1_6 Forward -179 -160 4.71854 0.133
NP_441453.1_4 Reverse -251 -259 5.32929 0.147
NP_441453.1_4 Forward -159 -151 4.24765 0.259
NP_442151.1_6 Reverse -251 -265 5.80112 0.262
NP_441818.1_1 Forward -158 -147 9.3996 0.246
NP_441812.1_3 Reverse -101 -115 8.94771 0.248
NP_442861.1_1 Forward -146 -127 9.43923 0.298
NP_440061.1_9 Reverse -278 -292 7.47213 0.205
NP_440061.1_9 Reverse -274 -288 6.29216 0.251
NP_441054.1_4 Reverse -140 -158 7.78729 0.0903
NP_442062.1_8 Forward -159 -149 9.91146 0.0554
NP_440761.1_3 Reverse -13 -32 9.01981 0.263
NP_441859.1_3 Reverse -343 -362 5.50519 0.198
NP_440304.1_4 Reverse -148 -158 5.97822 0.185
NP_440011.1_1 Forward -299 -280 16.5191 0.153
NP_441935.1_9 Forward -366 -347 13.3207 0.285
NP_441594.1_6 Reverse -147 -166 13.2741 0.109
NP_442110.1_7 Forward -266 -252 -0.492064 0.291
NP_441082.1_5 Reverse -103 -122 8.94757 0.28
NP_440856.1_4 Forward -93 -74 -0.39387 0.177
NP_441083.1_5 Reverse -50 -60 -0.41329 0.267
NP_441083.1_5 Reverse -251 -261 -0.511621 0.269
NP_442827.1_8 Reverse -142 -161 5.40686 0.12
NP_442827.1_8 Forward -268 -249 -2.8529 0.29
NP_441738.1_2 Forward -264 -257 6.52862 0.261
NP_441558.1_5 Forward -161 -142 10.4225 0.098
NP_440209.1_1 Reverse -50 -58 2.08437 0.286
NP_440209.1_2 Forward -135 -119 18.0531 0.168
NP_442398.1_1 Forward -346 -327 16.1257 0.087
NP_441770.1_1 Reverse -281 -300 10.2251 0.29
NP_441770.1_10 Reverse -242 -261 13.2741 0.213
NP_440178.1_7 Forward -60 -41 -23.2067 0.298
NP_441163.1_1 Reverse -274 -291 5.44632 0.274
NP_441486.1_1 Forward -62 -48 -5.80194 0.26
NP_441880.2_10 Forward -58 -40 7.88563 0.288
NP_442634.1_4 Reverse -148 -162 -6.09693 0.299
NP_441014.1_8 Reverse -281 -300 19.0757 0.0335
NP_441014.1_8 Reverse -289 -308 -8.85033 0.288
NP_443018.1_3 Forward -158 -151 10.7572 0.0907
NP_443018.1_3 Reverse -252 -259 8.8889 0.136
NP_443018.1_3 Reverse -151 -158 4.56234 0.241
NP_443018.1_3 Forward -58 -51 4.26735 0.267
NP_443018.1_3 Reverse -51 -58 4.07068 0.299
NP_441588.1_4 Reverse -355 -365 5.19158 0.282
NP_442687.1_7 Reverse -49 -59 12.6647 0.0698
NP_442687.1_7 Forward -261 -251 4.0116 0.271
NP_442687.1_7 Forward -198 -188 3.71661 0.292
NP_442485.1_3 Reverse -281 -300 -5.01543 0.287
NP_442485.1_3 Reverse -277 -296 -5.60541 0.293
NP_441846.1_10 Forward -300 -281 -23.1083 0.277
NP_442958.1_3 Reverse -139 -158 -1.27885 0.276
NP_440691.1_10 Reverse -283 -302 11.6025 0.269
NP_440667.1_2 Reverse -264 -283 -8.752 0.293
NP_441950.1_8 Reverse -146 -160 11.406 0.186
NP_442658.1_1 Reverse -148 -158 7.15773 0.214
NP_440528.1_1 Forward -392 -379 17.041 0.257
NP_440720.1_1 Forward -300 -281 2.0644 0.263
NP_441127.1_1 Forward -91 -77 9.5377 0.272
NP_441127.1_5 Reverse -280 -299 22.0166 0.0448
NP_440203.1_5 Forward -156 -146 10.3043 0.229
NP_439905.1_1 Forward -158 -145 17.7189 0.0359
NP_439905.1_2 Reverse -283 -297 12.7826 0.208
NP_440984.1_7 Reverse -246 -260 5.01447 0.276
NP_439990.1_5 Forward -71 -58 11.0324 0.128
NP_442690.1_1 Forward -382 -363 -12.4886 0.243
NP_440153.1_8 Forward -159 -146 6.01747 0.175
NP_443055.1_6 Forward -158 -140 0.903388 0.238
NP_440138.1_7 Reverse -140 -158 17.859 0.245
NP_442002.1_9 Forward -198 -191 12.2322 0.185
NP_442002.1_9 Forward -236 -229 9.77388 0.258
NP_441646.1_2 Reverse -245 -264 19.8623 0.263
NP_440147.1_4 Forward -262 -249 4.64084 0.153
NP_441550.1_8 Reverse -249 -259 4.99446 0.274
NP_441916.1_7 Reverse -150 -160 4.40493 0.178
NP_441916.1_7 Reverse -276 -286 3.32329 0.22
NP_440383.1_3 Forward -82 -64 12.8022 0.295
NP_441041.1_4 Reverse -144 -163 -4.72043 0.141
NP_441041.1_4 Forward -59 -40 -10.1286 0.228
NP_441041.1_7 Forward -162 -150 5.76558 0.241
NP_442396.1_1 Reverse -213 -231 14.0805 0.179
NP_441725.1_5 Forward -158 -148 4.89658 0.115
NP_441725.1_5 Forward -58 -48 0.0783647 0.215
NP_442941.1_3 Forward -259 -249 -0.216628 0.252
NP_440289.1_2 Reverse -47 -60 2.57589 0.0936
NP_440260.1_8 Reverse -263 -281 -5.09406 0.273
NP_442281.1_1 Forward -271 -257 4.91554 0.176
NP_442281.1_1 Reverse -297 -311 1.5723 0.296
NP_442256.1_2 Forward -262 -244 -9.51896 0.274
NP_440647.1_9 Forward -262 -244 3.16574 0.281
NP_441087.1_6 Reverse -101 -119 -0.276578 0.258
NP_441644.1_6 Reverse -251 -261 9.41933 0.0767
NP_441644.1_6 Forward -159 -149 9.321 0.0799
NP_441644.1_6 Reverse -50 -60 8.63269 0.097
NP_442215.1_2 Forward -68 -52 0.648521 0.148
NP_442215.1_2 Reverse -168 -184 -6.23465 0.266
NP_441810.1_2 Reverse -259 -278 11.4058 0.121
NP_440929.1_8 Reverse -280 -289 4.0313 0.193
NP_442933.1_10 Reverse -150 -159 4.52295 0.24
NP_441751.2_8 Reverse -51 -65 -5.11362 0.194
NP_442554.1_8 Forward -158 -148 7.74818 0.0846
NP_442554.1_8 Forward -259 -249 5.78156 0.138
NP_442554.1_8 Reverse -51 -61 4.69992 0.176
NP_442142.1_4 Reverse -47 -60 6.60689 0.16
NP_442292.1_1 Forward -158 -149 5.70292 0.135
NP_442292.1_1 Reverse -51 -60 5.70292 0.135
NP_441711.1_4 Reverse -242 -261 3.24438 0.254
NP_440357.1_3 Forward -161 -142 -1.08219 0.297
NP_441198.1_8 Forward -161 -151 11.2205 0.217
NP_440464.1_10 Reverse -51 -61 12.0532 0.262
NP_441468.1_1 Reverse -151 -158 4.07068 0.263
NP_441468.1_1 Forward -58 -51 4.07068 0.263
NP_441015.1_10 Forward -300 -281 -10.4236 0.284
NP_441826.1_2 Reverse -258 -272 -0.688726 0.22
NP_441826.1_2 Reverse -44 -58 -1.5737 0.25
NP_441330.1_1 Reverse -246 -265 -14.2585 0.216
NP_442811.1_2 Reverse -211 -230 -0.787193 0.252
NP_442490.1_10 Reverse -287 -305 10.0489 0.234
NP_441764.1_8 Forward -237 -227 11.9807 0.284
NP_441764.1_8 Forward -199 -189 11.9807 0.284
NP_442868.1_6 Reverse -148 -158 4.50326 0.174
NP_442719.1_2 Reverse -123 -141 12.5064 0.0728
NP_442542.1_9 Reverse -295 -309 7.07881 0.211
NP_442113.1_10 Forward -160 -141 -6.58872 0.263
NP_442342.1_9 Forward -224 -208 4.28677 0.25
NP_441114.1_3 Reverse -83 -92 7.66954 0.231
NP_440558.1_2 Forward -162 -143 -4.03212 0.241
NP_440093.1_7 Reverse -174 -193 11.9958 0.219
NP_441878.1_6 Reverse -49 -59 -0.41329 0.177
NP_441878.1_6 Reverse -149 -159 -7.59145 0.245
NP_441557.1_5 Reverse -150 -159 -0.786921 0.239
NP_441557.1_8 Reverse -283 -293 13.0576 0.225
NP_441445.1_1 Forward -68 -49 3.93269 0.204
NP_441445.1_8 Reverse -289 -308 -4.81876 0.277
NP_441590.1_4 Reverse -282 -301 5.70185 0.27
NP_442350.1_1 Reverse -128 -147 13.4708 0.278
NP_442469.1_8 Forward -308 -294 12.291 0.291
NP_442444.1_6 Forward -167 -149 12.1468 0.289
NP_442347.1_10 Forward -184 -170 15.0436 0.278
NP_442645.1_2 Reverse -42 -61 -16.9135 0.245
NP_442888.1_6 Reverse -240 -259 3.14605 0.244
NP_442317.1_6 Reverse -145 -164 5.99764 0.238
NP_441728.2_4 Reverse -352 -371 11.4109 0.293
NP_442998.1_5 Forward -120 -110 14.3364 0.149
NP_442998.1_5 Forward -142 -132 11.7798 0.176
NP_442998.1_5 Forward -119 -109 9.32148 0.243
NP_440299.1_1 Forward -157 -144 2.772 0.274
NP_441799.1_1 Reverse -146 -160 5.50552 0.206
NP_441007.1_10 Reverse -145 -158 0.707601 0.219
NP_440256.1_1 Forward -263 -244 -7.86702 0.247
NP_440256.1_1 Reverse -210 -229 -8.06369 0.251
NP_440256.1_1 Reverse -248 -267 -8.45701 0.261
NP_441270.1_5 Reverse -137 -156 10.8472 0.296
NP_440915.1_6 Forward -63 -49 -2.55701 0.276
NP_440717.1_3 Forward -227 -213 7.47213 0.28
NP_440164.1_1 Forward -133 -114 4.71934 0.26
NP_440026.1_2 Reverse -165 -184 12.4875 0.297
NP_440306.1_8 Reverse -126 -145 7.37347 0.204
NP_442453.1_6 Reverse -288 -302 15.7887 0.286
NP_441939.1_3 Forward -259 -240 6.58763 0.231
NP_441199.1_7 Reverse -18 -37 3.04771 0.248
NP_441494.1_6 Forward -164 -151 9.06573 0.227
NP_442993.1_1 Reverse -150 -166 -3.67804 0.133
NP_442993.1_1 Reverse -356 -372 -9.47957 0.186
NP_440677.1_6 Reverse -314 -333 10.8159 0.251
NP_442386.1_9 Reverse -149 -158 8.06244 0.209
NP_441750.1_1 Forward -304 -285 -8.752 0.3
NP_441340.1_5 Forward -259 -252 4.07068 0.239
NP_441340.1_5 Forward -158 -151 3.97235 0.274
NP_441340.1_5 Reverse -51 -58 3.97235 0.274
NP_440168.1_9 Reverse -148 -167 -4.52377 0.296
NP_440168.1_9 Forward -305 -286 -4.72043 0.296
NP_440586.1_8 Reverse -51 -58 9.57686 0.146
NP_440027.1_8 Reverse -279 -298 4.81688 0.285
NP_443051.1_1 Reverse -250 -259 -0.0986038 0.256
NP_440439.1_1 Reverse -218 -231 -1.06236 0.249
NP_442239.1_8 Forward -295 -276 5.211 0.281
NP_439943.1_4 Forward -303 -284 4.12936 0.287
NP_440372.1_2 Forward -259 -252 4.07068 0.262
NP_442285.1_7 Forward -184 -165 3.44104 0.275
NP_440819.1_5 Forward -143 -135 7.98423 0.228
NP_440819.1_5 Reverse -383 -391 7.68924 0.266
NP_440316.1_10 Reverse -212 -222 6.66654 0.256
NP_440210.1_8 Forward -359 -343 7.92501 0.285
NP_440267.1_2 Forward -235 -221 5.21053 0.276
NP_441018.1_7 Forward -301 -282 10.9142 0.194
NP_441018.1_7 Forward -69 -50 6.78429 0.282
NP_442262.1_10 Reverse -252 -259 11.4455 0.102
NP_442262.1_10 Forward -158 -151 9.87221 0.164
NP_442165.1_2 Reverse -154 -167 18.1122 0.177
NP_440531.1_6 Forward -167 -148 -2.36049 0.249
NP_441060.1_4 Forward -149 -131 2.0841 0.256
NP_440297.1_9 Forward -58 -48 0.57002 0.282
NP_441592.1_4 Reverse -282 -301 -1.18052 0.251
NP_440894.1_7 Reverse -132 -151 17.4032 0.121
NP_440999.1_9 Forward -163 -149 -0.885388 0.22
NP_440888.1_2 Forward -159 -145 11.602 0.0635
NP_440600.1_4 Forward -268 -250 -2.83245 0.209
NP_442147.1_7 Forward -68 -49 10.8159 0.244
NP_441543.1_2 Reverse -51 -60 5.21127 0.209
NP_441543.1_2 Forward -158 -149 5.01461 0.209
NP_442845.1_2 Forward -165 -151 6.98109 0.199
NP_442845.1_2 Reverse -144 -158 6.29277 0.212
NP_442845.1_2 Forward -65 -51 3.8345 0.275
NP_441178.1_6 Reverse -285 -304 5.2102 0.268
NP_441178.1_6 Reverse -279 -298 5.01354 0.268
NP_440982.1_1 Reverse -282 -301 12.88 0.15
NP_442337.1_6 Forward -298 -279 13.6417 0.245
NP_441462.1_2 Reverse -150 -160 -0.216628 0.192
NP_441462.1_2 Forward -260 -250 -1.10161 0.281
NP_443062.1_1 Reverse -50 -68 7.18082 0.182
NP_443062.1_6 Forward -67 -48 8.55425 0.142
NP_442487.1_2 Reverse -52 -71 1.47364 0.282
NP_440516.1_8 Reverse -251 -260 7.07956 0.0867
NP_440516.1_8 Forward -59 -50 -0.196935 0.185
NP_441785.1_1 Forward -78 -64 11.3809 0.3
NP_441033.1_8 Reverse -286 -305 19.8623 0.155
NP_442428.1_5 Reverse -151 -158 4.46401 0.267
NP_442428.1_5 Forward -58 -51 4.46401 0.267
NP_441443.1_1 Forward -292 -273 4.71934 0.194
NP_442823.1_8 Forward -102 -83 10.7175 0.297
NP_440673.1_3 Reverse -253 -260 10.4622 0.139
NP_440673.1_3 Forward -157 -150 8.98723 0.203
NP_441052.1_2 Reverse -50 -60 7.84651 0.0605
NP_440436.1_4 Forward -158 -149 11.0124 0.0655
NP_440436.1_4 Reverse -51 -60 11.0124 0.0655
NP_442864.1_7 Reverse -288 -306 6.01734 0.274
NP_440648.1_1 Forward -260 -241 13.6675 0.0817
NP_441004.1_1 Forward -304 -285 -9.047 0.206
NP_441004.1_1 Forward -297 -278 -18.1918 0.298
NP_441004.1_3 Forward -59 -40 3.04771 0.264
NP_441004.1_4 Forward -93 -83 14.533 0.175
NP_441004.1_4 Reverse -341 -351 7.64985 0.294
NP_441004.1_5 Forward -94 -80 7.27608 0.292
NP_442366.1_3 Reverse -49 -67 3.3624 0.111
NP_441115.1_4 Forward -160 -142 9.85146 0.198
NP_441115.1_8 Forward -263 -245 13.2938 0.292
NP_442206.1_10 Reverse -344 -359 3.32315 0.186
NP_443054.1_2 Reverse -242 -256 0.196253 0.274
NP_442308.1_8 Reverse -164 -183 8.35759 0.263
NP_441851.1_10 Reverse -149 -159 5.78156 0.2
NP_441542.1_4 Forward -122 -108 4.03116 0.264
NP_441668.1_4 Forward -100 -81 1.67108 0.212
NP_442515.1_1 Reverse -56 -70 -1.08205 0.245
NP_440432.1_9 Forward -259 -244 3.61814 0.0862
NP_439960.1_4 Forward -298 -279 12.9783 0.274
NP_440474.1_8 Reverse -151 -165 9.24208 0.165
NP_441150.1_6 Reverse -78 -97 17.8948 0.122
NP_442450.1_5 Reverse -48 -58 6.8632 0.151
NP_440195.1_4 Reverse -344 -363 8.65258 0.207
NP_442006.1_2 Forward -297 -280 -4.77938 0.137
NP_441570.1_1 Reverse -251 -269 -8.63398 0.117
NP_441570.1_1 Forward -59 -41 -17.3854 0.273
NP_441078.1_4 Reverse -150 -159 -1.6719 0.266
NP_441078.1_4 Forward -59 -50 -2.06522 0.295
NP_441078.1_10 Forward -269 -250 14.4533 0.22
NP_442443.1_1 Forward -299 -280 -0.4922 0.224
NP_440526.1_3 Reverse -51 -62 8.71129 0.116
NP_440526.1_3 Forward -158 -147 0.844851 0.267
NP_441432.1_8 Reverse -149 -158 15.0444 0.0182
NP_441432.1_8 Forward -261 -252 5.21127 0.185
NP_441432.1_8 Forward -60 -51 4.32629 0.223
NP_441432.1_9 Reverse -126 -139 14.7067 0.14
NP_441732.1_2 Forward -183 -167 -17.4444 0.258
NP_440629.1_4 Forward -152 -133 10.2259 0.238
NP_441805.1_1 Forward -209 -190 -4.13045 0.227
NP_442353.1_4 Reverse -51 -70 11.0117 0.101
NP_440913.1_1 Reverse -148 -166 10.2456 0.175
NP_440913.1_1 Reverse -249 -267 7.39397 0.202
NP_441072.1_2 Forward -70 -51 19.0757 0.0405
NP_442400.1_10 Reverse -19 -32 10.4704 0.261
NP_442400.1_10 Reverse -364 -377 8.0831 0.279
NP_442489.1_7 Forward -59 -50 -1.37691 0.195
NP_442489.1_7 Reverse -150 -159 -1.6719 0.235
NP_442489.1_7 Reverse -251 -260 -1.77023 0.247
NP_442489.1_7 Forward -311 -302 -1.86856 0.259
NP_442489.1_7 Forward -159 -150 -1.96689 0.28
NP_441659.2_8 Forward -159 -149 4.0116 0.146
NP_441659.2_8 Reverse -50 -60 3.22496 0.169
NP_440426.1_7 Reverse -292 -311 0.196116 0.264
NP_442913.1_10 Reverse -161 -180 2.0644 0.132
NP_442913.1_10 Reverse -293 -312 -4.13045 0.227
NP_439956.1_7 Reverse -144 -163 4.52268 0.257
NP_442346.1_2 Forward -170 -151 4.81767 0.289
NP_442346.1_5 Reverse -149 -159 12.6647 0.0375
NP_442346.1_5 Reverse -49 -59 11.5831 0.0634
NP_442346.1_5 Forward -363 -353 4.60159 0.281
NP_440831.1_3 Reverse -286 -305 5.99883 0.28
NP_440459.1_2 Reverse -249 -266 8.10198 0.27
NP_440459.1_8 Reverse -233 -251 7.39397 0.291
NP_440010.1_10 Forward -300 -281 5.89931 0.226
NP_441050.1_5 Reverse -146 -164 -3.22577 0.286
NP_441329.1_6 Reverse -15 -34 1.57519 0.233
NP_441895.1_10 Forward -145 -126 -18.8801 0.282
NP_442162.1_9 Reverse -252 -259 9.28223 0.0694
NP_440671.1_6 Forward -361 -342 12.4867 0.228
NP_441915.1_4 Forward -297 -278 5.99684 0.293
NP_442140.1_3 Reverse -51 -61 6.96153 0.156
NP_441609.1_1 Reverse -188 -207 1.0811 0.197
NP_441671.1_10 Reverse -291 -310 0.786102 0.281
NP_440875.1_9 Reverse -152 -162 9.05339 0.233
NP_441813.1_5 Reverse -249 -259 5.19158 0.142
NP_440590.1_4 Forward -96 -83 -4.20895 0.258
NP_440590.1_4 Forward -158 -145 -6.07724 0.299
NP_440590.1_9 Forward -296 -278 7.78729 0.262
NP_441239.1_9 Forward -161 -149 4.8572 0.239
NP_441239.1_9 Reverse -278 -290 4.36554 0.253
NP_441239.1_9 Reverse -80 -92 3.38223 0.285
NP_441239.1_9 Forward -224 -212 3.08724 0.296
NP_441951.1_9 Forward -167 -148 1.37609 0.254
NP_441727.1_3 Forward -166 -147 7.47261 0.225
NP_441892.1_1 Forward -168 -151 5.05372 0.105
NP_441892.1_1 Forward -269 -252 -3.99273 0.253
NP_442044.1_1 Forward -164 -145 -4.32711 0.177
NP_441769.1_3 Reverse -123 -142 -1.18128 0.237
NP_442052.1_6 Reverse -48 -66 15.8496 0.268
NP_441782.1_5 Forward -326 -307 7.57094 0.283
NP_441230.1_5 Reverse -246 -265 -0.295539 0.281
NP_440462.1_6 Reverse -249 -259 5.97822 0.135
NP_442340.1_3 Reverse -311 -330 -10.817 0.293
NP_442611.1_1 Forward -296 -277 -2.95047 0.295
NP_440868.1_4 Reverse -146 -158 -0.452677 0.269
NP_441084.1_6 Forward -161 -147 12.6407 0.158
NP_442358.1_9 Reverse -143 -162 14.6508 0.253
NP_440843.1_8 Reverse -144 -163 11.9958 0.297
NP_442039.1_7 Reverse -84 -94 6.76487 0.299
NP_441811.1_4 Forward -283 -264 0.58944 0.291
NP_441811.1_8 Reverse -144 -158 7.66941 0.241
NP_441926.1_3 Forward -260 -244 11.1699 0.134
NP_439994.1_3 Reverse -355 -374 8.43855 0.291
NP_442053.1_1 Reverse -251 -260 5.99792 0.153
NP_440505.1_3 Reverse -148 -158 5.87989 0.206
NP_440505.1_3 Reverse -249 -259 4.3066 0.3
NP_441701.1_3 Reverse -140 -157 16.7551 0.149
NP_440914.1_1 Forward -260 -250 7.63919 0.228
NP_442533.1_6 Reverse -150 -159 5.60459 0.137
NP_442533.1_6 Reverse -283 -292 1.86802 0.284
NP_442322.1_4 Reverse -280 -297 15.5744 0.109
NP_441028.1_6 Forward -391 -381 4.60114 0.278
NP_441527.1_4 Reverse -20 -39 -10.1703 0.266
NP_440115.1_6 Reverse -147 -157 6.17489 0.197
NP_440007.1_9 Reverse -140 -154 2.85119 0.277
NP_441602.1_3 Reverse -145 -164 -5.9004 0.3
NP_441106.1_1 Forward -60 -51 3.14632 0.243
NP_441869.1_2 Reverse -136 -155 13.0775 0.228
NP_439903.1_6 Reverse -248 -267 3.53858 0.209
NP_439903.1_7 Forward -294 -275 9.43923 0.243
NP_442306.1_10 Reverse -145 -164 -21.7317 0.286
NP_441286.1_1 Forward -60 -48 3.48056 0.0467
NP_442674.1_2 Reverse -127 -146 6.78429 0.296
NP_440670.1_8 Reverse -251 -260 3.24465 0.29
NP_440886.1_7 Reverse -49 -59 3.8145 0.265
NP_440886.1_7 Reverse -282 -292 3.12618 0.296
NP_442382.1_7 Forward -273 -254 6.19431 0.242
NP_442717.1_4 Forward -392 -373 1.27776 0.296
NP_442072.1_9 Forward -261 -243 -22.4986 0.241
NP_442125.1_2 Reverse -30 -49 9.93088 0.0678
NP_441021.1_1 Forward -158 -139 -2.65548 0.145
NP_442459.1_7 Forward -395 -376 2.75272 0.235
NP_441463.1_6 Forward -161 -147 7.09237 0.265
NP_442615.1_1 Forward -68 -50 3.3624 0.0549
NP_441962.1_4 Forward -164 -145 -12.0953 0.252
NP_441962.1_9 Forward -309 -290 6.88262 0.258
NP_441431.1_2 Forward -162 -148 8.75042 0.207
NP_441431.1_2 Reverse -284 -298 7.66879 0.237
NP_441431.1_2 Reverse -248 -262 7.57046 0.238
NP_441431.1_2 Reverse -283 -297 5.50552 0.298
NP_441836.1_2 Forward -165 -146 -2.0655 0.224
NP_441836.1_2 Reverse -144 -163 -6.09707 0.291
NP_440114.1_10 Forward -260 -246 16.5192 0.0176
NP_440114.1_10 Reverse -150 -164 14.4542 0.0401
NP_440114.1_10 Forward -59 -45 11.111 0.125
NP_442437.1_3 Forward -264 -245 19.0748 0.098
NP_440287.1_6 Forward -161 -142 -0.0988766 0.298
NP_440293.1_3 Forward -299 -280 -6.49039 0.29
NP_440766.1_4 Reverse -253 -267 4.03116 0.137
NP_440422.1_10 Forward -51 -32 14.3736 0.147
NP_441237.1_9 Forward -158 -148 11.7798 0.156
NP_441237.1_9 Reverse -51 -61 10.5014 0.228
NP_442867.1_8 Reverse -281 -300 5.211 0.276
NP_440457.1_1 Forward -289 -277 8.59377 0.101
NP_440457.1_1 Forward -293 -281 7.61046 0.101
NP_442680.1_5 Forward -122 -103 0.169919 0.268
NP_441984.1_3 Reverse -276 -294 11.5239 0.177
NP_441436.1_8 Forward -290 -271 10.6192 0.262
NP_442509.1_9 Forward -59 -49 6.0761 0.293
NP_442514.1_5 Reverse -280 -299 12.4867 0.0538
NP_440734.1_1 Forward -218 -199 15.6341 0.194
NP_440649.2_1 Forward -338 -319 26.4505 0.00475
NP_440649.2_2 Forward -263 -244 17.8957 0.285
NP_440649.2_3 Forward -293 -274 21.7306 0.0297
NP_440649.2_4 Forward -217 -199 21.947 0.0501
NP_440649.2_7 Forward -316 -297 23.2047 0.0318
NP_440649.2_10 Forward -242 -223 22.9097 0.0431
NP_442341.1_7 Reverse -56 -70 5.40779 0.157
NP_442341.1_9 Reverse -249 -263 7.3738 0.2
NP_442341.1_9 Forward -295 -281 5.40719 0.271
NP_441756.1_5 Reverse -284 -303 3.04771 0.205
NP_441173.1_9 Reverse -126 -134 12.9004 0.206
NP_440191.1_4 Reverse -192 -202 13.2451 0.282
NP_443000.1_7 Reverse -249 -259 0.668351 0.293
NP_440727.1_2 Reverse -142 -161 -4.6221 0.295
NP_440091.1_1 Forward -63 -51 -0.846001 0.293
NP_443010.1_10 Forward -162 -145 4.5102 0.229
NP_441105.1_3 Forward -170 -151 4.62101 0.077
NP_441105.1_3 Forward -302 -283 2.0644 0.107
NP_440216.1_1 Forward -311 -297 -3.04867 0.0682
NP_440216.1_1 Forward -260 -246 -3.63866 0.0849
NP_440678.1_9 Forward -164 -145 8.94757 0.279
NP_440172.1_1 Reverse -150 -160 13.8447 0.0175
NP_440172.1_1 Reverse -251 -261 10.0098 0.0572
NP_440172.1_1 Forward -59 -49 4.99491 0.157
NP_442371.1_1 Forward -143 -133 15.7125 0.142
NP_441766.1_9 Forward -305 -286 0.687771 0.246
NP_443052.1_3 Reverse -25 -44 18.2878 0.208
NP_443052.1_9 Reverse -285 -304 7.37428 0.134
NP_443052.1_9 Reverse -281 -300 -7.08038 0.293
NP_440261.1_5 Forward -158 -145 -4.89726 0.178
NP_440261.1_5 Reverse -281 -294 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCAAGCAATTTTTCTCGATGAGTTGTTGGTTAATATTGGTCACCGTACCCATTGGGTCATTAACTTAAAAGTTCCCGACGAAGTAATTGTAGAACGCCTGTTGGCCCGGGGGCGGGCGGACGATAACGAAACCACCATTCGCAATCGGCTGTTGGTTTACACAGAGCAAACTGCTCCCCTCATGGCCTATTACCAAGAACAGGGCAAACTTTACTCCCTTGACGGTAACCAGCCGGTAGAAGCCATTGCCACCAACCTGGAAAAATTGGTTAAACCTTAGGGGCAAAATGTCAAGACGAGCATAGGTTGGCCAATGGAGCAACCTATATTTGTTGTGATTGACGATGGCGCTTTTTTCGATACTTTATTCCGCTTTATTTTTAGGAGGTCATTAACCGC

CDS

TTGTCTAAACAAGATTTAATTGAGATGGAAGGCACGGTGATGGAGTCATTGCCCAATGCCATGTTTAGAGTCGATCTTGACAATGGTTTCAACGTTTTGGCCCACATCTCCGGCAAAATTCGTCGTAATTACATCAAAATTCTCCCCGGCGATCGGGTCAAAGTAGAATTAACCCCCTACGACCTCACCAAGGGGCGCATAACCTATCGTCTTAAAAATAAAAAGTAG

Protein

MSKQDLIEMEGTVMESLPNAMFRVDLDNGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLKNKK